4N59A

The crystal structure of pectocin m2 at 2.3 angstroms
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
270
structure length
262
Chain Sequence
ATYKVKDVTTGAEIEVPDDKYILDEFEKQGVNLPYSCRAGACSSCVALISSGEVDQSDGSFLSEKQEKKYILTCCSYPKSDCTIETGYEDKILEDFEIELAETGLEFFNDLKDSLPRSGEILSGVTAPFEAFDHYLFGNGVERSININDVGFNINVSQIPPIMSLLNGKNVGRFDIGSDFVRNTALDGYSVAAYLGNITMRTEGVLNVKSDGTWQYEGVIRSYNDTYDANPSTHRGALGEWSGTPYEIRIPGELKIKENGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the atypical bacteriocin pectocin M2 implies a novel mechanism of protein uptake.
pubmed doi rcsb
source organism Pectobacterium carotovorum subsp. brasiliensis
molecule tags Hydrolase
molecule keywords Pectocin M2
total genus 78
structure length 262
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF14859 Colicin_M Colicin M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.140 Mainly Beta Beta Barrel Porin Porin 4n59A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4n59A01
1N63A 3AV8A 4HROA 1FXIA 1NI3A 1TKGA 1N60A 5MPOA 1SF0A 4N58A 1RYJA 4ZHPA 1JWAD 1XLNA 3SFEB 1N5WA 1WWTA 1IUEA 4YSZB 2L83A 2MH7A 1YJIA 1XLOA 2WDRB 4FZLA 1EWYC 1V8CA 1WXQA 1XLQA 1FRDA 3PO0A 4YSXB 1PDXA 2Y5CA 2XMXA 2CJNA 1WYGA 2QIEB 1OFFA 2PIAA 2K9XA 1FRRA 3VRBB 4HRSA 1AYFA 3AN1A 1JALA 4N59A 2K22A 3AEBB 2Q5WD 2BS2B 3W5VB 4C7ZA 2PVOD 1QF6A 3P4QB 1JQ4A 1SIJA 2W55A 1YJJA 3AEAB 3P63A 3CWIA 1N5XA 2DWQA 3WCQA 4YTNB 3AEFB 1YQ4B 2B76B 5C2TB 1J7BA 1NEKB 2HTME 1FIQA 5EE0A 3B2FA 2M19A 2PKOA 2W3SA 1RFKA 2BS4B 1QOAA 5H8YE 4ITKA 2XTQA 1L6VA 1V97A 1NVID 2K5PA 1WRIA 1QT9A 3DWMA 2MJEA 1CJEA 2E3TA 1JRPA 1L5PA 2ACZB 2CJOA 3AE8B 3AEEB 3P4SB 2WU5B 4WQMA 3NS1A 3AEDB 3AEGB 2KAJA 3FAHA 1L0VB 1KF6B 1N61A 3ETRA 5GXGB 1GPXA 3EUB2 3HRDD 3NVYA 1VLBA 1SB3C 2H88B 3KWLA 3NVVA 4KX6B 1F0ZA 1E10A 3B2GA 3SR6A 2BS3B 3AE9B 4N6EB 2AX5A 4IDIA 4USAA 2JX5A 3AE7B 4YSYB 5G5GA 3RPFC 2PVGC 1N62A 2XTRA 5EE3A 3FC4A 3AE1B 1JROA 4C80A 4JWUC 2WS3B 3ZYYX 4C7YA 1ZOYB 5EE9A 1KFYB 2BT6A 2WP9B 3BIID 4WWMA 5H92C 1RWSA 1TJEA 5C3JB 1FFUA 3LXFA 3AM9A 4G75A 4P6VF 4ZOHC 1TKYA 3LB8C 1KRHA 2QJLA 3CIRB 1WGKA 1PUTA 1TKEA 1FO4A 1JWBD 3L4PA 1CZPA 4US9A 1QOGA 2OHFA 1J7AA 1A70A 1UWMA 1QLBB 1FMAD 5AUKA 1OQQA 3AE6B 2H89B 3AB5A 1QOBA 2CU3A 1QOFA 1TYGB 3DA3A 4YTPB 3VR8B 2W54A 3HUIA 2G1EA 4ZHOA 4YT0B 1DOYA 2WDVB 4JWSC 3AE5B 1RM6C 1DOIA 1ZXIA 3W5UB 4A9AA 3AH7A 4YXDB 1JW9D 1NYRA 2MJ3A 1I7HA 4FZNA 1L6UA 1E7PB 1XO3A 2WQYB 1ROEA 3W9CB 2WU2B 3SFDB 3DA4A 3HVZA 1E6EB 1E9MA 2EKIA 5EE1A 4FZMA 1E0ZA 4JX1C 5G5HA 2WDQB 1DOXA 3B9JA 4LTUA 2WLBA 3P4RB 2N0SB 3AE3B 5AUIA 4YTMB 4US8A 1R7SA 3NRZA 2M56B 3AE4B 1J7CA 1NYQA 2LEKA 2MJDA 1VDVA 3ABVB 3P4PB 2W3RA 1B9RA 1AWDA 1ZP0B 2DBYA 1T3QA 3DWGC 3VRAB 1YQ3B 1FXAA 3P1MA 3AECB 1FM0D 3AE2B 4G76A 1XLPA 2KMMA 3VR9B 1GAQB 1DGJA 1OQRA 3AMZA 3NVZA 4FXCA 2JQRB 1VJKA 2L52A 2FBWB 1ZUD2 1PFDA 1NENB 1FFVA 3NVWA
chains in the Genus database with same CATH superfamily
3AV8A 3T0SA 1YX6B 2KN4A 3OJ4B 1WSPA 5BYQA 1KLVA 1E90A 4WAAA 4YSZB 5FR3A 1WYWB 4EE2A 2WDRB 3LJ3A 2CR5A 1ZW7A 2SAKA 4GDKB 2C7NB 4C7ZA 1YMHE 4XE0A 4MDKE 3EFUA 4TMAB 4ANVA 1N5XA 1WR1A 1NI2A 5IN7A 5G26A 2WXIA 5HKHA 4G3XB 1BUIC 1SJHD 2NTSA 5BYSA 1KLGD 2CS4A 3V62A 5LXIB 2E3TA 1MM5A 4GDKA 2Y0LA 1P3QU 5JXVA 2DLBA 1N61A 2MSED 2PMVA 3B2GA 3AA7B 4KV2A 4YSYB 3RPFC 2LXAA 2N9EB 3Q3OC 2XK5A 5EE9A 4DHJD 2LGSA 1IP9A 1MG4A 2KZRA 4LDTD 1RWSA 5C3JB 1SBBB 2XG6A 3W2DA 4BBNF 1HXXA 4KR4A 2FIFA 1QZEA 1E8WA 3CIRB 3VZUX 1QOGA 1WJUA 2LZ6A 4W9FA 3EECA 2N7EA 2G1EA 1Q10A 4C4VA 3SYBA 3DBHI 3EGRA 3EA6A 2O4VA 3TBLD 2W9NA 3QHTA 4LNKA 4OZBA 1JW9D 1KTKA 4KKJA 1F1HA 2V3NA 4MGKE 1Q1OA 1UH6A 5EE1A 2AXTO 5TR5A 1ZDXA 4LTUA 1H8CA 1C77A 2WJRA 1MHHE 2JSVX 2W3RA 4DHZB 1L0YB 4E1SA 1T3QA 4LDTB 2V1YA 3HM3A 4G76A 3VTWA 2GRIA 3IVFA 3R3MA 3PREA 4IG7B 3C5OA 3DHIC 1MHXA 2N9XA 3H7PB 4XNKA 2PJHA 5B66O 4G11A 1XLOA 1YQBA 4WJPA 3RYTA 3TZGA 4TSSA 1SEBD 1WJ4A 3D32A 3DVGX 3R66C 2BYVE 2QEJC 4L23A 1U4AA 1QF6A 3P4QB 2W55A 3AEAB 2DAFA 2KANA 4B61A 1WXVA 2B76B 1VZ8A 3DZMA 5EE0A 2KKCA 4IWPA 2N2MA 3O65B 2X8XX 1QT9A 4GN1A 2WU5B 1MG8A 2C5LC 4I6PA 4OVVA 2KTRA 4E3CA 4OVUA 2O2VA 3N32A 2MRPA 1VCBA 2PVGC 2MBEA 3MJ5A 5ADXK 1HXUA 2LD9A 1ZHWA 3U7ZA 4HVBA 1KFYB 4RLBA 4FBJB 2CHXA 3RFZB 4AYID 5JHBA 3E9SA 5JHAA 4REZA 4HKZE 2HTHA 4AOFA 4BZAA 1GJZA 2G45B 1TTNA 4I6LB 3GP7A 4HDQA 1UF0A 2RPQA 3RI7C 3ML8A 2AQ1B 1KJTA 2KTFA 3AE5B 3VQIA 3RT3B 3ML9A 3DDCB 3HM6X 4BAXA 3PORA 4AFKA 2YNKA 4XYCA 2W80C 3AA6B 4JX1C 5D94A 2LJ5A 5EE2A 3ENEA 1OQYA 1GFOA 1KH0A 1XXGA 3AU5A 1EUVB 2KZ7A 1F9JA 3EFCA 2KTRB 4NZLB 4ZRIA 3DWNA 3RNBC 3C0RB 2AL3A 3GE3C 1M4VA 1PRNA 4L1BA 3HOLA 3GS2A 2C7HA 4O49A 3AXCA 2WXQA 5C23A 2ONQA 2N1WA 5GTHO 3ZUNA 4FHJA 1SF0A 1XLNA 3LK3B 4DHZE 2BQQA 1RRBA 3HHMA 4RF0A 4NY0A 1D6EC 4W9DA 3DCGA 1SE4A 2KYWA 4N59A 1EF1A 2R2OA 1XCTL 3QK0A 1K53A 3JYUA 4EZJA 2DWQA 1STEA 3BRYA 2IGGA 4XC2A 2KXPA 2L3ZA 1MPEA 3LK2A 2MBOA 3WALA 2X9KA 6PRNA 3AE8B 3OJ3A 4A3PA 2WHIA 3AEGB 4GF4A 2R4NA 2PE9A 3W1SC 1EF5A 2DZJA 1J0GA 3AAEB 1P0RA 1TZOA 4MACA 3BWUD 2BKFA 4AYDC 1VZ7A 4NJ6A 2R8AA 2TSSA 3LXFA 2PLPA 1PUTA 2XK5B 1GOZA 4HJGE 4DK5A 2ZVOA 1C9FA 4J6IA 2K0LA 2ON8A 3ZRFA 3ZXVA 3ZKJC 4RFBA 3SY9A 3GOEA 4YXDB 3N1XC 3MTNB 1K51A 2WQYB 5E79O 2QSDA 4LNOA 2JY6A 2NBWB 1HTQA 3KWVA 1J7CA 2ZW0A 2C7MB 1VDVA 2O2VB 3P4PB 2WXOA 3VFKA 3UQBA 1ZP0B 3Q3FA 1AW7A 3SYSA 1WH3A 4DXAB 4TQ0A 5E6NA 1OQRA 3AMZA 1VJKA 2J0MA 5HI1A 2R4OA 1PYWD 3L08A 3VZWX 5IYUA 1RYJA 2M1MA 4JFBA 1LQBA 4M02A 5FK9C 4K3CA 3LDZE 5CHFA 1EWYC 2FUG1 4YSXB 3WAMA 1GFNA 4ANWA 3BVMA 2CU1A 3W5VB 4BVUC 2ZVNA 3NUHB 4MH8A 5L83A 2LUMA 1TS5A 1KM7A 4MGYE 1BH3A 4GOCA 1YQ4B 4WWPA 3AAAA 5J17A 1MJDA 2JT4B 5BMGA 2BF8B 4FLHA 1P7EA 2IDYA 1CJEA 4DWFA 2AEHA 1SGHA 2J1NA 1B1ZA 3PHWB 4FQEA 4XDDA 2IGDA 2C60A 3C19A 3M63B 2H88B 4HWIB 1CMXB 4OZCA 4MM3B 3BRZA 2VH1A 3NS8A 3WI5A 2HE7A 1G6JA 2NS5A 1N62A 2LGYA 4ACFA 2BB6A 2VH2A 1GB4A 3LK3A 4ZRKA 3ZXRA 3A9JB 1YN5A 3L4PA 1FNVA 3FYXA 1IZNB 2J42A 1QKZA 2WXNA 2W54A 1YD8U 5G55A 2BGFA 2B3AA 1KLUD 3K19A 2XEWA 4OZAA 2D3BA 1WIAA 1XO3A 2V0GA 4PJ0O 3ZRCA 4BKSD 1C78A 3PRZA 2WDQB 3VUYA 4D65A 1OPFA 4PK1A 4WWOA 4K7UA 4D64A 2O6VB 3NG0A 2WXRA 3NOBA 4JL9A 4QAYA 4W9EA 2L05A 4LSIA 2NPTA 1HA5A 1I4GA 1BXWA 4LSFA 3DWGC 1ZKHA 2KFKB 3AE2B 3N1ZC 4NNJB 2WGSA 4IWOA 1GAQB 3R2TA 3PV1A 3ZNHB 2L52A 3A4RA 2FBWB 5EDSA 1R4NB 1N63A 2O6VA 2IGHA 2ZNVC 1D5MC 3DHHC 3DQVA 2L83A 2KFKA 4LNFA 1I4PA 2IJ0A 1GC7A 2JZPA 5D3DA 4EZLA 2KC0A 4C4VB 1KOTA 2RD0A 3NHEB 3V8UA 4M00A 3IT6B 2JXXA 3K9PB 2JYTA 3AA0B 2CKHB 3ZNZB 1SE2A 1SIJA 5E6OA 2XNAC 3ZQ4A 4N75A 3ZTCA 4WJOA 4KZCA 5HHDG 2K6QA 1NVID 4WH4A 1QILA 1QJ9A 5B5EO 2DZMA 2WXGA 3QCAA 3AA6A 2KXPB 4AWJA 2K8CA 3V61A 5FVNA 3HRDD 1FCLA 4KX6B 3N9YC 2KXJA 3SR6A 1AN8A 2ZJDA 1HZ5A 1BT0A 1OEYJ 1IBXB 1JWMD 4U9CA 2WS3B 4IKGA 3RNEC 5H92C 5DL8A 3VE1A 4KSKC 4F4BA 3V3XA 2ASQA 4A20A 3TEWA 1Z5SB 4HPPA 1TGZB 2L32A 4G0NB 1A70A 1F2RI 4WQOB 3ZJVA 4FJVB 2M0XA 2ODJA 2IPKD 3QWZB 3HUIA 5T8IA 4GCPA 5DL5A 1GNUA 3WU2O 3P42A 1MI0A 3UPGA 3QQ8B 3W9CB 2R88A 4D2KA 1P9DU 2MA9B 3MHZA 2KDEB 2DENB 2JZZA 2MBHA 3AE3B 4LLGM 3AA7A 4P7IA 1NYQA 4KR8A 4O3YA 4BFRA 3QX1A 5CHVC 3VRAB 4AKRA 1YIWA 2EMSA 2RDBC 5IKCM 1UBIA 4M0WB 3VR9B 3AAEA 2D5GA 2RSUA 1C1YB 1I4HA 3A9JA 1IPGA 3P2BA 2L0FA 1T6BX 2J53A 1NI3A 4S17A 4WWNA 5MPOA 1QJPA 3KH0A 2JWUA 1F2RC 4A55A 3M62B 2FAZA 4FESA 4II2B 1SXTA 4AKRB 4UDUC 2MH7A 4HKQA 1ACCA 2OJWA 2PIAA 3VDZA 4KRAA 4DDGD 1ESFA 2G9HD 5CTRC 1EU3A 3TEYA 4IC7B 3A2SX 4AQ7A 1XD3B 2N9PC 1FIQA 1TIFA 2M19A 1GFPA 2M0AA 2KLGA 2RDHA 1CK1A 1L5PA 2CJOA 4FRXA 3P4SB 2DX5B 4S0RA 2IZVB 1SB3C 4DXGA 3DOWA 3EMNX 2IY1B 2D3GA 3KW5B 4RGMA 3ZNGC 2N7JA 3PPAA 2WYQA 3OAWA 4ZRPA 3S2AA 2BT6A 1TY2A 2WVPA 3IXSA 1TJEA 3ZJUA 1L4DB 3BK2A 3TUOA 1TKEA 1S5LO 1H6S1 2LVOA 5G39A 3N3KB 1E8ZA 5AUKA 1HEZE 2CHWA 2RR9A 2REXA 2W82A 1P4TA 4YT0B 4FSPA 2WDVB 2M06A 2MBQA 2K0PA 2KJHB 4I6NB 3VXWA 1E7PB 2LASA 1IYFA 4IOIE 4W9IA 2XBBC 5FKAC 4FZMA 2BPSA 5D3IB 1SSNA 5AZFA 2MW5A 2J0JA 2MJDA 4TV3A 1E7UA 3L16A 1BXTA 3PS6A 3NSGA 3AU4A 3X0WA 2J4XA 1FXAA 4CQNA 3AECB 4HLEA 2NPTB 3DVNU 2JQRB 2LGXA 1OEYA 2J7QB 4PR7A 2BTEA 4HROA 4HDOA 4AUIA 3RULA 2ERVA 2WDTB 1N5WA 3ZIMA 3PTFC 3ZLZA 1PHOA 3DVGY 2J0KA 3A1QB 1SE9A 4UB8O 1PDXA 3TSSA 3MC8A 4ICVA 5FR6A 2QIEB 1FRRA 1UGMA 2BB5A 4FSOA 1NDDA 1YJ1A 4O1NA 1XCQL 2JRHA 1SJED 3Q2AC 2WJQA 3GZNB 4RL9A 2Y5PA 3A0HO 2IO0B 4YWGG 1QOAA 3FKYA 4MELA 4B0MA 3ECIA 3CSTA 3ZO5B 2JF5A 4KDLB 2KX0A 3FAHA 1R4MB 1KF6B 3TL5A 1F0ZA 2BKRB 1D3ZA 2R89A 3RMKC 2DZKA 3APDA 1QQRA 4A6QA 1V6EA 1ZHZA 1V81A 4EKUA 4P1BC 2J4UP 3QJZA 1FFUA 2FCQA 4LSHA 3ZVVA 4G75A 3LB8C 2QJLA 1WGKA 4NJ7A 4AUQC 2NMQA 4ZDVA 1ZHXA 2OHFA 2I38A 1D4BA 2PEAA 2OJRA 3DA3A 2JWZA 1YOVB 2SEBD 1GFQA 3DHGC 1C3TA 5LNK1 3R8BA 1DYQA 3K9OB 3T8MA 5GTIO 2G3QB 2N0SB 4ZYNA 4YTMB 1QJ8A 5D6JB 2I1KA 2K4TA 3PGRA 2JYEA 2BW2A 2INNE 2LMCA 3DBSA 2DAJA 3GB1A 1HXYD 1RAXA 2IO3B 4B0EA 4JIOU 5JZEB 4MGIE 3KYCD 1XT9B 1WI0A 1YN4A 3WIMA 2K6DB 2D3AA 1WWTA 5LLIA 4BOSC 1E5WA 2KK8A 1E7VA 4H2AA 2PE6B 3DBLI 3AN1A 3JSVB 3ZJTA 3P63A 1TS4A 3LYYA 3IT4B 5G3AA 1HE8A 3WCQA 2W3SA 2K1FA 3PRPB 3JW0X 3POXA 3NS1A 2VZKB 3ETRA 2F1TA 4AS1A 5DPSA 2KD0A 2V3PA 3H1UA 3UIOB 3T3NA 5TISO 1Q9FA 2AX5A 2GLSA 4GDLB 4USAA 3AE7B 5C1ZA 4FN2A 2IWVA 2K8HA 3BVGA 2K39A 2BVCA 4LSEA 1V9JA 4KDIC 2KDIA 4GMVA 3ZDTA 2R61A 3AM9A 1XF5L 1TKYA 4AYNA 3SU8X 1FO4A 1JWBD 4PUXA 2AQ2B 2DNFA 1FNUA 3AE6B 3AB5A 2Y7SA 2CU3A 4C00A 2G4DB 2ICIA 4LNNA 2NBVB 4JGHB 4K3BA 1RM6C 1WZ3A 2KDBA 3PT2B 4XWWA 3IFWB 1VZ6A 3WI4A 3UF8A 4RCOA 3SFDB 2PORA 3Q8BA 1E6EB 3NZUA 4GLSC 5G38A 5TSSA 3POQA 5AUIA 2ZPYA 3AI5A 3VTUA 4Q2JA 4XX5A 1AWDA 2Z8LA 2DZIA 1YQ3B 2D11A 4CO7A 4DXFA 2BWES 3TEXA 1FM0D 3VY9X 1UGJA 1ORMA 4HPLB 4IUMB 3AH7A 1NENB 5C2TB 4O4UA 4XZ4A 4N58A 2AYOB 1TS2A 3DBRB 4PYZA 4FZLA 1UBQA 1PGBA 1ZE3D 3RNCC 4BKSA 4MGZE 5PRNA 4RF1A 2CJNA 3NJTA 3OG5A 4DDID 5AFUL 2KJRA 2IWWA 4LNIA 4M8NA 4NPNA 3CWIA 4J3OD 4TUUA 2LJIA 4YTNB 3GP6A 2ZZPB 4URKA 3N20C 5D2MB 4O3WA 5GV0A 4XDCA 4AKMA 1C4CA 3AEEB 5G5GA 3SY7A 3QIJA 4M0WA 2R4LA 2JX5A 3RCZA 5HFYA 2GB1A 4C69X 3KZIO 4TQ1A 1V5TA 2INDC 4HPMB 3ZGZA 2QMTA 2WP9B 3RZFA 4PS7A 2KNBA 4NAWA 2L0TA 2HJ8A 4CYEA 4XGAB 4IW0A 2LFIA 1ET6A 3C8YA 4IWQA 1OQQA 2H89B 2N7DA 2ZCCA 3AA1B 1TYGB 1ENFA 1E54A 1UD7A 2LVPA 4JWSC 3TEZA 1WRDB 2V9HA 2WX1A 4FADA 4E71A 3JCUO 4GIVA 2KC2A 1NYRA 1T5XD 2EKEC 4MSQB 3WAOA 4MJSA 2BYEA 2R4PA 2R2QA 5AEKB 1E9MA 4LCDE 3VE2A 1WX9A 2DYOA 1I42A 1WZ0A 5G2NA 4KGRA 3H9DA 2YLMA 2Z0DB 3ABVB 3PLVA 1B9RA 3IAS1 4NQKE 3KQ4A 2XE1A 2A4ZA 3CMMB 3DVNV 3A1QA 3PZ7A 3I9V1 2KOXA 2N9LA 3U52E 3KUDB 1L6UA 1FFVA 4ANXA 4X57B 2MP2A 2MHLA 1N60A 2KMAA 1FXTB 4ZHPA 1JWAD 3J9CA 3OWEB 2YPVA 2N1VA 4F1SA 1X1MA 2JZ3B 3VUWA 2ZEQA 2LFUA 4HRSA 2KLCA 2KWVB 1L2NA 2PVOD 3U8ZA 1YJJA 3U4EG 3UIPB 2YVCA 2Y3AA 1LGRA 2IBIB 4O3ZA 3U30A 4MSMB 3MC9A 5IO9A 1C76A 1Y8RC 3SD5A 4MT5A 4DHJB 2ACZB 2MX2A 3APFA 2JMMA 3GE8C 4N74A 1GPXA 1ZDVA 3E56A 3L17A 3NVYA 1JRUA 3NVVA 2D2QA 4XWTA 2FCSA 4FOZA 3QARA 3AE9B 1ISNA 3TCAA 2KC1A 4JPSA 3KUZA 4IDIA 2LXCA 2NBUA 2HDEA 2FUHB 5I4DA 2PPHA 3AE1B 1JROA 2UWQA 3TIXA 5KHQA 4AJWA 2GOWA 1C79A 3PZ8A 2Z59B 4UB6O 2XE5A 3Q3MC 4PYUA 3T9LA 2V4IB 3URYA 1WJNA 4US9A 3UINB 1J7AA 2OMFA 2ZCBA 4JCHA 3DBLB 1WX8A 3SHQA 1QOFA 3RBHA 4LK0M 2MQJA 3UI3A 5HG2A 3QRCA 3MC0B 3VH4B 4FZNA 1K50A 1ROEA 4EOYA 4KZ0A 3WAPA 3HVZA 4GHBA 5G5HA 3CF6E 2DYMA 3PQUA 3H8HA 2WXKA 3NRZA 3RNGC 2QCZA 2X27X 4KGSA 2KX3A 2YEPF 3DBHB 3TMPB 2KMCA 3RUIB 1UUPA 2QHOA 1C4AA 4EEWA 2FE8A 3VZTX 2PW9A 1PFDA 4RJWA 2FGRA 3LK41 4KIKB 1UNSA 4KVGB 1YJIA 4NAWB 3Q8AA 4RGNA 3PRMB 1V8CA 3NY5A 2LHFA 2WWZA 2K9XA 3VTVA 3MFGA 4MEMA 1YN3A 1JQ4A 1YS5A 4ICUA 2AL6A 4OW0A 2NCNA 3N1YC 1LFDA 3M3JA 4RJXA 2KHWB 2LI5A 5DPWA 4FRTA 1E8YA 3R2IA 2GE4A 2J52A 1JMLA 5GXGB 1D5ZC 3A0BO 5BMIA 1Q9GA 1XQQA 1EU4A 4PS3A 3V60A 3B1LX 1E10A 2WX0A 2IO1B 3PSEB 4A8XC 1MPFA 3I5JC 2MLBA 3PGUA 2ZFGA 3BIID 4KIKA 5DL7A 2QC8A 1YNTE 1UZXB 3GZNI 1WM3A 3R7RA 1MVKA 4GDLA 4AZLA 2KDFB 5H2FO 3JTYA 4NQLB 2LUEA 1LXDA 3A33B 1T0YA 3H7SA 1DOYA 1WMHB 1JWSD 3R7QA 3EC8A 1ZXIA 3KVFB 4ZRJA 2AWTA 2L7RA 3VAWA 1WXMA 2RMMA 5CHWA 1HQRD 2WU2B 2JXTA 1WGHA 2WXMA 2EKIA 3I57A 4II3B 3W1YA 3Q8CA 2M56B 2KWUB 1WX7A 4LJPB 2GBJA 3JVZX 1IBXA 1K8RB 3P1MA 1BT9A 3BINA 2YEPB 4K7WA 4L2YA 4RMAA 3QC8B 2RDGA 2K8BA 2QILA 4P1CC 2KWCA 5AZHA 1Y56A 1M94A 2KFJA 1I35A 2EMTA 4WAFA 4A3OA 4GU2A 2D07B 2RGFA 3L0WB 3O13A 1WYGA 4HK2A 4B6WA 4M01A 2M4NA 2KT7A 3AA1A 5KAIO 1T0RC 5E6JA 1G90A 3A9KA 2IO2B 2IY0B 3WA0A 2F1CX 2N2LA 1LM8B 2XTQA 1L7YA 1WXSA 4K1RB 3UU2A 3B08A 8PRNA 3QRAA 2FCNA 4WIPA 4AJYB 1FCCC 3M95A 1GC6A 2V3SA 2KZ7B 2KO3A 2VRRB 4GB9A 4FMSA 5DPRA 3MHSD 3V6CB 1YX5B 3ZNID 4JWUC 3ZYYX 1ZOYB 1T1LA 2KQSA 4HXDA 1THQA 2OOBB 2FIDA 1PGAA 3HIZA 1I4QA 3Q14C 4KSLC 3X23A 2QDFA 1UELA 3AA0A 3VR8B 1E8XA 3PLUA 2Y0HA 1GB1A 2XE2A 1T16A 2CHZA 3KYDD 4CTDA 1PQSA 1MFWA 3RZWC 2WXJA 3DA4A 2I1JA 1E0ZA 1L0XB 3VH3B 2HJ1A 2M8SA 2MWSB 3LK2B 1N6ZA 2BYTA 2K3UA 4HEA1 3AE4B 4HCPB 2MCNB 2Y2XA 2KN5A 5DL6A 1WFYA 3TJPA 2DYBA 1WY8A 4RGOS 4MM3A 1H4RA 2LRWA 1ZUD2 1FXIA 1GG3A 5IP4D 1Z2MA 1PGXA 4BBNC 3N30A 1WGRA 1WXQA 1FRDA 3PO0A 3JSVA 1S1QB 2WNMA 1AYFA 1JALA 2Q5WD 3PQSA 2KJ6A 3DWOX 1VD2A 1NEKB 2JPHA 3MJWA 3HK0A 2NTTA 4WJNA 1TBEA 3SZVA 4ITKA 3Q3NC 3Q8EA 3NZ3A 1JRPA 4A90A 4FUVA 2KAJA 4GXBA 4OHJA 1MM4A 3EUB2 5J18A 4AP4C 4WJQA 1GFMA 2INCC 3MP9A 2XN9C 1J19A 1P1AA 1WJ6A 3BY4B 2WXFA 2NR2A 3BYYB 4P6VF 4B95A 4NAMA 3PF1A 2GMIC 2N9KA 2LRUA 1K52A 1R4NI 1UWMA 3V6EB 4N9F4 3HOEA 1QOBA 1SE3A 1V5OA 3L54A 1GUAB 5D5DA 1ZPSA 1WE7A 3UAQA 3PGSA 2MBBB 2UU7A 2ZW1A 3L10B 2Y0KA 4BKGA 2MJ3A 1I7HA 2KVRA 1VRAB 1WR6E 3RNAC 4EUTA 3SDLC 3VUXA 3ZW3A 2FNJB 4GSWA 2EELA 1DOXA 3B9JA 2LVQA 2ZPNA 2JUOA 3WANA 5DPTA 2I2YA 3RNFC 2M17A 5BO4B 3QAQA 1WM2A 2NVUI 5E6PA 4IL6O 1Q0WB 1ZHYA 2WXHA 4W9CA 4FXCA 2K25A 4BUMX 1T0SC 3G7GA 4O4XA 1IGDA 4QQ1A 3EHVA 2D3CA 3NZSA 2MEKA 3SFEB 5ADXL 4MH0E 2FCMA 2M07A 1XLQA 2Y5CA 2L1AA 2K22A 3AEBB 3H6NA 2WXLA 2BS2B 4RNAA 2JVCA 4RLCA 3VHTC 3SEBA 3AEFB 5LXHA 3KLSX 1RFAA 1V1PB 4W9GA 1L6VA 5KHOA 5AFUK 2K5PA 4LJOB 3BZDB 1L0VB 4ANUA 3W1SA 3IAM1 4GCSA 1JCKB 2BS3B 3RD2A 1TZ1A 1AARA 2DHZA 4YL8A 3IBEA 4IM2A 7PRNA 2W81C 4Z3TA 5EE3A 3FC4A 2HD5B 2O6VD 4K81A 2X38A 4C7YA 4PT5A 4W9LA 4WWMA 4IM0A 5IOIA 5AZGA 2KDYA 3KUCB 3FILA 4W9JA 1OTRB 4EFOA 1FMAD 4OVZA 4AYMC 4YTPB 3ONSA 1FD6A 4M8MA 2RPVA 4RGTA 4ZHOA 3OLMD 4F7ZA 2GBRA 2KVZA 2JQYA 3W5UB 1V86A 4HJKA 5KAFO 4ASWC 4RM9A 4E74A 4AYEC 5CX3A 5IAAC 4MJSB 4DBGA 4PS8A 4W9HA 1EWCA 3Q3JA 2LEKA 2V4LA 4RM8A 3PGEA 3POUA 3VY8X 4D5UA 1L4ZB 5GMVA 4GCQA 3BYTB 4WURA 2A5UA 2KMMA 3U7DA 1F52A 3NVWA 1WE6A 1TKGA 1P98A 4CHKA 3A9KB 4FJYA 2C9WB 1XEEA 3IG3A 3ZDMC 1T0QC 1EM7A 2KQ7A 2LHEA 1TT5B 2XMXA 1WMHA 1V2YA 1OFFA 2L76A 4KKIA 3VRBB 4ARCA 1C4PA 3DPDA 1OGWA 3ALBA 1HXTA 5J2RA 3CSFA 1I4RA 1F77A 2HTME 4RH6A 3PHXB 2PKOA 5H8YE 3ZTDA 3DWMA 3AAAB 1RLFA 3AEDB 3B0AA 1CQVA 1V80A 1VLBA 4FULA 1OSMA 4N6EB 3A4SC 1R4MI 5DCNA 4JLCA 1S3SG 2GBKA 4C56C 4B9KA 3I3TB 4IM3A 2KQ4X 1TS3A 2L00B 1Q5WB 1D5XC 4ZOHC 1JWUD 1VR9A 1KRHA 2Z0EB 1CZPA 2JRIB 3BK1A 2G4SA 3T24A 4E1TA 2LGDA 1QLBB 1P7FA 1ZXHA 3HW9A 2KACA 3BVZA 3HVDA 3L13A 4A9AA 3DBRI 3T20A 2N4FA 2LGIA 1ET9A 1A5RA 4JQWC 2WLBA 2LWPA 1HTOA 4US8A 5IA7A 1V1PA 1UWXA 1R7SA 1WGYA 2WXPA 3IHPC 3U2SC 2DBYA 2GI9A 4W9KA 1WF9A 2JU6X 3UGBB 4DQOC 3KVDD 4XNLA 1XLPA 3V05A 3H7PA 3NVZA 2PRNA 1I4XA 1WGGA 1FPYA 3VVWB 3FILB 1TY0A 5JDPA 4ARIA 4G50A 1IUEA 4F8CB 3BS0A 2INPE 2BYFA 2BBCA 1SIFA 2PTLA 3APCA 1LO5D 2ZNVB 1IZNA 3SZDA 4ZRQA 1V49A 1J7BA 2BWFA 3B2FA 1RFKA 2BS4B 1FEHA 1V97A 1WRIA 4FA6A 2MJEA 1V1OA 4WQMA 4R3DA 3KWLA 5JH5C 2D10A 3PVLA 5L95C 4P16A 2XTRA 2GBNA 1BMLC 1WXAA 1HZ6A 2MP2B 4NJCA 4C80A 5T5FA 2OEDA 4EZKA 2UYZB 1ZHTA 1J8CA 2L8JA 2VZKD 2QTKA 2KDMA 4GGQA 3Q8FA 2IYDB 1EO6A 2AQ3B 5D7GA 4FJZA 1DOIA 2KWDA 3QA8A 3PZDA 1FNWA 1WGDA 2ZLDA 3AULA 3PRNA 2GBMA 4BKTA 4K7SA 4JE3B 5BYRA 3HWBA 4KGTA 3P4RB 2F1VA 2MHJA 4HCNB 4TKNA 3RN9C 1ZGUB 3T3OA 3Q69A 2FGQX 2Y5BB 1NBFC 2E6XA 3O0EA 4BOZB 3UQAA 3Q6BA 2MNHA 3LK42 1IGCA 4O3XB 4ZYSA 4FT6A 4FHKA 1DGJA 2LHDA 2XE3A 3I63C 5BMHA
chains in the Genus database with same CATH topology
4O4UA 1N63A 3AV8A 1FXIA 3T0SA 2IGHA 2KN4A 4N58A 1D5MC 1TS2A 1WSPA 5BYQA 4YSZB 5FR3A 2L83A 4EE2A 2WDRB 1PGXA 4FZLA 1I4PA 1PGBA 1ZE3D 1WXQA 2IJ0A 1FRDA 2JZPA 3PO0A 5D3DA 5PRNA 4RF1A 2KC0A 2CJNA 3V8UA 2WNMA 1AYFA 2SAKA 5AFUL 1JALA 4GDKB 3IT6B 2Q5WD 4C7ZA 2JYTA 3AA0B 1YMHE 4XE0A 1SE2A 1SIJA 4TMAB 3PQSA 2XNAC 3CWIA 1N5XA 4J3OD 5G26A 2WXIA 2LJIA 4YTNB 3ZQ4A 3GP6A 1BUIC 1SJHD 1NEKB 2NTSA 5BYSA 2NTTA 1KLGD 4O3WA 5HHDG 3SZVA 4ITKA 3Q8EA 5GV0A 1NVID 4XDCA 4WH4A 1QILA 1QJ9A 3NZ3A 4AKMA 2E3TA 2WXGA 3AA6A 1JRPA 2KXPB 1C4CA 1MM5A 3AEEB 4A90A 5G5GA 2Y0LA 4FUVA 5FVNA 2KAJA 2DLBA 4OHJA 5JXVA 1N61A 1MM4A 3SY7A 3EUB2 3HRDD 1FCLA 2PMVA 4KX6B 3N9YC 3B2GA 3SR6A 3AA7B 4M0WA 1GFMA 1AN8A 3MP9A 2JX5A 4YSYB 2XN9C 3RPFC 5HFYA 1HZ5A 2GB1A 4C69X 1IBXB 1JWMD 4TQ1A 4U9CA 2WS3B 3ZGZA 4IKGA 5EE9A 2WXFA 2QMTA 2WP9B 5H92C 1RWSA 5DL8A 5C3JB 3VE1A 1SBBB 2XG6A 3BYYB 4F4BA 4P6VF 3V3XA 1HXXA 3W2DA 4KR4A 4NAMA 3CIRB 3VZUX 2N9KA 3TEWA 2LFIA 2L32A 1ET6A 1K52A 1QOGA 3C8YA 1A70A 1F2RI 1UWMA 1OQQA 3ZJVA 3HOEA 2H89B 1QOBA 2ODJA 3AA1B 1TYGB 1SE3A 1ENFA 2IPKD 3HUIA 5D5DA 1E54A 5T8IA 4GCPA 2G1EA 1Q10A 5DL5A 1ZPSA 3TEZA 4JWSC 3SYBA 3UAQA 3EGRA 3EA6A 2O4VA 2ZW1A 4OZBA 2Y0KA 1JW9D 3P42A 1NYRA 1T5XD 1KTKA 2MJ3A 1I7HA 1MI0A 1VRAB 2V3NA 4KKJA 3UPGA 3W9CB 4D2KA 1E9MA 5EE1A 3MHZA 2EELA 3VE2A 1DOXA 3B9JA 1ZDXA 4LTUA 3AE3B 2DYOA 4LLGM 3AA7A 1NYQA 4KR8A 4O3YA 4KGRA 3ABVB 1C77A 1MHHE 2I2YA 2JSVX 2W3RA 1B9RA 1L0YB 3IAS1 4E1SA 3KQ4A 1T3QA 2XE1A 3VRAB 4AKRA 3PZ7A 4G76A 1ZHYA 2WXHA 3VR9B 3AAEA 3I9V1 2D5GA 1I4HA 2GRIA 2N9LA 4FXCA 3U52E 4BUMX 3G7GA 1L6UA 1FFVA 1T6BX 2J53A 1NI3A 2MHLA 3C5OA 4O4XA 1N60A 5MPOA 1QJPA 1IGDA 4QQ1A 1MHXA 1F2RC 2JWUA 4A55A 4ZHPA 1JWAD 2MEKA 3J9CA 5ADXL 4XNKA 3SFEB 4FESA 1SXTA 4AKRB 4UDUC 2MH7A 1XLOA 3OWEB 2YPVA 1ACCA 4HKQA 2M07A 1XLQA 3TZGA 2Y5CA 1SEBD 4TSSA 2LFUA 2L1AA 2PIAA 4HRSA 4KRAA 2K22A 3AEBB 1ESFA 2WXLA 2G9HD 2BS2B 4RNAA 2QEJC 4L23A 2PVOD 1EU3A 3P4QB 3TEYA 1QF6A 4RLCA 2W55A 1YJJA 3U4EG 3AEAB 3A2SX 4AQ7A 3SEBA 3AEFB 4B61A 2B76B 1VZ8A 2Y3AA 1FIQA 5EE0A 4O3ZA 2M19A 3KLSX 2N2MA 1GFPA 1V1PB 2M0AA 1C76A 1L6VA 5AFUK 2K5PA 1QT9A 2RDHA 4MT5A 1CK1A 1L5PA 2ACZB 2CJOA 4FRXA 3P4SB 2JMMA 2WU5B 3BZDB 1L0VB 1GPXA 1ZDVA 3E56A 3W1SA 3NVYA 3IAM1 1SB3C 3NVVA 4DXGA 3EMNX 4GCSA 1JCKB 4XWTA 2BS3B 4FOZA 3AE9B 4JPSA 4IDIA 4RGMA 2HDEA 2PVGC 3MJ5A 5ADXK 1HXUA 2N7JA 7PRNA 2W81C 4Z3TA 1ZHWA 3U7ZA 5EE3A 5I4DA 3FC4A 3AE1B 1JROA 2X38A 4C7YA 4PT5A 4ZRPA 1KFYB 2BT6A 1TY2A 4WWMA 4RLBA 1C79A 3IXSA 1TJEA 3PZ8A 2XE5A 3ZJUA 3RFZB 2KDYA 4AYID 1L4DB 2V4IB 3E9SA 3BK2A 3TUOA 4REZA 4HKZE 1TKEA 1H6S1 3URYA 3FILA 4US9A 1J7AA 2OMFA 5AUKA 1FMAD 4JCHA 4OVZA 1QOFA 3RBHA 4AYMC 1HEZE 3GP7A 4LK0M 4YTPB 1FD6A 2RPVA 4RGTA 2W82A 4ZHOA 1P4TA 2AQ1B 4YT0B 4FSPA 2WDVB 3AE5B 3VQIA 3UI3A 2M06A 5HG2A 2K0PA 3W5UB 3QRCA 3MC0B 4FZNA 1K50A 1E7PB 3PORA 1ROEA 4AFKA 4IOIE 2YNKA 3HVZA 2W80C 3AA6B 5FKAC 4FZMA 4GHBA 4JX1C 5G5HA 2DYMA 5EE2A 3PQUA 4AYEC 5D3IB 1SSNA 1XXGA 1GFOA 1KH0A 3H8HA 2WXKA 3NRZA 1EWCA 2KZ7A 2LEKA 2MJDA 3POUA 2X27X 4KGSA 3VY8X 1BXTA 4D5UA 4NZLB 1L4ZB 2YEPF 3NSGA 4GCQA 3BYTB 4WURA 2J4XA 1M4VA 1PRNA 1FXAA 3HOLA 3AECB 4L1BA 4CQNA 3GS2A 1UUPA 2KMMA 1C4AA 4O49A 2WXQA 2FE8A 2JQRB 3VZTX 2PW9A 2ONQA 1PFDA 2BTEA 4RJWA 3NVWA 4HROA 2FGRA 1TKGA 1SF0A 3LK41 4AUIA 2ERVA 1XLNA 3LK3B 1N5WA 1UNSA 1XEEA 1YJIA 4NAWB 1PHOA 4RF0A 3Q8AA 4RGNA 1EM7A 1D6EC 1V8CA 2LHEA 1PDXA 3TSSA 2LHFA 2XMXA 2QIEB 1OFFA 4KKIA 2K9XA 1FRRA 3VRBB 4ARCA 1SE4A 2BB5A 4FSOA 4N59A 3MFGA 1C4PA 1YN3A 4O1NA 1YS5A 1JQ4A 1XCTL 1XCQL 1SJED 1K53A 4OW0A 1HXTA 2DWQA 1STEA 1I4RA 2IGGA 1F77A 2HTME 2KXPA 4RH6A 1MPEA 4RL9A 2Y5PA 2PKOA 4RJXA 4YWGG 3LK2A 5H8YE 1QOAA 6PRNA 4B0MA 3DWMA 4FRTA 3AAAB 3AE8B 3R2IA 2GE4A 2J52A 1JMLA 3AEDB 3AEGB 5GXGB 1D5ZC 3FAHA 1KF6B 4GF4A 1Q9GA 1CQVA 5BMIA 1EU4A 1VLBA 1F0ZA 1E10A 1OSMA 4N6EB 3AAEB 1QQRA 1TZOA 4A8XC 4A6QA 1MPFA 4MACA 3BWUD 4C56C 4AYDC 1VZ7A 1ZHZA 2ZFGA 3BIID 2KQ4X 2J4UP 5DL7A 1TS3A 1FFUA 2TSSA 3LXFA 4LSHA 1YNTE 1D5XC 4G75A 4ZOHC 1JWUD 1VR9A 3LB8C 2PLPA 1KRHA 2QJLA 1MVKA 1WGKA 1PUTA 4HJGE 1GOZA 2NMQA 1CZPA 1ZHXA 3BK1A 4AZLA 2OHFA 3T24A 4E1TA 1QLBB 1P7FA 2I38A 1D4BA 1C9FA 1ZXHA 3JTYA 2K0LA 2ON8A 3DA3A 2SEBD 1GFQA 3HW9A 2KACA 1DOYA 1JWSD 3BVZA 3SY9A 4RFBA 5LNK1 3HVDA 1ZXIA 4YXDB 4A9AA 3R8BA 1DYQA 2RMMA 3T20A 1K51A 2WQYB 1HQRD 2WU2B 2JXTA 2LGIA 2QSDA 2EKIA 2WXMA 3I57A 1ET9A 2WLBA 2N0SB 4YTMB 1QJ8A 3Q8CA 4US8A 1V1PA 1UWXA 1R7SA 3KWVA 2M56B 1J7CA 2ZW0A 2WXPA 1VDVA 3P4PB 2K4TA 2WXOA 2JYEA 3U2SC 1ZP0B 2BW2A 2DBYA 1AW7A 2GI9A 1IBXA 3SYSA 2INNE 2JU6X 3P1MA 2LMCA 3KVDD 4DQOC 4TQ0A 4XNLA 1XLPA 3GB1A 1BT9A 1HXYD 2YEPB 4L2YA 4B0EA 1OQRA 3AMZA 3NVZA 3V05A 2PRNA 1I4XA 1VJKA 5HI1A 1YN4A 1PYWD 3VZWX 3FILB 2RDGA 5IYUA 1TY0A 2QILA 1RYJA 5JDPA 4ARIA 1WWTA 1IUEA 1Y56A 4JFBA 5FK9C 1EWYC 4WAFA 2FUG1 2INPE 3O13A 4YSXB 1WYGA 4H2AA 1GFNA 2BBCA 2PTLA 3BVMA 3AN1A 1LO5D 1IZNA 3AA1A 3W5VB 3NUHB 4MH8A 2LUMA 5E6JA 3SZDA 1TS5A 1G90A 3ZJTA 3P63A 1TS4A 4ZRQA 3LYYA 3IT4B 1BH3A 3WCQA 1YQ4B 1J7BA 3AAAA 3B2FA 2W3SA 5BMGA 1RFKA 2BS4B 2N2LA 1FEHA 2XTQA 1V97A 1P7EA 1WRIA 2IDYA 2MJEA 1CJEA 1V1OA 3POXA 4WQMA 3NS1A 3UU2A 2J1NA 8PRNA 3QRAA 1B1ZA 2VZKB 3ETRA 4R3DA 4WIPA 2IGDA 1FCCC 2F1TA 4XDDA 3KWLA 2H88B 4AS1A 2V3PA 2KZ7B 3T3NA 4OZCA 1Q9FA 2AX5A 4GDLB 4MM3B 4USAA 4FMSA 3AE7B 4P16A 3WI5A 1N62A 2XTRA 3BVGA 1BMLC 4C80A 1HZ6A 2BB6A 4JWUC 4NJCA 3ZYYX 4LSEA 5T5FA 1ZOYB 2OEDA 1GB4A 3LK3A 1THQA 2R61A 3AM9A 1XF5L 1YN5A 1ZHTA 1TKYA 4AYNA 1PGAA 1FO4A 1JWBD 3L4PA 1I4QA 4PUXA 2VZKD 2AQ2B 2QTKA 2KDMA 1FNVA 3FYXA 1FNUA 3Q8FA 1IZNB 2J42A 1QKZA 3AE6B 3AA0A 3AB5A 2Y7SA 2CU3A 2WXNA 3VR8B 2W54A 2ICIA 2Y0HA 1GB1A 2AQ3B 2XE2A 5D7GA 1RM6C 1DOIA 1KLUD 3K19A 2KWDA 3AH7A 4OZAA 4XWWA 1FNWA 1XO3A 2V0GA 1VZ6A 2WXJA 3WI4A 4RCOA 2ZLDA 3SFDB 2PORA 3DA4A 3PRNA 3Q8BA 1C78A 1E6EB 4GLSC 5TSSA 1E0ZA 1L0XB 4JE3B 5BYRA 3HWBA 2WDQB 4KGTA 4D65A 3POQA 1OPFA 3LK2B 2F1VA 3P4RB 5AUIA 2BYTA 4D64A 2K3UA 4HEA1 2WXRA 3AE4B 3T3OA 2Y2XA 3Q69A 2FGQX 4Q2JA 4LSIA 2E6XA 3O0EA 5DL6A 1HA5A 1I4GA 1BXWA 1AWDA 2Z8LA 4LSFA 3DWGC 1YQ3B 2MNHA 4RGOS 4DXFA 3TEXA 3LK42 1FM0D 1IGCA 4O3XB 3VY9X 3AE2B 4ZYSA 1UGJA 4FT6A 1GAQB 1DGJA 1ORMA 2LHDA 2XE3A 3R2TA 2L52A 5BMHA 2FBWB 1ZUD2 1NENB 5C2TB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N63 A;  3AV8 A;  4HRO A;  1FXI A;  1NI3 A;  1TKG A;  1N60 A;  5MPO A;  1SF0 A;  4N58 A;  1RYJ A;  4ZHP A;  1JWA D;  1XLN A;  3SFE B;  1N5W A;  1WWT A;  1IUE A;  4YSZ B;  2L83 A;  2MH7 A;  1YJI A;  1XLO A;  2WDR B;  4FZL A;  1EWY C;  1V8C A;  1WXQ A;  1XLQ A;  1FRD A;  3PO0 A;  4YSX B;  1PDX A;  2Y5C A;  2XMX A;  2CJN A;  1WYG A;  2QIE B;  1OFF A;  2PIA A;  2K9X A;  1FRR A;  3VRB B;  4HRS A;  1AYF A;  3AN1 A;  1JAL A;  4N59 A;  2K22 A;  3AEB B;  2Q5W D;  2BS2 B;  3W5V B;  4C7Z A;  2PVO D;  1QF6 A;  3P4Q B;  1JQ4 A;  1SIJ A;  2W55 A;  1YJJ A;  3AEA B;  3P63 A;  3CWI A;  1N5X A;  2DWQ A;  3WCQ A;  4YTN B;  3AEF B;  1YQ4 B;  2B76 B;  5C2T B;  1J7B A;  1NEK B;  2HTM E;  1FIQ A;  5EE0 A;  3B2F A;  2M19 A;  2PKO A;  2W3S A;  1RFK A;  2BS4 B;  1QOA A;  5H8Y E;  4ITK A;  2XTQ A;  1L6V A;  1V97 A;  1NVI D;  2K5P A;  1WRI A;  1QT9 A;  3DWM A;  2MJE A;  1CJE A;  2E3T A;  1JRP A;  1L5P A;  2ACZ B;  2CJO A;  3AE8 B;  3AEE B;  3P4S B;  2WU5 B;  4WQM A;  3NS1 A;  3AED B;  3AEG B;  2KAJ A;  3FAH A;  1L0V B;  1KF6 B;  1N61 A;  3ETR A;  5GXG B;  1GPX A;  3EUB 2;  3HRD D;  3NVY A;  1VLB A;  1SB3 C;  2H88 B;  3KWL A;  3NVV A;  4KX6 B;  1F0Z A;  1E10 A;  3B2G A;  3SR6 A;  2BS3 B;  3AE9 B;  4N6E B;  2AX5 A;  4IDI A;  4USA A;  2JX5 A;  3AE7 B;  4YSY B;  5G5G A;  3RPF C;  2PVG C;  1N62 A;  2XTR A;  5EE3 A;  3FC4 A;  3AE1 B;  1JRO A;  4C80 A;  4JWU C;  2WS3 B;  3ZYY X;  4C7Y A;  1ZOY B;  5EE9 A;  1KFY B;  2BT6 A;  2WP9 B;  3BII D;  4WWM A;  5H92 C;  1RWS A;  1TJE A;  5C3J B;  1FFU A;  3LXF A;  3AM9 A;  4G75 A;  4P6V F;  4ZOH C;  1TKY A;  3LB8 C;  1KRH A;  2QJL A;  3CIR B;  1WGK A;  1PUT A;  1TKE A;  1FO4 A;  1JWB D;  3L4P A;  1CZP A;  4US9 A;  1QOG A;  2OHF A;  1J7A A;  1A70 A;  1UWM A;  1QLB B;  1FMA D;  5AUK A;  1OQQ A;  3AE6 B;  2H89 B;  3AB5 A;  1QOB A;  2CU3 A;  1QOF A;  1TYG B;  3DA3 A;  4YTP B;  3VR8 B;  2W54 A;  3HUI A;  2G1E A;  4ZHO A;  4YT0 B;  1DOY A;  2WDV B;  4JWS C;  3AE5 B;  1RM6 C;  1DOI A;  1ZXI A;  3W5U B;  4A9A A;  3AH7 A;  4YXD B;  1JW9 D;  1NYR A;  2MJ3 A;  1I7H A;  4FZN A;  1L6U A;  1E7P B;  1XO3 A;  2WQY B;  1ROE A;  3W9C B;  2WU2 B;  3SFD B;  3DA4 A;  3HVZ A;  1E6E B;  1E9M A;  2EKI A;  5EE1 A;  4FZM A;  1E0Z A;  4JX1 C;  5G5H A;  2WDQ B;  1DOX A;  3B9J A;  4LTU A;  2WLB A;  3P4R B;  2N0S B;  3AE3 B;  5AUI A;  4YTM B;  4US8 A;  1R7S A;  3NRZ A;  2M56 B;  3AE4 B;  1J7C A;  1NYQ A;  2LEK A;  2MJD A;  1VDV A;  3ABV B;  3P4P B;  2W3R A;  1B9R A;  1AWD A;  1ZP0 B;  2DBY A;  1T3Q A;  3DWG C;  3VRA B;  1YQ3 B;  1FXA A;  3P1M A;  3AEC B;  1FM0 D;  3AE2 B;  4G76 A;  1XLP A;  2KMM A;  3VR9 B;  1GAQ B;  1DGJ A;  1OQR A;  3AMZ A;  3NVZ A;  4FXC A;  2JQR B;  1VJK A;  2L52 A;  2FBW B;  1ZUD 2;  1PFD A;  1NEN B;  1FFV A;  3NVW A; 
#chains in the Genus database with same CATH topology
 3AV8 A;  3T0S A;  1YX6 B;  2KN4 A;  3OJ4 B;  1WSP A;  5BYQ A;  1KLV A;  1E90 A;  4WAA A;  4YSZ B;  5FR3 A;  1WYW B;  4EE2 A;  2WDR B;  3LJ3 A;  2CR5 A;  1ZW7 A;  2SAK A;  4GDK B;  2C7N B;  4C7Z A;  1YMH E;  4XE0 A;  4MDK E;  3EFU A;  4TMA B;  4ANV A;  1N5X A;  1WR1 A;  1NI2 A;  5IN7 A;  5G26 A;  2WXI A;  5HKH A;  4G3X B;  1BUI C;  1SJH D;  2NTS A;  5BYS A;  1KLG D;  2CS4 A;  3V62 A;  5LXI B;  2E3T A;  1MM5 A;  4GDK A;  2Y0L A;  1P3Q U;  5JXV A;  2DLB A;  1N61 A;  2MSE D;  2PMV A;  3B2G A;  3AA7 B;  4KV2 A;  4YSY B;  3RPF C;  2LXA A;  2N9E B;  3Q3O C;  2XK5 A;  5EE9 A;  4DHJ D;  2LGS A;  1IP9 A;  1MG4 A;  2KZR A;  4LDT D;  1RWS A;  5C3J B;  1SBB B;  2XG6 A;  3W2D A;  4BBN F;  1HXX A;  4KR4 A;  2FIF A;  1QZE A;  1E8W A;  3CIR B;  3VZU X;  1QOG A;  1WJU A;  2LZ6 A;  4W9F A;  3EEC A;  2N7E A;  2G1E A;  1Q10 A;  4C4V A;  3SYB A;  3DBH I;  3EGR A;  3EA6 A;  2O4V A;  3TBL D;  2W9N A;  3QHT A;  4LNK A;  4OZB A;  1JW9 D;  1KTK A;  4KKJ A;  1F1H A;  2V3N A;  4MGK E;  1Q1O A;  1UH6 A;  5EE1 A;  2AXT O;  5TR5 A;  1ZDX A;  4LTU A;  1H8C A;  1C77 A;  2WJR A;  1MHH E;  2JSV X;  2W3R A;  4DHZ B;  1L0Y B;  4E1S A;  1T3Q A;  4LDT B;  2V1Y A;  3HM3 A;  4G76 A;  3VTW A;  2GRI A;  3IVF A;  3R3M A;  3PRE A;  4IG7 B;  3C5O A;  3DHI C;  1MHX A;  2N9X A;  3H7P B;  4XNK A;  2PJH A;  5B66 O;  4G11 A;  1XLO A;  1YQB A;  4WJP A;  3RYT A;  3TZG A;  4TSS A;  1SEB D;  1WJ4 A;  3D32 A;  3DVG X;  3R66 C;  2BYV E;  2QEJ C;  4L23 A;  1U4A A;  1QF6 A;  3P4Q B;  2W55 A;  3AEA B;  2DAF A;  2KAN A;  4B61 A;  1WXV A;  2B76 B;  1VZ8 A;  3DZM A;  5EE0 A;  2KKC A;  4IWP A;  2N2M A;  3O65 B;  2X8X X;  1QT9 A;  4GN1 A;  2WU5 B;  1MG8 A;  2C5L C;  4I6P A;  4OVV A;  2KTR A;  4E3C A;  4OVU A;  2O2V A;  3N32 A;  2MRP A;  1VCB A;  2PVG C;  2MBE A;  3MJ5 A;  5ADX K;  1HXU A;  2LD9 A;  1ZHW A;  3U7Z A;  4HVB A;  1KFY B;  4RLB A;  4FBJ B;  2CHX A;  3RFZ B;  4AYI D;  5JHB A;  3E9S A;  5JHA A;  4REZ A;  4HKZ E;  2HTH A;  4AOF A;  4BZA A;  1GJZ A;  2G45 B;  1TTN A;  4I6L B;  3GP7 A;  4HDQ A;  1UF0 A;  2RPQ A;  3RI7 C;  3ML8 A;  2AQ1 B;  1KJT A;  2KTF A;  3AE5 B;  3VQI A;  3RT3 B;  3ML9 A;  3DDC B;  3HM6 X;  4BAX A;  3POR A;  4AFK A;  2YNK A;  4XYC A;  2W80 C;  3AA6 B;  4JX1 C;  5D94 A;  2LJ5 A;  5EE2 A;  3ENE A;  1OQY A;  1GFO A;  1KH0 A;  1XXG A;  3AU5 A;  1EUV B;  2KZ7 A;  1F9J A;  3EFC A;  2KTR B;  4NZL B;  4ZRI A;  3DWN A;  3RNB C;  3C0R B;  2AL3 A;  3GE3 C;  1M4V A;  1PRN A;  4L1B A;  3HOL A;  3GS2 A;  2C7H A;  4O49 A;  3AXC A;  2WXQ A;  5C23 A;  2ONQ A;  2N1W A;  5GTH O;  3ZUN A;  4FHJ A;  1SF0 A;  1XLN A;  3LK3 B;  4DHZ E;  2BQQ A;  1RRB A;  3HHM A;  4RF0 A;  4NY0 A;  1D6E C;  4W9D A;  3DCG A;  1SE4 A;  2KYW A;  4N59 A;  1EF1 A;  2R2O A;  1XCT L;  3QK0 A;  1K53 A;  3JYU A;  4EZJ A;  2DWQ A;  1STE A;  3BRY A;  2IGG A;  4XC2 A;  2KXP A;  2L3Z A;  1MPE A;  3LK2 A;  2MBO A;  3WAL A;  2X9K A;  6PRN A;  3AE8 B;  3OJ3 A;  4A3P A;  2WHI A;  3AEG B;  4GF4 A;  2R4N A;  2PE9 A;  3W1S C;  1EF5 A;  2DZJ A;  1J0G A;  3AAE B;  1P0R A;  1TZO A;  4MAC A;  3BWU D;  2BKF A;  4AYD C;  1VZ7 A;  4NJ6 A;  2R8A A;  2TSS A;  3LXF A;  2PLP A;  1PUT A;  2XK5 B;  1GOZ A;  4HJG E;  4DK5 A;  2ZVO A;  1C9F A;  4J6I A;  2K0L A;  2ON8 A;  3ZRF A;  3ZXV A;  3ZKJ C;  4RFB A;  3SY9 A;  3GOE A;  4YXD B;  3N1X C;  3MTN B;  1K51 A;  2WQY B;  5E79 O;  2QSD A;  4LNO A;  2JY6 A;  2NBW B;  1HTQ A;  3KWV A;  1J7C A;  2ZW0 A;  2C7M B;  1VDV A;  2O2V B;  3P4P B;  2WXO A;  3VFK A;  3UQB A;  1ZP0 B;  3Q3F A;  1AW7 A;  3SYS A;  1WH3 A;  4DXA B;  4TQ0 A;  5E6N A;  1OQR A;  3AMZ A;  1VJK A;  2J0M A;  5HI1 A;  2R4O A;  1PYW D;  3L08 A;  3VZW X;  5IYU A;  1RYJ A;  2M1M A;  4JFB A;  1LQB A;  4M02 A;  5FK9 C;  4K3C A;  3LDZ E;  5CHF A;  1EWY C;  2FUG 1;  4YSX B;  3WAM A;  1GFN A;  4ANW A;  3BVM A;  2CU1 A;  3W5V B;  4BVU C;  2ZVN A;  3NUH B;  4MH8 A;  5L83 A;  2LUM A;  1TS5 A;  1KM7 A;  4MGY E;  1BH3 A;  4GOC A;  1YQ4 B;  4WWP A;  3AAA A;  5J17 A;  1MJD A;  2JT4 B;  5BMG A;  2BF8 B;  4FLH A;  1P7E A;  2IDY A;  1CJE A;  4DWF A;  2AEH A;  1SGH A;  2J1N A;  1B1Z A;  3PHW B;  4FQE A;  4XDD A;  2IGD A;  2C60 A;  3C19 A;  3M63 B;  2H88 B;  4HWI B;  1CMX B;  4OZC A;  4MM3 B;  3BRZ A;  2VH1 A;  3NS8 A;  3WI5 A;  2HE7 A;  1G6J A;  2NS5 A;  1N62 A;  2LGY A;  4ACF A;  2BB6 A;  2VH2 A;  1GB4 A;  3LK3 A;  4ZRK A;  3ZXR A;  3A9J B;  1YN5 A;  3L4P A;  1FNV A;  3FYX A;  1IZN B;  2J42 A;  1QKZ A;  2WXN A;  2W54 A;  1YD8 U;  5G55 A;  2BGF A;  2B3A A;  1KLU D;  3K19 A;  2XEW A;  4OZA A;  2D3B A;  1WIA A;  1XO3 A;  2V0G A;  4PJ0 O;  3ZRC A;  4BKS D;  1C78 A;  3PRZ A;  2WDQ B;  3VUY A;  4D65 A;  1OPF A;  4PK1 A;  4WWO A;  4K7U A;  4D64 A;  2O6V B;  3NG0 A;  2WXR A;  3NOB A;  4JL9 A;  4QAY A;  4W9E A;  2L05 A;  4LSI A;  2NPT A;  1HA5 A;  1I4G A;  1BXW A;  4LSF A;  3DWG C;  1ZKH A;  2KFK B;  3AE2 B;  3N1Z C;  4NNJ B;  2WGS A;  4IWO A;  1GAQ B;  3R2T A;  3PV1 A;  3ZNH B;  2L52 A;  3A4R A;  2FBW B;  5EDS A;  1R4N B;  1N63 A;  2O6V A;  2IGH A;  2ZNV C;  1D5M C;  3DHH C;  3DQV A;  2L83 A;  2KFK A;  4LNF A;  1I4P A;  2IJ0 A;  1GC7 A;  2JZP A;  5D3D A;  4EZL A;  2KC0 A;  4C4V B;  1KOT A;  2RD0 A;  3NHE B;  3V8U A;  4M00 A;  3IT6 B;  2JXX A;  3K9P B;  2JYT A;  3AA0 B;  2CKH B;  3ZNZ B;  1SE2 A;  1SIJ A;  5E6O A;  2XNA C;  3ZQ4 A;  4N75 A;  3ZTC A;  4WJO A;  4KZC A;  5HHD G;  2K6Q A;  1NVI D;  4WH4 A;  1QIL A;  1QJ9 A;  5B5E O;  2DZM A;  2WXG A;  3QCA A;  3AA6 A;  2KXP B;  4AWJ A;  2K8C A;  3V61 A;  5FVN A;  3HRD D;  1FCL A;  4KX6 B;  3N9Y C;  2KXJ A;  3SR6 A;  1AN8 A;  2ZJD A;  1HZ5 A;  1BT0 A;  1OEY J;  1IBX B;  1JWM D;  4U9C A;  2WS3 B;  4IKG A;  3RNE C;  5H92 C;  5DL8 A;  3VE1 A;  4KSK C;  4F4B A;  3V3X A;  2ASQ A;  4A20 A;  3TEW A;  1Z5S B;  4HPP A;  1TGZ B;  2L32 A;  4G0N B;  1A70 A;  1F2R I;  4WQO B;  3ZJV A;  4FJV B;  2M0X A;  2ODJ A;  2IPK D;  3QWZ B;  3HUI A;  5T8I A;  4GCP A;  5DL5 A;  1GNU A;  3WU2 O;  3P42 A;  1MI0 A;  3UPG A;  3QQ8 B;  3W9C B;  2R88 A;  4D2K A;  1P9D U;  2MA9 B;  3MHZ A;  2KDE B;  2DEN B;  2JZZ A;  2MBH A;  3AE3 B;  4LLG M;  3AA7 A;  4P7I A;  1NYQ A;  4KR8 A;  4O3Y A;  4BFR A;  3QX1 A;  5CHV C;  3VRA B;  4AKR A;  1YIW A;  2EMS A;  2RDB C;  5IKC M;  1UBI A;  4M0W B;  3VR9 B;  3AAE A;  2D5G A;  2RSU A;  1C1Y B;  1I4H A;  3A9J A;  1IPG A;  3P2B A;  2L0F A;  1T6B X;  2J53 A;  1NI3 A;  4S17 A;  4WWN A;  5MPO A;  1QJP A;  3KH0 A;  2JWU A;  1F2R C;  4A55 A;  3M62 B;  2FAZ A;  4FES A;  4II2 B;  1SXT A;  4AKR B;  4UDU C;  2MH7 A;  4HKQ A;  1ACC A;  2OJW A;  2PIA A;  3VDZ A;  4KRA A;  4DDG D;  1ESF A;  2G9H D;  5CTR C;  1EU3 A;  3TEY A;  4IC7 B;  3A2S X;  4AQ7 A;  1XD3 B;  2N9P C;  1FIQ A;  1TIF A;  2M19 A;  1GFP A;  2M0A A;  2KLG A;  2RDH A;  1CK1 A;  1L5P A;  2CJO A;  4FRX A;  3P4S B;  2DX5 B;  4S0R A;  2IZV B;  1SB3 C;  4DXG A;  3DOW A;  3EMN X;  2IY1 B;  2D3G A;  3KW5 B;  4RGM A;  3ZNG C;  2N7J A;  3PPA A;  2WYQ A;  3OAW A;  4ZRP A;  3S2A A;  2BT6 A;  1TY2 A;  2WVP A;  3IXS A;  1TJE A;  3ZJU A;  1L4D B;  3BK2 A;  3TUO A;  1TKE A;  1S5L O;  1H6S 1;  2LVO A;  5G39 A;  3N3K B;  1E8Z A;  5AUK A;  1HEZ E;  2CHW A;  2RR9 A;  2REX A;  2W82 A;  1P4T A;  4YT0 B;  4FSP A;  2WDV B;  2M06 A;  2MBQ A;  2K0P A;  2KJH B;  4I6N B;  3VXW A;  1E7P B;  2LAS A;  1IYF A;  4IOI E;  4W9I A;  2XBB C;  5FKA C;  4FZM A;  2BPS A;  5D3I B;  1SSN A;  5AZF A;  2MW5 A;  2J0J A;  2MJD A;  4TV3 A;  1E7U A;  3L16 A;  1BXT A;  3PS6 A;  3NSG A;  3AU4 A;  3X0W A;  2J4X A;  1FXA A;  4CQN A;  3AEC B;  4HLE A;  2NPT B;  3DVN U;  2JQR B;  2LGX A;  1OEY A;  2J7Q B;  4PR7 A;  2BTE A;  4HRO A;  4HDO A;  4AUI A;  3RUL A;  2ERV A;  2WDT B;  1N5W A;  3ZIM A;  3PTF C;  3ZLZ A;  1PHO A;  3DVG Y;  2J0K A;  3A1Q B;  1SE9 A;  4UB8 O;  1PDX A;  3TSS A;  3MC8 A;  4ICV A;  5FR6 A;  2QIE B;  1FRR A;  1UGM A;  2BB5 A;  4FSO A;  1NDD A;  1YJ1 A;  4O1N A;  1XCQ L;  2JRH A;  1SJE D;  3Q2A C;  2WJQ A;  3GZN B;  4RL9 A;  2Y5P A;  3A0H O;  2IO0 B;  4YWG G;  1QOA A;  3FKY A;  4MEL A;  4B0M A;  3ECI A;  3CST A;  3ZO5 B;  2JF5 A;  4KDL B;  2KX0 A;  3FAH A;  1R4M B;  1KF6 B;  3TL5 A;  1F0Z A;  2BKR B;  1D3Z A;  2R89 A;  3RMK C;  2DZK A;  3APD A;  1QQR A;  4A6Q A;  1V6E A;  1ZHZ A;  1V81 A;  4EKU A;  4P1B C;  2J4U P;  3QJZ A;  1FFU A;  2FCQ A;  4LSH A;  3ZVV A;  4G75 A;  3LB8 C;  2QJL A;  1WGK A;  4NJ7 A;  4AUQ C;  2NMQ A;  4ZDV A;  1ZHX A;  2OHF A;  2I38 A;  1D4B A;  2PEA A;  2OJR A;  3DA3 A;  2JWZ A;  1YOV B;  2SEB D;  1GFQ A;  3DHG C;  1C3T A;  5LNK 1;  3R8B A;  1DYQ A;  3K9O B;  3T8M A;  5GTI O;  2G3Q B;  2N0S B;  4ZYN A;  4YTM B;  1QJ8 A;  5D6J B;  2I1K A;  2K4T A;  3PGR A;  2JYE A;  2BW2 A;  2INN E;  2LMC A;  3DBS A;  2DAJ A;  3GB1 A;  1HXY D;  1RAX A;  2IO3 B;  4B0E A;  4JIO U;  5JZE B;  4MGI E;  3KYC D;  1XT9 B;  1WI0 A;  1YN4 A;  3WIM A;  2K6D B;  2D3A A;  1WWT A;  5LLI A;  4BOS C;  1E5W A;  2KK8 A;  1E7V A;  4H2A A;  2PE6 B;  3DBL I;  3AN1 A;  3JSV B;  3ZJT A;  3P63 A;  1TS4 A;  3LYY A;  3IT4 B;  5G3A A;  1HE8 A;  3WCQ A;  2W3S A;  2K1F A;  3PRP B;  3JW0 X;  3POX A;  3NS1 A;  2VZK B;  3ETR A;  2F1T A;  4AS1 A;  5DPS A;  2KD0 A;  2V3P A;  3H1U A;  3UIO B;  3T3N A;  5TIS O;  1Q9F A;  2AX5 A;  2GLS A;  4GDL B;  4USA A;  3AE7 B;  5C1Z A;  4FN2 A;  2IWV A;  2K8H A;  3BVG A;  2K39 A;  2BVC A;  4LSE A;  1V9J A;  4KDI C;  2KDI A;  4GMV A;  3ZDT A;  2R61 A;  3AM9 A;  1XF5 L;  1TKY A;  4AYN A;  3SU8 X;  1FO4 A;  1JWB D;  4PUX A;  2AQ2 B;  2DNF A;  1FNU A;  3AE6 B;  3AB5 A;  2Y7S A;  2CU3 A;  4C00 A;  2G4D B;  2ICI A;  4LNN A;  2NBV B;  4JGH B;  4K3B A;  1RM6 C;  1WZ3 A;  2KDB A;  3PT2 B;  4XWW A;  3IFW B;  1VZ6 A;  3WI4 A;  3UF8 A;  4RCO A;  3SFD B;  2POR A;  3Q8B A;  1E6E B;  3NZU A;  4GLS C;  5G38 A;  5TSS A;  3POQ A;  5AUI A;  2ZPY A;  3AI5 A;  3VTU A;  4Q2J A;  4XX5 A;  1AWD A;  2Z8L A;  2DZI A;  1YQ3 B;  2D11 A;  4CO7 A;  4DXF A;  2BWE S;  3TEX A;  1FM0 D;  3VY9 X;  1UGJ A;  1ORM A;  4HPL B;  4IUM B;  3AH7 A;  1NEN B;  5C2T B;  4O4U A;  4XZ4 A;  4N58 A;  2AYO B;  1TS2 A;  3DBR B;  4PYZ A;  4FZL A;  1UBQ A;  1PGB A;  1ZE3 D;  3RNC C;  4BKS A;  4MGZ E;  5PRN A;  4RF1 A;  2CJN A;  3NJT A;  3OG5 A;  4DDI D;  5AFU L;  2KJR A;  2IWW A;  4LNI A;  4M8N A;  4NPN A;  3CWI A;  4J3O D;  4TUU A;  2LJI A;  4YTN B;  3GP6 A;  2ZZP B;  4URK A;  3N20 C;  5D2M B;  4O3W A;  5GV0 A;  4XDC A;  4AKM A;  1C4C A;  3AEE B;  5G5G A;  3SY7 A;  3QIJ A;  4M0W A;  2R4L A;  2JX5 A;  3RCZ A;  5HFY A;  2GB1 A;  4C69 X;  3KZI O;  4TQ1 A;  1V5T A;  2IND C;  4HPM B;  3ZGZ A;  2QMT A;  2WP9 B;  3RZF A;  4PS7 A;  2KNB A;  4NAW A;  2L0T A;  2HJ8 A;  4CYE A;  4XGA B;  4IW0 A;  2LFI A;  1ET6 A;  3C8Y A;  4IWQ A;  1OQQ A;  2H89 B;  2N7D A;  2ZCC A;  3AA1 B;  1TYG B;  1ENF A;  1E54 A;  1UD7 A;  2LVP A;  4JWS C;  3TEZ A;  1WRD B;  2V9H A;  2WX1 A;  4FAD A;  4E71 A;  3JCU O;  4GIV A;  2KC2 A;  1NYR A;  1T5X D;  2EKE C;  4MSQ B;  3WAO A;  4MJS A;  2BYE A;  2R4P A;  2R2Q A;  5AEK B;  1E9M A;  4LCD E;  3VE2 A;  1WX9 A;  2DYO A;  1I42 A;  1WZ0 A;  5G2N A;  4KGR A;  3H9D A;  2YLM A;  2Z0D B;  3ABV B;  3PLV A;  1B9R A;  3IAS 1;  4NQK E;  3KQ4 A;  2XE1 A;  2A4Z A;  3CMM B;  3DVN V;  3A1Q A;  3PZ7 A;  3I9V 1;  2KOX A;  2N9L A;  3U52 E;  3KUD B;  1L6U A;  1FFV A;  4ANX A;  4X57 B;  2MP2 A;  2MHL A;  1N60 A;  2KMA A;  1FXT B;  4ZHP A;  1JWA D;  3J9C A;  3OWE B;  2YPV A;  2N1V A;  4F1S A;  1X1M A;  2JZ3 B;  3VUW A;  2ZEQ A;  2LFU A;  4HRS A;  2KLC A;  2KWV B;  1L2N A;  2PVO D;  3U8Z A;  1YJJ A;  3U4E G;  3UIP B;  2YVC A;  2Y3A A;  1LGR A;  2IBI B;  4O3Z A;  3U30 A;  4MSM B;  3MC9 A;  5IO9 A;  1C76 A;  1Y8R C;  3SD5 A;  4MT5 A;  4DHJ B;  2ACZ B;  2MX2 A;  3APF A;  2JMM A;  3GE8 C;  4N74 A;  1GPX A;  1ZDV A;  3E56 A;  3L17 A;  3NVY A;  1JRU A;  3NVV A;  2D2Q A;  4XWT A;  2FCS A;  4FOZ A;  3QAR A;  3AE9 B;  1ISN A;  3TCA A;  2KC1 A;  4JPS A;  3KUZ A;  4IDI A;  2LXC A;  2NBU A;  2HDE A;  2FUH B;  5I4D A;  2PPH A;  3AE1 B;  1JRO A;  2UWQ A;  3TIX A;  5KHQ A;  4AJW A;  2GOW A;  1C79 A;  3PZ8 A;  2Z59 B;  4UB6 O;  2XE5 A;  3Q3M C;  4PYU A;  3T9L A;  2V4I B;  3URY A;  1WJN A;  4US9 A;  3UIN B;  1J7A A;  2OMF A;  2ZCB A;  4JCH A;  3DBL B;  1WX8 A;  3SHQ A;  1QOF A;  3RBH A;  4LK0 M;  2MQJ A;  3UI3 A;  5HG2 A;  3QRC A;  3MC0 B;  3VH4 B;  4FZN A;  1K50 A;  1ROE A;  4EOY A;  4KZ0 A;  3WAP A;  3HVZ A;  4GHB A;  5G5H A;  3CF6 E;  2DYM A;  3PQU A;  3H8H A;  2WXK A;  3NRZ A;  3RNG C;  2QCZ A;  2X27 X;  4KGS A;  2KX3 A;  2YEP F;  3DBH B;  3TMP B;  2KMC A;  3RUI B;  1UUP A;  2QHO A;  1C4A A;  4EEW A;  2FE8 A;  3VZT X;  2PW9 A;  1PFD A;  4RJW A;  2FGR A;  3LK4 1;  4KIK B;  1UNS A;  4KVG B;  1YJI A;  4NAW B;  3Q8A A;  4RGN A;  3PRM B;  1V8C A;  3NY5 A;  2LHF A;  2WWZ A;  2K9X A;  3VTV A;  3MFG A;  4MEM A;  1YN3 A;  1JQ4 A;  1YS5 A;  4ICU A;  2AL6 A;  4OW0 A;  2NCN A;  3N1Y C;  1LFD A;  3M3J A;  4RJX A;  2KHW B;  2LI5 A;  5DPW A;  4FRT A;  1E8Y A;  3R2I A;  2GE4 A;  2J52 A;  1JML A;  5GXG B;  1D5Z C;  3A0B O;  5BMI A;  1Q9G A;  1XQQ A;  1EU4 A;  4PS3 A;  3V60 A;  3B1L X;  1E10 A;  2WX0 A;  2IO1 B;  3PSE B;  4A8X C;  1MPF A;  3I5J C;  2MLB A;  3PGU A;  2ZFG A;  3BII D;  4KIK A;  5DL7 A;  2QC8 A;  1YNT E;  1UZX B;  3GZN I;  1WM3 A;  3R7R A;  1MVK A;  4GDL A;  4AZL A;  2KDF B;  5H2F O;  3JTY A;  4NQL B;  2LUE A;  1LXD A;  3A33 B;  1T0Y A;  3H7S A;  1DOY A;  1WMH B;  1JWS D;  3R7Q A;  3EC8 A;  1ZXI A;  3KVF B;  4ZRJ A;  2AWT A;  2L7R A;  3VAW A;  1WXM A;  2RMM A;  5CHW A;  1HQR D;  2WU2 B;  2JXT A;  1WGH A;  2WXM A;  2EKI A;  3I57 A;  4II3 B;  3W1Y A;  3Q8C A;  2M56 B;  2KWU B;  1WX7 A;  4LJP B;  2GBJ A;  3JVZ X;  1IBX A;  1K8R B;  3P1M A;  1BT9 A;  3BIN A;  2YEP B;  4K7W A;  4L2Y A;  4RMA A;  3QC8 B;  2RDG A;  2K8B A;  2QIL A;  4P1C C;  2KWC A;  5AZH A;  1Y56 A;  1M94 A;  2KFJ A;  1I35 A;  2EMT A;  4WAF A;  4A3O A;  4GU2 A;  2D07 B;  2RGF A;  3L0W B;  3O13 A;  1WYG A;  4HK2 A;  4B6W A;  4M01 A;  2M4N A;  2KT7 A;  3AA1 A;  5KAI O;  1T0R C;  5E6J A;  1G90 A;  3A9K A;  2IO2 B;  2IY0 B;  3WA0 A;  2F1C X;  2N2L A;  1LM8 B;  2XTQ A;  1L7Y A;  1WXS A;  4K1R B;  3UU2 A;  3B08 A;  8PRN A;  3QRA A;  2FCN A;  4WIP A;  4AJY B;  1FCC C;  3M95 A;  1GC6 A;  2V3S A;  2KZ7 B;  2KO3 A;  2VRR B;  4GB9 A;  4FMS A;  5DPR A;  3MHS D;  3V6C B;  1YX5 B;  3ZNI D;  4JWU C;  3ZYY X;  1ZOY B;  1T1L A;  2KQS A;  4HXD A;  1THQ A;  2OOB B;  2FID A;  1PGA A;  3HIZ A;  1I4Q A;  3Q14 C;  4KSL C;  3X23 A;  2QDF A;  1UEL A;  3AA0 A;  3VR8 B;  1E8X A;  3PLU A;  2Y0H A;  1GB1 A;  2XE2 A;  1T16 A;  2CHZ A;  3KYD D;  4CTD A;  1PQS A;  1MFW A;  3RZW C;  2WXJ A;  3DA4 A;  2I1J A;  1E0Z A;  1L0X B;  3VH3 B;  2HJ1 A;  2M8S A;  2MWS B;  3LK2 B;  1N6Z A;  2BYT A;  2K3U A;  4HEA 1;  3AE4 B;  4HCP B;  2MCN B;  2Y2X A;  2KN5 A;  5DL6 A;  1WFY A;  3TJP A;  2DYB A;  1WY8 A;  4RGO S;  4MM3 A;  1H4R A;  2LRW A;  1ZUD 2;  1FXI A;  1GG3 A;  5IP4 D;  1Z2M A;  1PGX A;  4BBN C;  3N30 A;  1WGR A;  1WXQ A;  1FRD A;  3PO0 A;  3JSV A;  1S1Q B;  2WNM A;  1AYF A;  1JAL A;  2Q5W D;  3PQS A;  2KJ6 A;  3DWO X;  1VD2 A;  1NEK B;  2JPH A;  3MJW A;  3HK0 A;  2NTT A;  4WJN A;  1TBE A;  3SZV A;  4ITK A;  3Q3N C;  3Q8E A;  3NZ3 A;  1JRP A;  4A90 A;  4FUV A;  2KAJ A;  4GXB A;  4OHJ A;  1MM4 A;  3EUB 2;  5J18 A;  4AP4 C;  4WJQ A;  1GFM A;  2INC C;  3MP9 A;  2XN9 C;  1J19 A;  1P1A A;  1WJ6 A;  3BY4 B;  2WXF A;  2NR2 A;  3BYY B;  4P6V F;  4B95 A;  4NAM A;  3PF1 A;  2GMI C;  2N9K A;  2LRU A;  1K52 A;  1R4N I;  1UWM A;  3V6E B;  4N9F 4;  3HOE A;  1QOB A;  1SE3 A;  1V5O A;  3L54 A;  1GUA B;  5D5D A;  1ZPS A;  1WE7 A;  3UAQ A;  3PGS A;  2MBB B;  2UU7 A;  2ZW1 A;  3L10 B;  2Y0K A;  4BKG A;  2MJ3 A;  1I7H A;  2KVR A;  1VRA B;  1WR6 E;  3RNA C;  4EUT A;  3SDL C;  3VUX A;  3ZW3 A;  2FNJ B;  4GSW A;  2EEL A;  1DOX A;  3B9J A;  2LVQ A;  2ZPN A;  2JUO A;  3WAN A;  5DPT A;  2I2Y A;  3RNF C;  2M17 A;  5BO4 B;  3QAQ A;  1WM2 A;  2NVU I;  5E6P A;  4IL6 O;  1Q0W B;  1ZHY A;  2WXH A;  4W9C A;  4FXC A;  2K25 A;  4BUM X;  1T0S C;  3G7G A;  4O4X A;  1IGD A;  4QQ1 A;  3EHV A;  2D3C A;  3NZS A;  2MEK A;  3SFE B;  5ADX L;  4MH0 E;  2FCM A;  2M07 A;  1XLQ A;  2Y5C A;  2L1A A;  2K22 A;  3AEB B;  3H6N A;  2WXL A;  2BS2 B;  4RNA A;  2JVC A;  4RLC A;  3VHT C;  3SEB A;  3AEF B;  5LXH A;  3KLS X;  1RFA A;  1V1P B;  4W9G A;  1L6V A;  5KHO A;  5AFU K;  2K5P A;  4LJO B;  3BZD B;  1L0V B;  4ANU A;  3W1S A;  3IAM 1;  4GCS A;  1JCK B;  2BS3 B;  3RD2 A;  1TZ1 A;  1AAR A;  2DHZ A;  4YL8 A;  3IBE A;  4IM2 A;  7PRN A;  2W81 C;  4Z3T A;  5EE3 A;  3FC4 A;  2HD5 B;  2O6V D;  4K81 A;  2X38 A;  4C7Y A;  4PT5 A;  4W9L A;  4WWM A;  4IM0 A;  5IOI A;  5AZG A;  2KDY A;  3KUC B;  3FIL A;  4W9J A;  1OTR B;  4EFO A;  1FMA D;  4OVZ A;  4AYM C;  4YTP B;  3ONS A;  1FD6 A;  4M8M A;  2RPV A;  4RGT A;  4ZHO A;  3OLM D;  4F7Z A;  2GBR A;  2KVZ A;  2JQY A;  3W5U B;  1V86 A;  4HJK A;  5KAF O;  4ASW C;  4RM9 A;  4E74 A;  4AYE C;  5CX3 A;  5IAA C;  4MJS B;  4DBG A;  4PS8 A;  4W9H A;  1EWC A;  3Q3J A;  2LEK A;  2V4L A;  4RM8 A;  3PGE A;  3POU A;  3VY8 X;  4D5U A;  1L4Z B;  5GMV A;  4GCQ A;  3BYT B;  4WUR A;  2A5U A;  2KMM A;  3U7D A;  1F52 A;  3NVW A;  1WE6 A;  1TKG A;  1P98 A;  4CHK A;  3A9K B;  4FJY A;  2C9W B;  1XEE A;  3IG3 A;  3ZDM C;  1T0Q C;  1EM7 A;  2KQ7 A;  2LHE A;  1TT5 B;  2XMX A;  1WMH A;  1V2Y A;  1OFF A;  2L76 A;  4KKI A;  3VRB B;  4ARC A;  1C4P A;  3DPD A;  1OGW A;  3ALB A;  1HXT A;  5J2R A;  3CSF A;  1I4R A;  1F77 A;  2HTM E;  4RH6 A;  3PHX B;  2PKO A;  5H8Y E;  3ZTD A;  3DWM A;  3AAA B;  1RLF A;  3AED B;  3B0A A;  1CQV A;  1V80 A;  1VLB A;  4FUL A;  1OSM A;  4N6E B;  3A4S C;  1R4M I;  5DCN A;  4JLC A;  1S3S G;  2GBK A;  4C56 C;  4B9K A;  3I3T B;  4IM3 A;  2KQ4 X;  1TS3 A;  2L00 B;  1Q5W B;  1D5X C;  4ZOH C;  1JWU D;  1VR9 A;  1KRH A;  2Z0E B;  1CZP A;  2JRI B;  3BK1 A;  2G4S A;  3T24 A;  4E1T A;  2LGD A;  1QLB B;  1P7F A;  1ZXH A;  3HW9 A;  2KAC A;  3BVZ A;  3HVD A;  3L13 A;  4A9A A;  3DBR I;  3T20 A;  2N4F A;  2LGI A;  1ET9 A;  1A5R A;  4JQW C;  2WLB A;  2LWP A;  1HTO A;  4US8 A;  5IA7 A;  1V1P A;  1UWX A;  1R7S A;  1WGY A;  2WXP A;  3IHP C;  3U2S C;  2DBY A;  2GI9 A;  4W9K A;  1WF9 A;  2JU6 X;  3UGB B;  4DQO C;  3KVD D;  4XNL A;  1XLP A;  3V05 A;  3H7P A;  3NVZ A;  2PRN A;  1I4X A;  1WGG A;  1FPY A;  3VVW B;  3FIL B;  1TY0 A;  5JDP A;  4ARI A;  4G50 A;  1IUE A;  4F8C B;  3BS0 A;  2INP E;  2BYF A;  2BBC A;  1SIF A;  2PTL A;  3APC A;  1LO5 D;  2ZNV B;  1IZN A;  3SZD A;  4ZRQ A;  1V49 A;  1J7B A;  2BWF A;  3B2F A;  1RFK A;  2BS4 B;  1FEH A;  1V97 A;  1WRI A;  4FA6 A;  2MJE A;  1V1O A;  4WQM A;  4R3D A;  3KWL A;  5JH5 C;  2D10 A;  3PVL A;  5L95 C;  4P16 A;  2XTR A;  2GBN A;  1BML C;  1WXA A;  1HZ6 A;  2MP2 B;  4NJC A;  4C80 A;  5T5F A;  2OED A;  4EZK A;  2UYZ B;  1ZHT A;  1J8C A;  2L8J A;  2VZK D;  2QTK A;  2KDM A;  4GGQ A;  3Q8F A;  2IYD B;  1EO6 A;  2AQ3 B;  5D7G A;  4FJZ A;  1DOI A;  2KWD A;  3QA8 A;  3PZD A;  1FNW A;  1WGD A;  2ZLD A;  3AUL A;  3PRN A;  2GBM A;  4BKT A;  4K7S A;  4JE3 B;  5BYR A;  3HWB A;  4KGT A;  3P4R B;  2F1V A;  2MHJ A;  4HCN B;  4TKN A;  3RN9 C;  1ZGU B;  3T3O A;  3Q69 A;  2FGQ X;  2Y5B B;  1NBF C;  2E6X A;  3O0E A;  4BOZ B;  3UQA A;  3Q6B A;  2MNH A;  3LK4 2;  1IGC A;  4O3X B;  4ZYS A;  4FT6 A;  4FHK A;  1DGJ A;  2LHD A;  2XE3 A;  3I63 C;  5BMH A; 
#chains in the Genus database with same CATH homology
 4O4U A;  1N63 A;  3AV8 A;  1FXI A;  3T0S A;  2IGH A;  2KN4 A;  4N58 A;  1D5M C;  1TS2 A;  1WSP A;  5BYQ A;  4YSZ B;  5FR3 A;  2L83 A;  4EE2 A;  2WDR B;  1PGX A;  4FZL A;  1I4P A;  1PGB A;  1ZE3 D;  1WXQ A;  2IJ0 A;  1FRD A;  2JZP A;  3PO0 A;  5D3D A;  5PRN A;  4RF1 A;  2KC0 A;  2CJN A;  3V8U A;  2WNM A;  1AYF A;  2SAK A;  5AFU L;  1JAL A;  4GDK B;  3IT6 B;  2Q5W D;  4C7Z A;  2JYT A;  3AA0 B;  1YMH E;  4XE0 A;  1SE2 A;  1SIJ A;  4TMA B;  3PQS A;  2XNA C;  3CWI A;  1N5X A;  4J3O D;  5G26 A;  2WXI A;  2LJI A;  4YTN B;  3ZQ4 A;  3GP6 A;  1BUI C;  1SJH D;  1NEK B;  2NTS A;  5BYS A;  2NTT A;  1KLG D;  4O3W A;  5HHD G;  3SZV A;  4ITK A;  3Q8E A;  5GV0 A;  1NVI D;  4XDC A;  4WH4 A;  1QIL A;  1QJ9 A;  3NZ3 A;  4AKM A;  2E3T A;  2WXG A;  3AA6 A;  1JRP A;  2KXP B;  1C4C A;  1MM5 A;  3AEE B;  4A90 A;  5G5G A;  2Y0L A;  4FUV A;  5FVN A;  2KAJ A;  2DLB A;  4OHJ A;  5JXV A;  1N61 A;  1MM4 A;  3SY7 A;  3EUB 2;  3HRD D;  1FCL A;  2PMV A;  4KX6 B;  3N9Y C;  3B2G A;  3SR6 A;  3AA7 B;  4M0W A;  1GFM A;  1AN8 A;  3MP9 A;  2JX5 A;  4YSY B;  2XN9 C;  3RPF C;  5HFY A;  1HZ5 A;  2GB1 A;  4C69 X;  1IBX B;  1JWM D;  4TQ1 A;  4U9C A;  2WS3 B;  3ZGZ A;  4IKG A;  5EE9 A;  2WXF A;  2QMT A;  2WP9 B;  5H92 C;  1RWS A;  5DL8 A;  5C3J B;  3VE1 A;  1SBB B;  2XG6 A;  3BYY B;  4F4B A;  4P6V F;  3V3X A;  1HXX A;  3W2D A;  4KR4 A;  4NAM A;  3CIR B;  3VZU X;  2N9K A;  3TEW A;  2LFI A;  2L32 A;  1ET6 A;  1K52 A;  1QOG A;  3C8Y A;  1A70 A;  1F2R I;  1UWM A;  1OQQ A;  3ZJV A;  3HOE A;  2H89 B;  1QOB A;  2ODJ A;  3AA1 B;  1TYG B;  1SE3 A;  1ENF A;  2IPK D;  3HUI A;  5D5D A;  1E54 A;  5T8I A;  4GCP A;  2G1E A;  1Q10 A;  5DL5 A;  1ZPS A;  3TEZ A;  4JWS C;  3SYB A;  3UAQ A;  3EGR A;  3EA6 A;  2O4V A;  2ZW1 A;  4OZB A;  2Y0K A;  1JW9 D;  3P42 A;  1NYR A;  1T5X D;  1KTK A;  2MJ3 A;  1I7H A;  1MI0 A;  1VRA B;  2V3N A;  4KKJ A;  3UPG A;  3W9C B;  4D2K A;  1E9M A;  5EE1 A;  3MHZ A;  2EEL A;  3VE2 A;  1DOX A;  3B9J A;  1ZDX A;  4LTU A;  3AE3 B;  2DYO A;  4LLG M;  3AA7 A;  1NYQ A;  4KR8 A;  4O3Y A;  4KGR A;  3ABV B;  1C77 A;  1MHH E;  2I2Y A;  2JSV X;  2W3R A;  1B9R A;  1L0Y B;  3IAS 1;  4E1S A;  3KQ4 A;  1T3Q A;  2XE1 A;  3VRA B;  4AKR A;  3PZ7 A;  4G76 A;  1ZHY A;  2WXH A;  3VR9 B;  3AAE A;  3I9V 1;  2D5G A;  1I4H A;  2GRI A;  2N9L A;  4FXC A;  3U52 E;  4BUM X;  3G7G A;  1L6U A;  1FFV A;  1T6B X;  2J53 A;  1NI3 A;  2MHL A;  3C5O A;  4O4X A;  1N60 A;  5MPO A;  1QJP A;  1IGD A;  4QQ1 A;  1MHX A;  1F2R C;  2JWU A;  4A55 A;  4ZHP A;  1JWA D;  2MEK A;  3J9C A;  5ADX L;  4XNK A;  3SFE B;  4FES A;  1SXT A;  4AKR B;  4UDU C;  2MH7 A;  1XLO A;  3OWE B;  2YPV A;  1ACC A;  4HKQ A;  2M07 A;  1XLQ A;  3TZG A;  2Y5C A;  1SEB D;  4TSS A;  2LFU A;  2L1A A;  2PIA A;  4HRS A;  4KRA A;  2K22 A;  3AEB B;  1ESF A;  2WXL A;  2G9H D;  2BS2 B;  4RNA A;  2QEJ C;  4L23 A;  2PVO D;  1EU3 A;  3P4Q B;  3TEY A;  1QF6 A;  4RLC A;  2W55 A;  1YJJ A;  3U4E G;  3AEA B;  3A2S X;  4AQ7 A;  3SEB A;  3AEF B;  4B61 A;  2B76 B;  1VZ8 A;  2Y3A A;  1FIQ A;  5EE0 A;  4O3Z A;  2M19 A;  3KLS X;  2N2M A;  1GFP A;  1V1P B;  2M0A A;  1C76 A;  1L6V A;  5AFU K;  2K5P A;  1QT9 A;  2RDH A;  4MT5 A;  1CK1 A;  1L5P A;  2ACZ B;  2CJO A;  4FRX A;  3P4S B;  2JMM A;  2WU5 B;  3BZD B;  1L0V B;  1GPX A;  1ZDV A;  3E56 A;  3W1S A;  3NVY A;  3IAM 1;  1SB3 C;  3NVV A;  4DXG A;  3EMN X;  4GCS A;  1JCK B;  4XWT A;  2BS3 B;  4FOZ A;  3AE9 B;  4JPS A;  4IDI A;  4RGM A;  2HDE A;  2PVG C;  3MJ5 A;  5ADX K;  1HXU A;  2N7J A;  7PRN A;  2W81 C;  4Z3T A;  1ZHW A;  3U7Z A;  5EE3 A;  5I4D A;  3FC4 A;  3AE1 B;  1JRO A;  2X38 A;  4C7Y A;  4PT5 A;  4ZRP A;  1KFY B;  2BT6 A;  1TY2 A;  4WWM A;  4RLB A;  1C79 A;  3IXS A;  1TJE A;  3PZ8 A;  2XE5 A;  3ZJU A;  3RFZ B;  2KDY A;  4AYI D;  1L4D B;  2V4I B;  3E9S A;  3BK2 A;  3TUO A;  4REZ A;  4HKZ E;  1TKE A;  1H6S 1;  3URY A;  3FIL A;  4US9 A;  1J7A A;  2OMF A;  5AUK A;  1FMA D;  4JCH A;  4OVZ A;  1QOF A;  3RBH A;  4AYM C;  1HEZ E;  3GP7 A;  4LK0 M;  4YTP B;  1FD6 A;  2RPV A;  4RGT A;  2W82 A;  4ZHO A;  1P4T A;  2AQ1 B;  4YT0 B;  4FSP A;  2WDV B;  3AE5 B;  3VQI A;  3UI3 A;  2M06 A;  5HG2 A;  2K0P A;  3W5U B;  3QRC A;  3MC0 B;  4FZN A;  1K50 A;  1E7P B;  3POR A;  1ROE A;  4AFK A;  4IOI E;  2YNK A;  3HVZ A;  2W80 C;  3AA6 B;  5FKA C;  4FZM A;  4GHB A;  4JX1 C;  5G5H A;  2DYM A;  5EE2 A;  3PQU A;  4AYE C;  5D3I B;  1SSN A;  1XXG A;  1GFO A;  1KH0 A;  3H8H A;  2WXK A;  3NRZ A;  1EWC A;  2KZ7 A;  2LEK A;  2MJD A;  3POU A;  2X27 X;  4KGS A;  3VY8 X;  1BXT A;  4D5U A;  4NZL B;  1L4Z B;  2YEP F;  3NSG A;  4GCQ A;  3BYT B;  4WUR A;  2J4X A;  1M4V A;  1PRN A;  1FXA A;  3HOL A;  3AEC B;  4L1B A;  4CQN A;  3GS2 A;  1UUP A;  2KMM A;  1C4A A;  4O49 A;  2WXQ A;  2FE8 A;  2JQR B;  3VZT X;  2PW9 A;  2ONQ A;  1PFD A;  2BTE A;  4RJW A;  3NVW A;  4HRO A;  2FGR A;  1TKG A;  1SF0 A;  3LK4 1;  4AUI A;  2ERV A;  1XLN A;  3LK3 B;  1N5W A;  1UNS A;  1XEE A;  1YJI A;  4NAW B;  1PHO A;  4RF0 A;  3Q8A A;  4RGN A;  1EM7 A;  1D6E C;  1V8C A;  2LHE A;  1PDX A;  3TSS A;  2LHF A;  2XMX A;  2QIE B;  1OFF A;  4KKI A;  2K9X A;  1FRR A;  3VRB B;  4ARC A;  1SE4 A;  2BB5 A;  4FSO A;  4N59 A;  3MFG A;  1C4P A;  1YN3 A;  4O1N A;  1YS5 A;  1JQ4 A;  1XCT L;  1XCQ L;  1SJE D;  1K53 A;  4OW0 A;  1HXT A;  2DWQ A;  1STE A;  1I4R A;  2IGG A;  1F77 A;  2HTM E;  2KXP A;  4RH6 A;  1MPE A;  4RL9 A;  2Y5P A;  2PKO A;  4RJX A;  4YWG G;  3LK2 A;  5H8Y E;  1QOA A;  6PRN A;  4B0M A;  3DWM A;  4FRT A;  3AAA B;  3AE8 B;  3R2I A;  2GE4 A;  2J52 A;  1JML A;  3AED B;  3AEG B;  5GXG B;  1D5Z C;  3FAH A;  1KF6 B;  4GF4 A;  1Q9G A;  1CQV A;  5BMI A;  1EU4 A;  1VLB A;  1F0Z A;  1E10 A;  1OSM A;  4N6E B;  3AAE B;  1QQR A;  1TZO A;  4A8X C;  4A6Q A;  1MPF A;  4MAC A;  3BWU D;  4C56 C;  4AYD C;  1VZ7 A;  1ZHZ A;  2ZFG A;  3BII D;  2KQ4 X;  2J4U P;  5DL7 A;  1TS3 A;  1FFU A;  2TSS A;  3LXF A;  4LSH A;  1YNT E;  1D5X C;  4G75 A;  4ZOH C;  1JWU D;  1VR9 A;  3LB8 C;  2PLP A;  1KRH A;  2QJL A;  1MVK A;  1WGK A;  1PUT A;  4HJG E;  1GOZ A;  2NMQ A;  1CZP A;  1ZHX A;  3BK1 A;  4AZL A;  2OHF A;  3T24 A;  4E1T A;  1QLB B;  1P7F A;  2I38 A;  1D4B A;  1C9F A;  1ZXH A;  3JTY A;  2K0L A;  2ON8 A;  3DA3 A;  2SEB D;  1GFQ A;  3HW9 A;  2KAC A;  1DOY A;  1JWS D;  3BVZ A;  3SY9 A;  4RFB A;  5LNK 1;  3HVD A;  1ZXI A;  4YXD B;  4A9A A;  3R8B A;  1DYQ A;  2RMM A;  3T20 A;  1K51 A;  2WQY B;  1HQR D;  2WU2 B;  2JXT A;  2LGI A;  2QSD A;  2EKI A;  2WXM A;  3I57 A;  1ET9 A;  2WLB A;  2N0S B;  4YTM B;  1QJ8 A;  3Q8C A;  4US8 A;  1V1P A;  1UWX A;  1R7S A;  3KWV A;  2M56 B;  1J7C A;  2ZW0 A;  2WXP A;  1VDV A;  3P4P B;  2K4T A;  2WXO A;  2JYE A;  3U2S C;  1ZP0 B;  2BW2 A;  2DBY A;  1AW7 A;  2GI9 A;  1IBX A;  3SYS A;  2INN E;  2JU6 X;  3P1M A;  2LMC A;  3KVD D;  4DQO C;  4TQ0 A;  4XNL A;  1XLP A;  3GB1 A;  1BT9 A;  1HXY D;  2YEP B;  4L2Y A;  4B0E A;  1OQR A;  3AMZ A;  3NVZ A;  3V05 A;  2PRN A;  1I4X A;  1VJK A;  5HI1 A;  1YN4 A;  1PYW D;  3VZW X;  3FIL B;  2RDG A;  5IYU A;  1TY0 A;  2QIL A;  1RYJ A;  5JDP A;  4ARI A;  1WWT A;  1IUE A;  1Y56 A;  4JFB A;  5FK9 C;  1EWY C;  4WAF A;  2FUG 1;  2INP E;  3O13 A;  4YSX B;  1WYG A;  4H2A A;  1GFN A;  2BBC A;  2PTL A;  3BVM A;  3AN1 A;  1LO5 D;  1IZN A;  3AA1 A;  3W5V B;  3NUH B;  4MH8 A;  2LUM A;  5E6J A;  3SZD A;  1TS5 A;  1G90 A;  3ZJT A;  3P63 A;  1TS4 A;  4ZRQ A;  3LYY A;  3IT4 B;  1BH3 A;  3WCQ A;  1YQ4 B;  1J7B A;  3AAA A;  3B2F A;  2W3S A;  5BMG A;  1RFK A;  2BS4 B;  2N2L A;  1FEH A;  2XTQ A;  1V97 A;  1P7E A;  1WRI A;  2IDY A;  2MJE A;  1CJE A;  1V1O A;  3POX A;  4WQM A;  3NS1 A;  3UU2 A;  2J1N A;  8PRN A;  3QRA A;  1B1Z A;  2VZK B;  3ETR A;  4R3D A;  4WIP A;  2IGD A;  1FCC C;  2F1T A;  4XDD A;  3KWL A;  2H88 B;  4AS1 A;  2V3P A;  2KZ7 B;  3T3N A;  4OZC A;  1Q9F A;  2AX5 A;  4GDL B;  4MM3 B;  4USA A;  4FMS A;  3AE7 B;  4P16 A;  3WI5 A;  1N62 A;  2XTR A;  3BVG A;  1BML C;  4C80 A;  1HZ6 A;  2BB6 A;  4JWU C;  4NJC A;  3ZYY X;  4LSE A;  5T5F A;  1ZOY B;  2OED A;  1GB4 A;  3LK3 A;  1THQ A;  2R61 A;  3AM9 A;  1XF5 L;  1YN5 A;  1ZHT A;  1TKY A;  4AYN A;  1PGA A;  1FO4 A;  1JWB D;  3L4P A;  1I4Q A;  4PUX A;  2VZK D;  2AQ2 B;  2QTK A;  2KDM A;  1FNV A;  3FYX A;  1FNU A;  3Q8F A;  1IZN B;  2J42 A;  1QKZ A;  3AE6 B;  3AA0 A;  3AB5 A;  2Y7S A;  2CU3 A;  2WXN A;  3VR8 B;  2W54 A;  2ICI A;  2Y0H A;  1GB1 A;  2AQ3 B;  2XE2 A;  5D7G A;  1RM6 C;  1DOI A;  1KLU D;  3K19 A;  2KWD A;  3AH7 A;  4OZA A;  4XWW A;  1FNW A;  1XO3 A;  2V0G A;  1VZ6 A;  2WXJ A;  3WI4 A;  4RCO A;  2ZLD A;  3SFD B;  2POR A;  3DA4 A;  3PRN A;  3Q8B A;  1C78 A;  1E6E B;  4GLS C;  5TSS A;  1E0Z A;  1L0X B;  4JE3 B;  5BYR A;  3HWB A;  2WDQ B;  4KGT A;  4D65 A;  3POQ A;  1OPF A;  3LK2 B;  2F1V A;  3P4R B;  5AUI A;  2BYT A;  4D64 A;  2K3U A;  4HEA 1;  2WXR A;  3AE4 B;  3T3O A;  2Y2X A;  3Q69 A;  2FGQ X;  4Q2J A;  4LSI A;  2E6X A;  3O0E A;  5DL6 A;  1HA5 A;  1I4G A;  1BXW A;  1AWD A;  2Z8L A;  4LSF A;  3DWG C;  1YQ3 B;  2MNH A;  4RGO S;  4DXF A;  3TEX A;  3LK4 2;  1FM0 D;  1IGC A;  4O3X B;  3VY9 X;  3AE2 B;  4ZYS A;  1UGJ A;  4FT6 A;  1GAQ B;  1DGJ A;  1ORM A;  2LHD A;  2XE3 A;  3R2T A;  2L52 A;  5BMH A;  2FBW B;  1ZUD 2;  1NEN B;  5C2T B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...