4N59A

The crystal structure of pectocin m2 at 2.3 angstroms
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
270
structure length
262
Chain Sequence
ATYKVKDVTTGAEIEVPDDKYILDEFEKQGVNLPYSCRAGACSSCVALISSGEVDQSDGSFLSEKQEKKYILTCCSYPKSDCTIETGYEDKILEDFEIELAETGLEFFNDLKDSLPRSGEILSGVTAPFEAFDHYLFGNGVERSININDVGFNINVSQIPPIMSLLNGKNVGRFDIGSDFVRNTALDGYSVAAYLGNITMRTEGVLNVKSDGTWQYEGVIRSYNDTYDANPSTHRGALGEWSGTPYEIRIPGELKIKENGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectocin M2
publication title Structure of the atypical bacteriocin pectocin M2 implies a novel mechanism of protein uptake.
pubmed doi rcsb
source organism Pectobacterium carotovorum subsp. brasiliensis
molecule tags Hydrolase
total genus 78
structure length 262
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF14859 Colicin_M Colicin M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.140 Mainly Beta Beta Barrel Porin Porin 4n59A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4n59A01
1FIQA 1FRRA 1UWMA 2CU3A 2WLBA 3VRBB 1OQRA 1DOYA 1NYRA 1ZXIA 3AEDB 4YTPB 4G75A 4A9AA 3AE3B 1QOFA 4P6VF 1J7AA 1FO4A 4ZHPA 1AYFA 2L83A 3P63A 3L4PA 4YSXB 1JROA 4ZOHC 1JWBD 3AV8A 1T3QA 3AE2B 2E3TA 2MH7A 4JWSC 4N59A 1KRHA 1ZOYB 3ETRA 3RPFC 3ZYYX 5H8YE 2FBWB 3HRDD 1J7BA 2XTQA 5MPOA 1TKYA 2WDRB 1V8CA 3AE9B 3BIID 3AE4B 4N6EB 2W3SA 1JRPA 2EKIA 3AE8B 2AX5A 1GAQB 3NVVA 4USAA 1QLBB 5AUIA 2KMMA 2Y5CA 1RFKA 2H88B 1A70A 3P4PB 3P4SB 1N5WA 3DA3A 1FFVA 2G1EA 1NVID 1WXQA 1XLQA 2PKOA 5EE9A 3LXFA 1V97A 4US9A 3B2GA 4WQMA 1QF6A 1GPXA 1E9MA 1TJEA 3B2FA 1JW9D 3EUB2 2PVOD 3AECB 1VDVA 3W9CB 1DOXA 1RWSA 1FM0D 1PDXA 1RYJA 1DOIA 1SIJA 2JQRB 4N58A 1CJEA 3HVZA 2XMXA 1R7SA 1L5PA 3FAHA 4ITKA 5EE3A 2K22A 3NVZA 3P1MA 1RM6C 5EE0A 1CZPA 3VRAB 1KF6B 1SB3C 3AM9A 5C2TB 3SR6A 1YQ4B 3AE5B 2WU5B 1YJJA 1E0ZA 5G5GA 1NYQA 2Q5WD 1OFFA 5AUKA 1L6VA 1AWDA 5EE1A 1JQ4A 1B9RA 5GXGB 1PUTA 3CIRB 1YQ3B 1NEKB 3AMZA 1WYGA 3AEBB 1FMAD 1EWYC 2JX5A 1TKGA 4HROA 5G5HA 4US8A 5C3JB 1QOGA 1QOAA 1TYGB 1DGJA 1N63A 1ROEA 1XO3A 2K9XA 2DWQA 3HUIA 3SFDB 1VLBA 2BS2B 1J7CA 1E10A 4FZMA 1WRIA 4G76A 2DBYA 4YXDB 3AN1A 4WWMA 2BS4B 1YJIA 4IDIA 1IUEA 1N60A 1N5XA 3LB8C 3AEAB 3CWIA 3ABVB 3B9JA 1L0VB 3AEEB 3NRZA 1N62A 1JALA 1FXAA 2M19A 2MJEA 3NVWA 4YSYB 4YT0B 1WWTA 3NS1A 1QT9A 4JX1C 4KX6B 4ZHOA 2WU2B 2PVGC 3NVYA 2W3RA 2QJLA 1NI3A 4C7YA 4LTUA 2KAJA 1QOBA 3WCQA 4C80A 3FC4A 3AE7B 1PFDA 2N0SB 2WDQB 3P4QB 1E6EB 4FZLA 2H89B 2XTRA 1FFUA 2HTME 2OHFA 2MJDA 3P4RB 1XLPA 2WQYB 1ZUD2 3KWLA 3DWGC 1F0ZA 1I7HA 1XLNA 1SF0A 1FRDA 1XLOA 2M56B 3AEFB 1TKEA 2WP9B 1VJKA 1L6UA 3DA4A 2K5PA 2WS3B 4YSZB 2WDVB 4JWUC 4YTNB 3VR9B 3VR8B 4HRSA 3PO0A 1E7PB 3AE1B 2W54A 3SFEB 2ACZB 1FXIA 2BS3B 2CJOA 3AE6B 3DWMA 1OQQA 3W5UB 3W5VB 2MJ3A 4C7ZA 2B76B 3AEGB 1NENB 4YTMB 1KFYB 1N61A 1ZP0B 4FZNA 2PIAA 1JWAD 2QIEB 1WGKA 2BT6A 2LEKA 3AB5A 2CJNA 2L52A 3AH7A 4FXCA 5H92C 2W55A
chains in the Genus database with same CATH superfamily
3POUA 1PQSA 3RFZB 2JZZA 1OQRA 4K81A 1NYRA 3RBHA 4P6VF 3DWNA 4M0WA 4MJSB 3AAEA 3DVGX 4PS7A 2Y2XA 1T5XD 4OZAA 2NBUA 4JQWC 3HIZA 2XTQA 1P0RA 1TKYA 5IKCM 4IL6O 3DBLI 1ENFA 5D3DA 3U30A 3U7ZA 4IWQA 1YX5B 2C5LC 1YN3A 2PVOD 2XNAC 2KX3A 3FAHA 1R4MI 2N2MA 3ZXVA 4FLHA 3QCAA 5C23A 2KN5A 1L6VA 5EE1A 1L7YA 1SBBB 1JWUD 4IM2A 3AMZA 5DL6A 4BOZB 4HROA 1TS5A 3MHSD 2IO3B 4WAFA 1DGJA 4IUMB 2DWQA 5BYSA 2PMVA 3UU2A 4XZ4A 1HZ5A 3QC8B 1WJ6A 1UELA 1GUAB 4YT0B 3DCGA 3DPDA 1V2YA 1KLVA 2OEDA 3P42A 1PFDA 4FSPA 2D07B 1MG8A 3DBHB 4E3CA 3P4RB 4CTDA 1E54A 1ZXHA 1L0YB 4RJXA 3PQSA 3SZDA 1GJZA 4URKA 1VJKA 2R4NA 3QK0A 4EE2A 4AQ7A 2AQ2B 4RF0A 4F8CB 4YTNB 4ACFA 3UF8A 3ZTCA 2WXNA 3U7DA 4C7ZA 3OLMD 3QWZB 2JQYA 3AEGB 3RCZA 2VZKD 4FZNA 3APFA 4IWOA 4LDTB 2LEKA 3PHXB 1EF1A 4A9AA 4G75A 2KXPA 1J8CA 4JWSC 2WXHA 5IOIA 1QZEA 2VZKB 3VTWA 4LNOA 4ANUA 3AE8B 1CK1A 3QJZA 4USAA 1QLBB 3DOWA 4ZRKA 1HXUA 2Y5CA 3EFUA 3Q69A 1C3TA 1XXGA 1IGCA 2DZKA 1TZOA 2KMCA 2GMIC 5BMGA 3UAQA 3X0WA 1S5LO 2ASQA 3CMMB 1FM0D 4FMSA 1WX9A 2L32A 3P2BA 2XN9C 3N1ZC 2M0XA 2NCNA 5AUKA 5E6JA 5I4DA 4O4XA 5E6OA 2QMTA 3V6CB 3WALA 1GNUA 1N63A 3HOLA 1ROEA 4A6QA 4A20A 2IO0B 3E56A 2DAFA 4GU2A 2MBEA 3LK3B 2RPQA 1S3SG 1F1HA 5CTRC 3TMPB 4RCOA 4K7WA 2EELA 1C79A 3V62A 3APDA 2ZNVB 2WXKA 2RD0A 2M8SA 3K19A 2QJLA 3A9KB 1WYWB 4HDOA 2WDQB 2R4OA 2H89B 3Q3NC 2INNE 1H4RA 3AA7B 2LGSA 3O0EA 3X23A 3POQA 3QRCA 3DA4A 4O1NA 5L95C 2MBHA 4HEA1 1V1PB 2KOXA 4CHKA 8PRNA 3PO0A 1WZ0A 2JMMA 2UU7A 3HW9A 4AZLA 4S0RA 2KWCA 4IM0A 3LDZE 4C4VA 5JH5C 1WXAA 2G3QB 3VE1A 2INDC 2JYTA 2JVCA 3VRBB 1FEHA 2PE6B 1LQBA 2NVUI 2KC1A 4W9KA 2LXCA 2KDBA 3ONSA 3L4PA 3ZJVA 4ZOHC 2MH7A 5G2NA 2KN4A 4WJPA 2KX0A 3HWBA 4WIPA 2WDTB 2IJ0A 1WXQA 2GBKA 4W9HA 3UQAA 4RGNA 3KWVA 4W9DA 2KVZA 2LXAA 2V4LA 4TMAB 1WF9A 2N1WA 2XMXA 2YLMA 2K22A 3NVZA 1HTQA 2RGFA 1H8CA 5G26A 2EKEC 4B0MA 1JQ4A 5GXGB 1D5ZC 3TSSA 2PORA 3RNGC 3HM6X 3TEYA 5EE2A 2M06A 3AEBB 2V3PA 5G5HA 2JX5A 2N7EA 3JW0X 3ZLZA 1TYGB 2KDIA 1ET6A 3AA0B 1OGWA 3APCA 5LXIB 4KZ0A 1IUEA 4MM3A 4BFRA 1E8XA 3ABVB 3AEEB 1WWTA 3VUXA 1LFDA 3QAQA 2KXJA 1M4VA 1D5XC 2X8XX 5AFUK 1QJPA 3AAAB 3P4QB 1WX7A 3ZTDA 1BT0A 5DPSA 5EDSA 4GMVA 4FESA 4NQLB 3SD5A 3KVDD 2LUEA 1MHXA 3ALBA 4GCPA 5T8IA 1T0YA 4ICVA 3IXSA 1WY8A 2CHXA 2K3UA 5FVNA 1NENB 4YTMB 2FE8A 3GP6A 2PIAA 2K1FA 2JUOA 2WXRA 1ORMA 3A2SX 2XBBC 3FYXA 1ZXIA 3AEDB 2JWZA 2Y7SA 2LASA 2L83A 5GTHO 3PREA 3JCUO 2VH1A 4HCPB 3LK42 3C19A 1YN4A 3DBHI 4D5UA 1B1ZA 4W9EA 1IBXA 4FT6A 2FGRA 3PLUA 3EHVA 3NOBA 1J0GA 2G4SA 2ZW1A 1C4AA 3A9JB 2WJRA 3B08A 3URYA 3MTNB 3B2FA 4FADA 5HHDG 1TIFA 5EE3A 3P1MA 3PQUA 3QIJA 1F2RI 1MPEA 1YQ4B 4JLCA 1NYQA 4LNFA 3BZDB 1T16A 2JU6X 1MHHE 1TS4A 3CIRB 2JSVX 3A33B 3WI5A 2KDEB 4US8A 1WGYA 3ZNHB 4FJYA 2Y5PA 2VH2A 3WIMA 1WH3A 1OEYA 4A55A 1WGRA 4NAWB 3NVWA 2KMAA 2R2OA 1ISNA 2KFKB 2FCSA 4LTUA 4C80A 1QOBA 1SE3A 2DLBA 4EOYA 3AE7B 1QKZA 2N0SB 2YEPB 2M17A 1GB1A 5IYUA 2LGYA 3DVNV 4WWOA 4YL8A 2ZVOA 2LZ6A 3H1UA 4RM8A 4ARCA 3KWLA 2QCZA 2JYEA 3MP9A 1THQA 4N74A 1TKEA 2I1KA 3BVGA 4C69X 3BRZA 4E1TA 4HKZE 4I6PA 2DHZA 2VRRB 3I5JC 3BS0A 4S17A 5IN7A 4O3XB 1ET9A 3PPAA 5KAFO 2FBWB 5DPRA 3VTUA 2JPHA 4XWTA 5AUIA 4WJOA 4PT5A 2ZNVC 1XQQA 3BY4B 2PKOA 4Z3TA 4MSMB 3AXCA 2WVPA 2Y0LA 2UWQA 2O2VA 1M94A 1JWSD 2J4UP 3R66C 2RMMA 1SIJA 1TY2A 7PRNA 4ITKA 4JE3B 4GIVA 2L0FA 3EC8A 2KJRA 2O6VA 3AM9A 4IC7B 3SR6A 3Q3OC 1OFFA 5AZFA 1L4ZB 4I6LB 2CU1A 4FRXA 4OVVA 1TZ1A 3N32A 3Q2AC 3JSVB 4JL9A 3UPGA 2ZW0A 1NI2A 2DENB 2GB1A 3H7PB 3PLVA 2Z0EB 2NMQA 4FZMA 2W80C 2WX0A 2K4TA 4GXBA 4BKSD 4FHKA 2OJRA 4G50A 4B61A 2X38A 2L0TA 3CWIA 3M3JA 4P7IA 3TEXA 4ZRPA 5BMHA 3N1XC 1T0QC 3WAMA 1YOVB 2DNFA 5KHQA 1OQYA 3GE8C 3FC4A 3SYSA 2EMTA 3VZUX 4FJVB 4RLCA 2N9PC 3MC9A 2LVQA 1SF0A 1GC7A 2SAKA 1XEEA 3A4SC 2WDVB 3DDCB 2MP2A 4GSWA 4I6NB 1QILA 1H6S1 3OJ4B 5BYQA 1TS2A 5AZGA 1GG3A 1V1OA 3MJWA 4MJSA 4MACA 3BWUD 3AA1B 4YWGG 2GE4A 2INPE 3ZNGC 4KIKA 1HXYD 1AYFA 2J52A 2OOBB 3ENEA 3PV1A 4N59A 1SXTA 2BQQA 3ZYYX 3HRDD 4PYZA 2WDRB 4MGKE 1IZNA 1LXDA 4RNAA 2W3SA 2EKIA 1BT9A 1DYQA 1GAQB 2KQSA 2MEKA 1GFPA 3V8UA 2LUMA 2SEBD 2IPKD 3Q3MC 3VAWA 1DOIA 4F4BA 4KR4A 2N7DA 3CSFA 3HVZA 4LCDE 2J0MA 3ZKJC 3T3OA 4AS1A 2R88A 4HJGE 4RF1A 4M00A 1E0ZA 4RGOS 1JMLA 1WM3A 1V9JA 2Y0HA 5TISO 4W9IA 4BUMX 3QQ8B 3EGRA 1EWYC 1Q9FA 1WIAA 4WWPA 4F1SA 3KYDD 3SFDB 5BMIA 3AN1A 1N5XA 2D5GA 3NRZA 4YSYB 2MW5A 2KZ7B 2E6XA 2DX5B 3DZMA 1C4PA 1U4AA 3JYUA 3Q3FA 3BK2A 4L1BA 2MA9B 3KUCB 3ZGZA 2M4NA 4O3ZA 3ZNID 3L13A 2I2YA 2V9HA 2BYEA 2MNHA 5J2RA 3A1QB 4AYID 2PRNA 2K25A 3VR8B 1E7PB 3SFEB 2XE1A 3W5UB 3W5VB 4H2AA 1KFYB 2JRHA 2BB5A 1BUIC 2D11A 4XYCA 1FRRA 2CU3A 4O49A 5JDPA 5AEKB 2KNBA 3AE3B 3AA6B 2A5UA 2LHFA 2QTKA 2MRPA 4ZHPA 1K52A 2R2QA 3GE3C 1ZW7A 4BKGA 1JRPA 5DPWA 1VZ6A 3AU5A 3JTYA 3ZQ4A 2AEHA 2KJHB 5EE9A 2IY0B 3B2GA 4BAXA 1GFQA 3BVZA 3C8YA 1TY0A 1HEZE 1IGDA 2Z0DB 1JW9D 1TJEA 2ZCBA 1DOXA 2L3ZA 1ZHWA 4N58A 1KF6B 5LLIA 4NPNA 1EF5A 3PRNA 4K1RB 2LGXA 4MDKE 4RM9A 3VDZA 3BK1A 3Q8CA 3BYYB 5IA7A 3KLSX 1TBEA 4TQ0A 2LHDA 1WYGA 3PGRA 1YNTE 3LK3A 1YX6B 1GB4A 2Y0KA 3O65B 1V81A 3U2SC 3AI5A 2K8BA 3A0BO 2W9NA 1WFYA 2R4LA 4G76A 2DBYA 2KFJA 2KWUB 5GV0A 1EU4A 4RMAA 3PVLA 4J3OD 3A9KA 3I57A 1C4CA 3MFGA 1QT9A 1UGMA 2XG6A 1QQRA 4C7YA 1UH6A 3NZ3A 1P7FA 3KUZA 3AA7A 2I38A 4GDKB 5TR5A 1HQRD 4DHJD 3C5OA 1V1PA 3DWGC 5PRNA 1YMHE 2FUG1 2KJ6A 4NZLB 5DPTA 5FKAC 2LVPA 2RPVA 5TSSA 2D3CA 2LD9A 4WH4A 3NZSA 2BYTA 1FNVA 2MHLA 4LSHA 5ADXK 4FUVA 4J6IA 1XCQL 4AWJA 4A8XC 5FR3A 1FXIA 3PRZA 3PSEB 1D4BA 4RL9A 4DHJB 1OEYJ 1UBQA 3R2IA 1UNSA 2MCNB 2KWVB 1QOFA 1N6ZA 4IW0A 3QRAA 1Z5SB 2PLPA 3E9SA 4XDDA 1JWMD 4AJYB 3BVMA 3Q8BA 1FPYA 2Y5BB 1AN8A 3UIOB 3VUYA 3RZWC 2W82A 2QC8A 4ZRJA 1N5WA 3ZUNA 1UD7A 3TL5A 3KVFB 3DHGC 3HK0A 3R7RA 4LSFA 1WR6E 4OHJA 1WR1A 3Q8FA 4NJ7A 2KLCA 2Q5WD 4R3DA 5B5EO 4K3CA 2ZJDA 3KZIO 2X27X 4OVZA 4A3OA 3AA0A 1JRUA 1Q10A 3BYTB 3DHHC 2DAJA 1XO3A 2FUHB 2AYOB 2BS2B 1WRIA 3PS6A 3SEBA 1ZE3D 4DK5A 3A4RA 1Y8RC 4N9F4 4CQNA 3L10B 1I4RA 1HTOA 3RMKC 4W9GA 4EUTA 1Q5WB 1PHOA 4XC2A 5KAIO 3RI7C 2MJEA 2L7RA 2GBRA 1C77A 3AAAA 4DHZE 3SY9A 4K7UA 2BWFA 3DBRB 4DDGD 5HKHA 2CHZA 3PT2B 1GFMA 4MGIE 4Q2JA 2XEWA 4OZBA 4C4VB 2HD5B 2C7MB 1IYFA 2GRIA 1TT5B 2KACA 4DXFA 2KKCA 4AOFA 2A4ZA 1I4XA 2JXXA 3O13A 2GBMA 2CJOA 3DWMA 4A90A 1C9FA 4DWFA 1SJED 2NTTA 4C00A 2B3AA 4FXCA 1KOTA 4XNKA 1DOYA 3H9DA 4YTPB 3QHTA 2XK5B 4HK2A 4KSLC 2JT4B 1JROA 3NZUA 3U4EG 4GHBA 1ZOYB 4ZRIA 3PZ7A 4DQOC 4N6EB 3A9JA 2M1MA 3V61A 4F7ZA 1K8RB 1I4GA 2KC2A 4M02A 3FKYA 2G9HD 4KSKC 2FGQX 3LK2A 2KK8A 2QILA 2G1EA 3VHTC 2D3AA 4ZRQA 3Q8EA 2LJIA 2PTLA 3N9YC 1WE6A 4JGHB 4K7SA 4UB8O 1EM7A 1KH0A 1L5PA 2N9KA 2BGFA 5LXHA 1VR9A 2UYZB 1BH3A 4II2B 5DL8A 5KHOA 4D64A 2FIDA 3BINA 2IGDA 3EMNX 4LNKA 1QOGA 3IAM1 5D3IB 3WAOA 2K0LA 1V86A 3B1LX 1SGHA 2AWTA 2M07A 3NS8A 2BW2A 3FILB 2KFKA 1J19A 3IVFA 4JX1C 4KX6B 2WXFA 3EA6A 2OMFA 1Z2MA 2IGGA 3UQBA 3SYBA 4TQ1A 2BF8B 4AKRB 4RH6A 3GOEA 1F2RC 1P4TA 4FQEA 2N1VA 2G4DB 4PS3A 1MI0A 1UF0A 2IO1B 4W9FA 2R8AA 1G6JA 2BVCA 3TEZA 5DL7A 4RFBA 3IBEA 1STEA 5G3AA 1N61A 4G11A 3AB5A 1SJHD 3SY7A 2K0PA 5H92C 5IO9A 1F77A 1WRDB 1BMLC 1I4PA 1YN5A 3L0WB 4MH0E 5JHBA 1C78A 3ZW3A 4ANXA 2HJ8A 4G3XB 2KQ4X 3AE2B 2E3TA 4AJWA 4KGRA 3K9PB 3V60A 2Z8LA 2KVRA 1ZDVA 2JWUA 4WQOB 2KTFA 1GFOA 3MC8A 4ANWA 2F1VA 1XLQA 1WSPA 5GTIO 4GOCA 2RDGA 3QA8A 1VCBA 3W9CB 1RYJA 2BBCA 3UINB 5EE0A 2Z59B 4FHJA 2ZPYA 3JSVA 1TGZB 2XE3A 1P1AA 2PJHA 3H7PA 4KKIA 1WXMA 1PUTA 5G38A 1VZ7A 2NTSA 4ICUA 2IYDB 4AUQC 2WXGA 3VTVA 1TKGA 1HA5A 2QSDA 1PRNA 3HUIA 2LI5A 2K9XA 1VLBA 1J7CA 4NQKE 2W81C 1EWCA 2WXLA 1GOZA 3D32A 1RFAA 1YIWA 1I35A 4B95A 4MEMA 2LVOA 3B9JA 2J53A 4M8MA 4MGYE 5HG2A 3N3KB 3VZTX 1WMHB 4ZYSA 3IT4B 3NVYA 3I63C 4TV3A 2BTEA 4IWPA 4TKNA 3Q8AA 4HDQA 2D3GA 3GZNB 4P1BC 3GS2A 1FD6A 1FFUA 2HTME 4OW0A 4DXGA 1WI0A 2FIFA 2WP9B 3DQVA 3M62B 2WXJA 2WX1A 4JWUC 1MM4A 2INCC 5FR6A 3L08A 5J18A 1IP9A 1OSMA 4L23A 3AA1A 2ZCCA 4LJPB 4M8NA 1F0ZA 1HXXA 3DVGY 2YEPF 5HFYA 4REZA 3U52E 2KTRB 3ZJTA 4GDLB 3VY9X 1UGJA 3WA0A 2LGDA 4HXDA 1LO5D 2IZVB 3DBRI 4IKGA 2WXQA 2KANA 3PORA 3L54A 4AKMA 2FAZA 3SU8X 2ON8A 3T0SA 2HJ1A 3RUIB 3AU4A 2ZVNA 1FFVA 1V97A 3RNFC 2K6QA 3ZXRA 1BXWA 1QF6A 1YS5A 2NPTB 4KDIC 4WJQA 2AL3A 2JZ3B 3PRMB 1Y56A 2KHWB 1KLGD 3PGEA 4M01A 1T6BX 1TS3A 5CX3A 3IHPC 3RNAC 4HPPA 1NEKB 1PGAA 2WJQA 2J0KA 3N30A 1QOAA 3L17A 1E10A 1ACCA 4YXDB 2ZPNA 2KZ7A 5BYRA 2HE7A 2KD0A 4KGTA 1QJ8A 1X1MA 3ZDMC 2IBIB 1L0VB 1KM7A 5IAAC 1E8ZA 3PRPB 3VH4B 2LWPA 2WU2B 4P16A 3VE2A 3H7SA 4PUXA 2MWSB 2NR2A 3WCQA 2MP2B 3NSGA 3A1QA 1FNUA 2WQYB 4OZCA 2MQJA 5D7GA 2KWDA 4MT5A 1OTRB 2MHJA 4IOIE 2M56B 3ZJUA 3HHMA 1VRAB 4HKQA 4YSZB 4KIKB 1F52A 2ACZB 2N9EB 1OQQA 3V05A 3ZRFA 1SE2A 1R4NB 2B76B 4C56C 3BIID 4FOZA 2KQ7A 3AA6A 1AW7A 3AH7A 4KV2A 1IZNB 2M0AA 3TCAA 3ZO5B 2RR9A 3VQIA 1WXSA 2LFIA 4YSXB 4MSQB 3W1SA 2NS5A 1D5MC 2ODJA 3NUHB 1KRHA 1GC6A 3MC0B 5H8YE 3W1YA 4KVGB 4HLEA 3N1YC 5MPOA 3AE9B 5E79O 4M0WB 2JXTA 3AAEB 2J0JA 1WE7A 2H88B 4GGQA 3H6NA 3P4SB 3PHWB 1C76A 1VD2A 3LXFA 3BRYA 5J17A 1D6EC 1HZ6A 4US9A 3QARA 4AYDC 3Q6BA 1T0RC 2FNJB 2QEJC 1E9MA 4GLSC 5H2FO 4AYEC 5DCNA 2JQRB 2KLGA 4ZDVA 4AYNA 5D94A 1HXTA 3AE5B 1YJJA 2GBJA 1ZKHA 4GF4A 3MHZA 4D2KA 3T24A 4CO7A 4LSEA 1FMAD 2DYBA 4LDTD 4AFKA 4QQ1A 5E6NA 2WYQA 4BOSC 4DHZB 4HCNB 4BKTA 3ML8A 4JFBA 4UB6O 5T5FA 5HI1A 2L1AA 3LB8C 2RDBC 3WANA 3HOEA 1UBIA 1LGRA 4PS8A 4UDUC 1XCTL 2K39A 4XDCA 4GDKA 3NHEB 1G90A 1NI3A 2KAJA 5L83A 1AARA 2LMCA 2N2LA 2WXPA 4U9CA 3TJPA 4EZLA 4MGZE 1RLFA 1XLNA 1XLOA 4RGMA 3TBLD 1L6UA 5G55A 1UUPA 3VUWA 3NJTA 1WX8A 2IGHA 4LJOB 4N75A 2KDFB 1ZHTA 2BS3B 2DZIA 1Q0WB 4W9LA 4KRAA 1JWAD 1WGKA 2BT6A 2BYVE 4JPSA 2CJNA 3V3XA 1VZ8A 3LJ3A 3PGSA 1XT9B 1UWMA 1F9JA 2LRUA 2RSUA 5IP4D 1YQBA 4FULA 2MX2A 3PZDA 1J7AA 4NNJB 3P63A 2G45B 3AV8A 1T3QA 3TIXA 2KC0A 2QDFA 2KXPB 4EZKA 1WJNA 3GZNI 4II3B 3JVZX 1WZ3A 4HPMB 2KMMA 1RFKA 4LK0M 3DA3A 6PRNA 1YD8U 1NVID 4XGAB 3CSTA 4WQMA 3UIPB 1JCKB 4BBNF 1V6EA 1ZHZA 3Q14C 1RWSA 1PDXA 2GLSA 4CYEA 1FCLA 4JIOU 1CJEA 1R7SA 3TUOA 3IG3A 4PR7A 3UI3A 3J9CA 1XF5L 1Q9GA 2JF5A 5G5GA 4FN2A 1AWDA 1B9RA 1L2NA 4BZAA 2AXTO 1BXTA 4FSOA 1XD3B 5C3JB 3HM3A 2J4XA 4L2YA 5JHAA 4RLBA 1FNWA 3N20C 4WWMA 3OJ3A 2ERVA 1YJIA 1MG4A 5JZEB 1KTKA 2WXOA 3V6EB 2MBBB 4DDID 1V49A 3EECA 1E5WA 1SE9A 2W3RA 1IPGA 5JXVA 2D10A 3RYTA 1EUVB 5CHFA 4FZLA 2XTRA 4FRTA 1XLPA 3WU2O 1I7HA 2RDHA 2CR5A 4ANVA 2PW9A 2V0GA 3RULA 3R2TA 2LFUA 5GMVA 2FCMA 2IY1B 2V4IB 3RD2A 1ZDXA 4TSSA 2K8HA 3AE6B 4MELA 3DHIC 1ZPSA 2BKRB 2KZRA 2XK5A 2QIEB 1MPFA 2L52A 4EKUA 4D65A 1ZHYA 4KGSA 1FIQA 4B0EA 4K3BA 3G7GA 2BPSA 3VVWB 5DL5A 1I4QA 1WGHA 4ARIA 2V3SA 2K8CA 2PE9A 2JY6A 2PPHA 1QJ9A 2BB6A 2V1YA 3KW5B 2AX5A 2MBOA 3VY8X 2BKFA 2L76A 3P4PB 3I3TB 1E8WA 5FK9C 1S1QB 3POXA 3T9LA 4FA6A 4AYMC 4JCHA 3SHQA 1GPXA 2DZJA 1I42A 1RAXA 1ZGUB 5BO4B 3EUB2 3AECB 1VDVA 1R4NI 3M95A 3S2AA 4B6WA 1RM6C 1KJTA 2KDMA 4FJZA 1RRBA 4XX5A 5C2TB 3KUDB 2WU5B 4GCSA 3DBSA 3TEWA 2DYOA 3TZGA 1LM8B 2L05A 2PEAA 3ZDTA 2REXA 2WGSA 4LNIA 2BYFA 4KKJA 3FILA 2O4VA 3H8HA 4O3WA 4FBJB 3RNEC 1UZXB 1WGDA 4IG7B 1FXTB 1SSNA 3GB1A 4KZCA 3AEAB 1K53A 2X9KA 2AQ1B 2LRWA 2M19A 1CQVA 2D3BA 4MM3B 3R7QA 3HVDA 4TUUA 4AKRA 1PGXA 2ZEQA 1I4HA 2R4PA 1T1LA 3C0RB 1E6EB 2ZLDA 1V80A 3WAPA 1GFNA 4RJWA 3DBLB 4NAWA 4BBNC 1A5RA 2XE2A 2NBVB 2D2QA 4B9KA 2XE5A 4WJNA 3ZIMA 1C1YB 5AZHA 2TSSA 3ML9A 4LNNA 4WWNA 1V5OA 2W54A 2GOWA 3RZFA 4DXAB 1R4MB 1EU3A 3ZNZB 3PZ8A 1CMXB 3CF6E 2WLBA 3W1SC 5C1ZA 2C60A 3IT6B 3LK2B 4HVBA 2JZPA 1PYWD 2ZZPB 2LHEA 1FO4A 1P3QU 4RGTA 1JWBD 4O3YA 1K51A 3ETRA 3RPFC 3R3MA 1V8CA 4GCQA 3AE4B 2DYMA 1UWXA 3NVVA 4E1SA 3L16A 1A70A 4HPLB 1FCCC 3T8MA 2N4FA 1IBXB 4X57B 3ZVVA 1WJ4A 4ZYNA 4XNLA 2F1CX 5ADXL 4OVUA 2IO2B 2Y3AA 2ICIA 2MBQA 2CHWA 4W9JA 1PGBA 2FCNA 2L8JA 4LLGM 3VRAB 1CZPA 3U8ZA 3VXWA 4MH8A 1L4DB 1K50A 3LYYA 4WAAA 2GBNA 3T3NA 2YNKA 1TTNA 2WNMA 2N9LA 2JRIB 3ZRCA 3KQ4A 2WHIA 4KR8A 2IWVA 3RN9C 3DWOX 4XE0A 4QAYA 2DZMA 3KYCD 3PGUA 3W2DA 1WMHA 4IDIA 3MJ5A 2I1JA 3OWEB 4ASWC 2HDEA 4NJCA 1FXAA 1WJUA 4G0NB 2YVCA 2GI9A 3NS1A 4ZHOA 2KO3A 2OJWA 5E6PA 2C7HA 5LNK1 1V5TA 3PF1A 4NAMA 5B66O 4EEWA 4DBGA 2KYWA 2MJDA 3A0HO 1ZUD2 1P7EA 4BVUC 2L00B 2WXMA 1KLUD 1HE8A 2YPVA 2K5PA 1OPFA 4E74A 2IWWA 2V3NA 3LK41 4GB9A 3QX1A 2AQ3B 4BKSA 2MJ3A 4AP4C 1MFWA 1ZP0B 5D2MB 3IFWB 3I9V1 5G39A 2AL6A 2KTRA 4GDLA 1MVKA 3VH3B 1E7VA 3UGBB 3SZVA 3VFKA 2CKHB 1P98A 1ESFA 3IAS1 3NY5A 3SDLC 4IM3A 2C9WB 3EFCA 2MSED 4GN1A 1J7BA 5D6JB 2C7NB 4HWIB 2R89A 1MM5A 4O4UA 2NPTA 2F1TA 1MJDA 4P1CC 1YJ1A 2QHOA 2O6VD 1NDDA 4E71A 2LJ5A 1Q1OA 3AULA 4XWWA 2HTHA 3Q3JA 3GP7A 1T0SC 2O2VB 1SB3C 3RNBC 2CS4A 5CHVC 5AFUL 2K6DB 4W9CA 1YQ3B 2O6VB 2KT7A 2ONQA 2WWZA 2N7JA 1NBFC 2FCQA 1E7UA 2R61A 4PYUA 1E8YA 1WXVA 1P9DU 2IDYA 3K9OB 5CHWA 2BS4B 1SE4A 2MLBA 1N60A 5D5DA 4NJ6A 2N9XA 1SEBD 1WM2A 4LSIA 1N62A 1JALA 2KDYA 3RT3B 4EFOA 4PJ0O 2PVGC 4A3PA 1L0XB 3OG5A 2BWES 2J1NA 1E90A 1D3ZA 2J7QB 3DVNU 1WGGA 2OHFA 3ECIA 2NBWB 2WXIA 1FRDA 3OAWA 4KDLB 3R8BA 3AEFB 3NG0A 4EZJA 3T20A 2WS3B 2ZFGA 4NY0A 2EMSA 3VR9B 1EO6A 4HRSA 3AE1B 3KH0A 4AUIA 4HJKA 2J42A 1ZHXA 3M63B 3RNCC 4PK1A 3VZWX 3WI4A 3B0AA 2LGIA 3PTFC 4WURA 1SIFA 2W55A
chains in the Genus database with same CATH topology
3POUA 3RFZB 4XNKA 1UWMA 1DOYA 1OQRA 1NYRA 3RBHA 4YTPB 4O3XB 4P6VF 1ET9A 1J7AA 3P63A 4M0WA 3AAEA 1JROA 3AV8A 1T3QA 2Y2XA 3U4EG 1T5XD 4GHBA 1ZOYB 4OZAA 2KC0A 3PZ7A 2FBWB 2KXPB 2XTQA 4DQOC 1TKYA 4N6EB 4A6QA 1I4GA 4XWTA 5AUIA 2G9HD 4PT5A 2KMMA 2FGQX 1RFKA 3LK2A 2QILA 4LK0M 3DA3A 6PRNA 2G1EA 1NVID 4Z3TA 2PKOA 1ENFA 4ZRQA 5D3DA 2Y0LA 3Q8EA 4WQMA 3U7ZA 1JCKB 2LJIA 2PTLA 1YN3A 3N9YC 1JWSD 1ZHZA 2PVOD 2J4UP 1RWSA 1EM7A 1PDXA 1SIJA 1TY2A 2RMMA 2XNAC 1FCLA 1CJEA 1KH0A 7PRNA 1R7SA 1L5PA 3FAHA 2N9KA 4ITKA 4JE3B 3TUOA 3UI3A 3J9CA 2N2MA 3AM9A 3SR6A 1XF5L 1Q9GA 1VR9A 5G5GA 1BH3A 1OFFA 5DL8A 1L4ZB 1AWDA 1L6VA 5EE1A 1B9RA 1SBBB 4D64A 4FRXA 1JWUD 3AMZA 5DL6A 3UPGA 2ZW0A 4HROA 1TS5A 2IGDA 1BXTA 3EMNX 2GB1A 4FSOA 1QOGA 4WAFA 3IAM1 1DGJA 5D3IB 5C3JB 2J4XA 2DWQA 4L2YA 5BYSA 2K0LA 4RLBA 2NMQA 4FZMA 1FNWA 2PMVA 2W80C 3UU2A 2K4TA 4WWMA 2ERVA 1YJIA 2M07A 4B61A 1HZ5A 2X38A 2BW2A 3CWIA 3FILB 3TEXA 4ZRPA 5BMHA 1KTKA 4YT0B 2WXOA 4JX1C 4KX6B 2WXFA 2W3RA 2OEDA 3P42A 3EA6A 2OMFA 2IGGA 3FC4A 3SYSA 3SYBA 4TQ1A 1PFDA 4FSPA 5JXVA 3VZUX 4FZLA 2XTRA 3P4RB 4FRTA 1E54A 4RLCA 1XLPA 1ZXHA 4AKRB 1L0YB 1I7HA 4RH6A 2RDHA 1SF0A 4RJXA 3PQSA 1F2RC 3SZDA 2PW9A 1P4TA 2V0GA 2SAKA 1VJKA 1XEEA 3R2TA 2LFUA 4EE2A 4AQ7A 2AQ2B 4RF0A 2WDVB 4YTNB 1MI0A 2V4IB 3TEZA 1ZDXA 5DL7A 4RFBA 4TSSA 3AE6B 1QILA 1H6S1 1ZPSA 2WXNA 4C7ZA 3AEGB 1STEA 5BYQA 2VZKD 1N61A 2QIEB 4FZNA 1TS2A 3AB5A 2LEKA 1MPFA 2L52A 1SJHD 3SY7A 1V1OA 2K0PA 5H92C 4D65A 1ZHYA 4KGSA 1FIQA 1F77A 4B0EA 4MACA 3BWUD 3AA1B 1BMLC 1I4PA 1YN5A 2GE4A 4YWGG 4A9AA 4G75A 1C78A 2INPE 3G7GA 2KXPA 1HXYD 5DL5A 1AYFA 1I4QA 2J52A 4ARIA 2KQ4X 3AE2B 2E3TA 2WXHA 4JWSC 4KGRA 4N59A 2Z8LA 1SXTA 1QJ9A 1ZDVA 2BB6A 2JWUA 3ZYYX 3HRDD 2VZKB 2WDRB 1IZNA 4RNAA 2W3SA 2EKIA 1BT9A 1DYQA 1CK1A 3AE8B 2AX5A 1GAQB 4USAA 1QLBB 1GFOA 2MEKA 1HXUA 2Y5CA 1GFPA 3VY8X 3V8UA 3P4PB 3Q69A 1XXGA 2F1VA 1IGCA 2LUMA 5FK9C 1XLQA 3POXA 1TZOA 1WSPA 5BMGA 4AYMC 4JCHA 3UAQA 2SEBD 2RDGA 2IPKD 1GPXA 3EUB2 3W9CB 3AECB 1VDVA 1FM0D 1RYJA 1DOIA 4F4BA 4KR4A 2BBCA 3T3OA 3HVZA 5EE0A 4FMSA 1RM6C 2KDMA 4AS1A 2L32A 2XN9C 5C2TB 4HJGE 4RF1A 2WU5B 4GCSA 1E0ZA 2XE3A 5AUKA 4RGOS 1JMLA 5E6JA 2Y0HA 4KKIA 1PUTA 3TEWA 1VZ7A 2NTSA 4BUMX 2DYOA 3TZGA 5I4DA 4O4XA 2WXGA 3EGRA 2QMTA 1EWYC 1Q9FA 1TKGA 1HA5A 2QSDA 1PRNA 1N63A 3HOLA 2O4VA 1ROEA 2K9XA 3FILA 4O3WA 3H8HA 3HUIA 1VLBA 3E56A 1J7CA 3SFDB 5BMIA 2W81C 1EWCA 2WXLA 1GOZA 3AN1A 3LK3B 1SSNA 3GB1A 1N5XA 2D5GA 3AEAB 1K53A 4RCOA 2AQ1B 3B9JA 3NRZA 2EELA 2J53A 4YSYB 2M19A 1C79A 5HG2A 2KZ7B 3VZTX 2E6XA 1CQVA 2WXKA 4ZYSA 4MM3B 3HVDA 3IT4B 3NVYA 3K19A 1C4PA 2QJLA 4AKRA 2BTEA 1PGXA 3BK2A 3Q8AA 4L1BA 1I4HA 2WDQB 3ZGZA 1E6EB 2H89B 3GS2A 1FFUA 2HTME 1FD6A 4O3ZA 2ZLDA 4OW0A 2INNE 4DXGA 1GFNA 4RJWA 2I2YA 3AA7B 2XE2A 3O0EA 3POQA 2MNHA 2XE5A 3QRCA 2WP9B 3DA4A 4AYID 4O1NA 2WXJA 4JWUC 4HEA1 1MM4A 1V1PB 2PRNA 8PRNA 2TSSA 3VR8B 3PO0A 1E7PB 2W54A 2XE1A 3SFEB 1OSMA 4L23A 2JMMA 3W5UB 3AA1A 3W5VB 3HW9A 4H2AA 4AZLA 1KFYB 2BB5A 1BUIC 1EU3A 1F0ZA 3PZ8A 3VE1A 1HXXA 2JYTA 1FRRA 3VRBB 2CU3A 2WLBA 4O49A 2YEPF 5JDPA 3IT6B 1FEHA 3AE3B 3LK2B 5HFYA 4REZA 3U52E 2JZPA 3AA6B 2LHFA 2QTKA 1PYWD 2LHEA 4ZHPA 1FO4A 4GDLB 3ZJTA 3VY9X 1K52A 1UGJA 3L4PA 4RGTA 3ZJVA 4ZOHC 1JWBD 1LO5D 2MH7A 2KN4A 4IKGA 2WXQA 4O3YA 1K51A 3ETRA 3RPFC 3PORA 3HWBA 4AKMA 1V8CA 4GCQA 3AE4B 1JRPA 4WIPA 2DYMA 1UWXA 1VZ6A 3NVVA 2ON8A 3T0SA 4E1SA 2IJ0A 1A70A 1FCCC 3JTYA 3ZQ4A 1FFVA 1WXQA 5EE9A 1V97A 1IBXB 3B2GA 1BXWA 4RGNA 1QF6A 1YS5A 1GFQA 3KWVA 3BVZA 1TY0A 4XNLA 5ADXL 1HEZE 1IGDA 1JW9D 1TJEA 3C8YA 1DOXA 4TMAB 2Y3AA 2ICIA 1ZHWA 4N58A 1PGBA 2XMXA 2K22A 3NVZA 4LLGM 3VRAB 1Y56A 1CZPA 1KF6B 1KLGD 4MH8A 3PRNA 1L4DB 1K50A 3LYYA 5G26A 1T6BX 4B0MA 1TS3A 3BK1A 2YNKA 3BYYB 2WNMA 3Q8CA 5GXGB 3T3NA 1JQ4A 3KLSX 2N9LA 1D5ZC 3TSSA 2PORA 1NEKB 3TEYA 4TQ0A 5EE2A 2LHDA 2M06A 1PGAA 1WYGA 1YNTE 3AEBB 3LK3A 2V3PA 3KQ4A 2Y0KA 2JX5A 5G5HA 1GB4A 3U2SC 1QOAA 1TYGB 4KR8A 1E10A 1ACCA 4XE0A 4G76A 1ET6A 2DBYA 3AA0B 4YXDB 2KZ7A 5BYRA 3W2DA 5GV0A 4IDIA 4KGTA 1QJ8A 1IUEA 1EU4A 3MJ5A 3OWEB 3ABVB 2HDEA 4J3OD 1L0VB 3AEEB 4NJCA 1FXAA 3I57A 1WWTA 1C4CA 3MFGA 2GI9A 3NS1A 1QT9A 4ZHOA 2XG6A 2WU2B 4P16A 3VE2A 5LNK1 4PUXA 1QQRA 3NZ3A 4C7YA 1P7FA 4NAMA 3WCQA 1M4VA 1D5XC 3AA7A 5AFUK 1QJPA 2I38A 4GDKB 3AAAB 3NSGA 3P4QB 2MJDA 1FNUA 2WQYB 4OZCA 1HQRD 1P7EA 3C5OA 1V1PA 1ZUD2 2KWDA 5D7GA 3DWGC 5PRNA 1YMHE 2FUG1 2WXMA 4MT5A 4FESA 4NZLB 1KLUD 5FKAC 4IOIE 2M56B 3KVDD 3ZJUA 2YPVA 2K5PA 1VRAB 2RPVA 1OPFA 5TSSA 4YSZB 4HKQA 1MHXA 4WH4A 2BYTA 4GCPA 1FNVA 2V3NA 2MHLA 3LK41 4LSHA 4FUVA 5ADXK 1XCQL 5T8IA 4A8XC 5FR3A 2ACZB 1FXIA 2AQ3B 1OQQA 3IXSA 3V05A 2MJ3A 1SE2A 2K3UA 4C56C 5FVNA 2B76B 1D4BA 1NENB 4YTMB 1ZP0B 2FE8A 4RL9A 3GP6A 4FOZA 2PIAA 3BIID 3I9V1 3AA6A 1AW7A 2WXRA 1ORMA 3AH7A 3A2SX 1IZNB 1MVKA 2M0AA 3R2IA 1UNSA 3FYXA 3VQIA 1ZXIA 3AEDB 1QOFA 4KKJA 2Y7SA 3SZVA 3QRAA 2L83A 2LFIA 2PLPA 4YSXB 3W1SA 1ESFA 3LK42 1D5MC 3E9SA 3IAS1 2ODJA 1JWMD 1KRHA 3NUHB 4XDDA 3MC0B 3BVMA 1YN4A 5H8YE 1J7BA 3Q8BA 5MPOA 4D5UA 3AE9B 1B1ZA 2JXTA 3AAEB 1IBXA 4FT6A 2FGRA 1AN8A 1MM5A 4O4UA 2H88B 2F1TA 2W82A 3P4SB 1N5WA 2ZW1A 1C4AA 1C76A 3LXFA 1D6EC 1HZ6A 4US9A 3URYA 4AYDC 2QEJC 1E9MA 4GLSC 4LSFA 3B2FA 4AYEC 4OHJA 4XWWA 5HHDG 2JQRB 3Q8FA 5EE3A 4AYNA 3GP7A 3P1MA 3PQUA 1HXTA 1SB3C 1F2RI 1MPEA 1YQ4B 3AE5B 1YJJA 1NYQA 2Q5WD 4R3DA 5AFUL 4GF4A 3BZDB 2JU6X 3MHZA 1MHHE 4D2KA 1TS4A 3CIRB 2X27X 1YQ3B 3T24A 2JSVX 3WI5A 3AA0A 4OVZA 4LSEA 1Q10A 1FMAD 2ONQA 3BYTB 4US8A 4AFKA 2N7JA 4QQ1A 1XO3A 2Y5PA 2BS2B 1WRIA 2R61A 3SEBA 1ZE3D 4JFBA 2IDYA 4CQNA 5T5FA 2BS4B 5HI1A 1SE4A 1I4RA 1N60A 2L1AA 3LB8C 5D5DA 3HOEA 4A55A 1SEBD 4LSIA 4NAWB 1XCTL 1PHOA 1JALA 1N62A 3NVWA 2KDYA 2MJEA 4UDUC 4XDCA 1C77A 3AAAA 3SY9A 2PVGC 1G90A 1NI3A 4LTUA 2KAJA 1QOBA 1SE3A 4C80A 2DLBA 1L0XB 3AE7B 2J1NA 1QKZA 2N0SB 2LMCA 2YEPB 2N2LA 2WXPA 1GB1A 5IYUA 2OHFA 4U9CA 1GFMA 4Q2JA 4ARCA 4OZBA 3KWLA 2JYEA 3MP9A 1XLNA 2WXIA 1FRDA 1XLOA 1THQA 4RGMA 3AEFB 3R8BA 1TKEA 1L6UA 2GRIA 3T20A 3BVGA 4C69X 2WS3B 1UUPA 2ZFGA 4E1TA 2KACA 4DXFA 4HKZE 2IGHA 3VR9B 4HRSA 1I4XA 1ZHTA 3AE1B 3O13A 4AUIA 2BS3B 2CJOA 3DWMA 4A90A 2J42A 1ZHXA 1C9FA 1SJED 2NTTA 4KRAA 1JWAD 3VZWX 3WI4A 1WGKA 2BT6A 4JPSA 2CJNA 2LGIA 3V3XA 4FXCA 4WURA 1VZ8A 2W55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FIQ A;  1FRR A;  1UWM A;  2CU3 A;  2WLB A;  3VRB B;  1OQR A;  1DOY A;  1NYR A;  1ZXI A;  3AED B;  4YTP B;  4G75 A;  4A9A A;  3AE3 B;  1QOF A;  4P6V F;  1J7A A;  1FO4 A;  4ZHP A;  1AYF A;  2L83 A;  3P63 A;  3L4P A;  4YSX B;  1JRO A;  4ZOH C;  1JWB D;  3AV8 A;  1T3Q A;  3AE2 B;  2E3T A;  2MH7 A;  4JWS C;  4N59 A;  1KRH A;  1ZOY B;  3ETR A;  3RPF C;  3ZYY X;  5H8Y E;  2FBW B;  3HRD D;  1J7B A;  2XTQ A;  5MPO A;  1TKY A;  2WDR B;  1V8C A;  3AE9 B;  3BII D;  3AE4 B;  4N6E B;  2W3S A;  1JRP A;  2EKI A;  3AE8 B;  2AX5 A;  1GAQ B;  3NVV A;  4USA A;  1QLB B;  5AUI A;  2KMM A;  2Y5C A;  1RFK A;  2H88 B;  1A70 A;  3P4P B;  3P4S B;  1N5W A;  3DA3 A;  1FFV A;  2G1E A;  1NVI D;  1WXQ A;  1XLQ A;  2PKO A;  5EE9 A;  3LXF A;  1V97 A;  4US9 A;  3B2G A;  4WQM A;  1QF6 A;  1GPX A;  1E9M A;  1TJE A;  3B2F A;  1JW9 D;  3EUB 2;  2PVO D;  3AEC B;  1VDV A;  3W9C B;  1DOX A;  1RWS A;  1FM0 D;  1PDX A;  1RYJ A;  1DOI A;  1SIJ A;  2JQR B;  4N58 A;  1CJE A;  3HVZ A;  2XMX A;  1R7S A;  1L5P A;  3FAH A;  4ITK A;  5EE3 A;  2K22 A;  3NVZ A;  3P1M A;  1RM6 C;  5EE0 A;  1CZP A;  3VRA B;  1KF6 B;  1SB3 C;  3AM9 A;  5C2T B;  3SR6 A;  1YQ4 B;  3AE5 B;  2WU5 B;  1YJJ A;  1E0Z A;  5G5G A;  1NYQ A;  2Q5W D;  1OFF A;  5AUK A;  1L6V A;  1AWD A;  5EE1 A;  1JQ4 A;  1B9R A;  5GXG B;  1PUT A;  3CIR B;  1YQ3 B;  1NEK B;  3AMZ A;  1WYG A;  3AEB B;  1FMA D;  1EWY C;  2JX5 A;  1TKG A;  4HRO A;  5G5H A;  4US8 A;  5C3J B;  1QOG A;  1QOA A;  1TYG B;  1DGJ A;  1N63 A;  1ROE A;  1XO3 A;  2K9X A;  2DWQ A;  3HUI A;  3SFD B;  1VLB A;  2BS2 B;  1J7C A;  1E10 A;  4FZM A;  1WRI A;  4G76 A;  2DBY A;  4YXD B;  3AN1 A;  4WWM A;  2BS4 B;  1YJI A;  4IDI A;  1IUE A;  1N60 A;  1N5X A;  3LB8 C;  3AEA B;  3CWI A;  3ABV B;  3B9J A;  1L0V B;  3AEE B;  3NRZ A;  1N62 A;  1JAL A;  1FXA A;  2M19 A;  2MJE A;  3NVW A;  4YSY B;  4YT0 B;  1WWT A;  3NS1 A;  1QT9 A;  4JX1 C;  4KX6 B;  4ZHO A;  2WU2 B;  2PVG C;  3NVY A;  2W3R A;  2QJL A;  1NI3 A;  4C7Y A;  4LTU A;  2KAJ A;  1QOB A;  3WCQ A;  4C80 A;  3FC4 A;  3AE7 B;  1PFD A;  2N0S B;  2WDQ B;  3P4Q B;  1E6E B;  4FZL A;  2H89 B;  2XTR A;  1FFU A;  2HTM E;  2OHF A;  2MJD A;  3P4R B;  1XLP A;  2WQY B;  1ZUD 2;  3KWL A;  3DWG C;  1F0Z A;  1I7H A;  1XLN A;  1SF0 A;  1FRD A;  1XLO A;  2M56 B;  3AEF B;  1TKE A;  2WP9 B;  1VJK A;  1L6U A;  3DA4 A;  2K5P A;  2WS3 B;  4YSZ B;  2WDV B;  4JWU C;  4YTN B;  3VR9 B;  3VR8 B;  4HRS A;  3PO0 A;  1E7P B;  3AE1 B;  2W54 A;  3SFE B;  2ACZ B;  1FXI A;  2BS3 B;  2CJO A;  3AE6 B;  3DWM A;  1OQQ A;  3W5U B;  3W5V B;  2MJ3 A;  4C7Z A;  2B76 B;  3AEG B;  1NEN B;  4YTM B;  1KFY B;  1N61 A;  1ZP0 B;  4FZN A;  2PIA A;  1JWA D;  2QIE B;  1WGK A;  2BT6 A;  2LEK A;  3AB5 A;  2CJN A;  2L52 A;  3AH7 A;  4FXC A;  5H92 C;  2W55 A; 
#chains in the Genus database with same CATH topology
 3POU A;  1PQS A;  3RFZ B;  2JZZ A;  1OQR A;  4K81 A;  1NYR A;  3RBH A;  4P6V F;  3DWN A;  4M0W A;  4MJS B;  3AAE A;  3DVG X;  4PS7 A;  2Y2X A;  1T5X D;  4OZA A;  2NBU A;  4JQW C;  3HIZ A;  2XTQ A;  1P0R A;  1TKY A;  5IKC M;  4IL6 O;  3DBL I;  1ENF A;  5D3D A;  3U30 A;  3U7Z A;  4IWQ A;  1YX5 B;  2C5L C;  1YN3 A;  2PVO D;  2XNA C;  2KX3 A;  3FAH A;  1R4M I;  2N2M A;  3ZXV A;  4FLH A;  3QCA A;  5C23 A;  2KN5 A;  1L6V A;  5EE1 A;  1L7Y A;  1SBB B;  1JWU D;  4IM2 A;  3AMZ A;  5DL6 A;  4BOZ B;  4HRO A;  1TS5 A;  3MHS D;  2IO3 B;  4WAF A;  1DGJ A;  4IUM B;  2DWQ A;  5BYS A;  2PMV A;  3UU2 A;  4XZ4 A;  1HZ5 A;  3QC8 B;  1WJ6 A;  1UEL A;  1GUA B;  4YT0 B;  3DCG A;  3DPD A;  1V2Y A;  1KLV A;  2OED A;  3P42 A;  1PFD A;  4FSP A;  2D07 B;  1MG8 A;  3DBH B;  4E3C A;  3P4R B;  4CTD A;  1E54 A;  1ZXH A;  1L0Y B;  4RJX A;  3PQS A;  3SZD A;  1GJZ A;  4URK A;  1VJK A;  2R4N A;  3QK0 A;  4EE2 A;  4AQ7 A;  2AQ2 B;  4RF0 A;  4F8C B;  4YTN B;  4ACF A;  3UF8 A;  3ZTC A;  2WXN A;  3U7D A;  4C7Z A;  3OLM D;  3QWZ B;  2JQY A;  3AEG B;  3RCZ A;  2VZK D;  4FZN A;  3APF A;  4IWO A;  4LDT B;  2LEK A;  3PHX B;  1EF1 A;  4A9A A;  4G75 A;  2KXP A;  1J8C A;  4JWS C;  2WXH A;  5IOI A;  1QZE A;  2VZK B;  3VTW A;  4LNO A;  4ANU A;  3AE8 B;  1CK1 A;  3QJZ A;  4USA A;  1QLB B;  3DOW A;  4ZRK A;  1HXU A;  2Y5C A;  3EFU A;  3Q69 A;  1C3T A;  1XXG A;  1IGC A;  2DZK A;  1TZO A;  2KMC A;  2GMI C;  5BMG A;  3UAQ A;  3X0W A;  1S5L O;  2ASQ A;  3CMM B;  1FM0 D;  4FMS A;  1WX9 A;  2L32 A;  3P2B A;  2XN9 C;  3N1Z C;  2M0X A;  2NCN A;  5AUK A;  5E6J A;  5I4D A;  4O4X A;  5E6O A;  2QMT A;  3V6C B;  3WAL A;  1GNU A;  1N63 A;  3HOL A;  1ROE A;  4A6Q A;  4A20 A;  2IO0 B;  3E56 A;  2DAF A;  4GU2 A;  2MBE A;  3LK3 B;  2RPQ A;  1S3S G;  1F1H A;  5CTR C;  3TMP B;  4RCO A;  4K7W A;  2EEL A;  1C79 A;  3V62 A;  3APD A;  2ZNV B;  2WXK A;  2RD0 A;  2M8S A;  3K19 A;  2QJL A;  3A9K B;  1WYW B;  4HDO A;  2WDQ B;  2R4O A;  2H89 B;  3Q3N C;  2INN E;  1H4R A;  3AA7 B;  2LGS A;  3O0E A;  3X23 A;  3POQ A;  3QRC A;  3DA4 A;  4O1N A;  5L95 C;  2MBH A;  4HEA 1;  1V1P B;  2KOX A;  4CHK A;  8PRN A;  3PO0 A;  1WZ0 A;  2JMM A;  2UU7 A;  3HW9 A;  4AZL A;  4S0R A;  2KWC A;  4IM0 A;  3LDZ E;  4C4V A;  5JH5 C;  1WXA A;  2G3Q B;  3VE1 A;  2IND C;  2JYT A;  2JVC A;  3VRB B;  1FEH A;  2PE6 B;  1LQB A;  2NVU I;  2KC1 A;  4W9K A;  2LXC A;  2KDB A;  3ONS A;  3L4P A;  3ZJV A;  4ZOH C;  2MH7 A;  5G2N A;  2KN4 A;  4WJP A;  2KX0 A;  3HWB A;  4WIP A;  2WDT B;  2IJ0 A;  1WXQ A;  2GBK A;  4W9H A;  3UQA A;  4RGN A;  3KWV A;  4W9D A;  2KVZ A;  2LXA A;  2V4L A;  4TMA B;  1WF9 A;  2N1W A;  2XMX A;  2YLM A;  2K22 A;  3NVZ A;  1HTQ A;  2RGF A;  1H8C A;  5G26 A;  2EKE C;  4B0M A;  1JQ4 A;  5GXG B;  1D5Z C;  3TSS A;  2POR A;  3RNG C;  3HM6 X;  3TEY A;  5EE2 A;  2M06 A;  3AEB B;  2V3P A;  5G5H A;  2JX5 A;  2N7E A;  3JW0 X;  3ZLZ A;  1TYG B;  2KDI A;  1ET6 A;  3AA0 B;  1OGW A;  3APC A;  5LXI B;  4KZ0 A;  1IUE A;  4MM3 A;  4BFR A;  1E8X A;  3ABV B;  3AEE B;  1WWT A;  3VUX A;  1LFD A;  3QAQ A;  2KXJ A;  1M4V A;  1D5X C;  2X8X X;  5AFU K;  1QJP A;  3AAA B;  3P4Q B;  1WX7 A;  3ZTD A;  1BT0 A;  5DPS A;  5EDS A;  4GMV A;  4FES A;  4NQL B;  3SD5 A;  3KVD D;  2LUE A;  1MHX A;  3ALB A;  4GCP A;  5T8I A;  1T0Y A;  4ICV A;  3IXS A;  1WY8 A;  2CHX A;  2K3U A;  5FVN A;  1NEN B;  4YTM B;  2FE8 A;  3GP6 A;  2PIA A;  2K1F A;  2JUO A;  2WXR A;  1ORM A;  3A2S X;  2XBB C;  3FYX A;  1ZXI A;  3AED B;  2JWZ A;  2Y7S A;  2LAS A;  2L83 A;  5GTH O;  3PRE A;  3JCU O;  2VH1 A;  4HCP B;  3LK4 2;  3C19 A;  1YN4 A;  3DBH I;  4D5U A;  1B1Z A;  4W9E A;  1IBX A;  4FT6 A;  2FGR A;  3PLU A;  3EHV A;  3NOB A;  1J0G A;  2G4S A;  2ZW1 A;  1C4A A;  3A9J B;  2WJR A;  3B08 A;  3URY A;  3MTN B;  3B2F A;  4FAD A;  5HHD G;  1TIF A;  5EE3 A;  3P1M A;  3PQU A;  3QIJ A;  1F2R I;  1MPE A;  1YQ4 B;  4JLC A;  1NYQ A;  4LNF A;  3BZD B;  1T16 A;  2JU6 X;  1MHH E;  1TS4 A;  3CIR B;  2JSV X;  3A33 B;  3WI5 A;  2KDE B;  4US8 A;  1WGY A;  3ZNH B;  4FJY A;  2Y5P A;  2VH2 A;  3WIM A;  1WH3 A;  1OEY A;  4A55 A;  1WGR A;  4NAW B;  3NVW A;  2KMA A;  2R2O A;  1ISN A;  2KFK B;  2FCS A;  4LTU A;  4C80 A;  1QOB A;  1SE3 A;  2DLB A;  4EOY A;  3AE7 B;  1QKZ A;  2N0S B;  2YEP B;  2M17 A;  1GB1 A;  5IYU A;  2LGY A;  3DVN V;  4WWO A;  4YL8 A;  2ZVO A;  2LZ6 A;  3H1U A;  4RM8 A;  4ARC A;  3KWL A;  2QCZ A;  2JYE A;  3MP9 A;  1THQ A;  4N74 A;  1TKE A;  2I1K A;  3BVG A;  4C69 X;  3BRZ A;  4E1T A;  4HKZ E;  4I6P A;  2DHZ A;  2VRR B;  3I5J C;  3BS0 A;  4S17 A;  5IN7 A;  4O3X B;  1ET9 A;  3PPA A;  5KAF O;  2FBW B;  5DPR A;  3VTU A;  2JPH A;  4XWT A;  5AUI A;  4WJO A;  4PT5 A;  2ZNV C;  1XQQ A;  3BY4 B;  2PKO A;  4Z3T A;  4MSM B;  3AXC A;  2WVP A;  2Y0L A;  2UWQ A;  2O2V A;  1M94 A;  1JWS D;  2J4U P;  3R66 C;  2RMM A;  1SIJ A;  1TY2 A;  7PRN A;  4ITK A;  4JE3 B;  4GIV A;  2L0F A;  3EC8 A;  2KJR A;  2O6V A;  3AM9 A;  4IC7 B;  3SR6 A;  3Q3O C;  1OFF A;  5AZF A;  1L4Z B;  4I6L B;  2CU1 A;  4FRX A;  4OVV A;  1TZ1 A;  3N32 A;  3Q2A C;  3JSV B;  4JL9 A;  3UPG A;  2ZW0 A;  1NI2 A;  2DEN B;  2GB1 A;  3H7P B;  3PLV A;  2Z0E B;  2NMQ A;  4FZM A;  2W80 C;  2WX0 A;  2K4T A;  4GXB A;  4BKS D;  4FHK A;  2OJR A;  4G50 A;  4B61 A;  2X38 A;  2L0T A;  3CWI A;  3M3J A;  4P7I A;  3TEX A;  4ZRP A;  5BMH A;  3N1X C;  1T0Q C;  3WAM A;  1YOV B;  2DNF A;  5KHQ A;  1OQY A;  3GE8 C;  3FC4 A;  3SYS A;  2EMT A;  3VZU X;  4FJV B;  4RLC A;  2N9P C;  3MC9 A;  2LVQ A;  1SF0 A;  1GC7 A;  2SAK A;  1XEE A;  3A4S C;  2WDV B;  3DDC B;  2MP2 A;  4GSW A;  4I6N B;  1QIL A;  1H6S 1;  3OJ4 B;  5BYQ A;  1TS2 A;  5AZG A;  1GG3 A;  1V1O A;  3MJW A;  4MJS A;  4MAC A;  3BWU D;  3AA1 B;  4YWG G;  2GE4 A;  2INP E;  3ZNG C;  4KIK A;  1HXY D;  1AYF A;  2J52 A;  2OOB B;  3ENE A;  3PV1 A;  4N59 A;  1SXT A;  2BQQ A;  3ZYY X;  3HRD D;  4PYZ A;  2WDR B;  4MGK E;  1IZN A;  1LXD A;  4RNA A;  2W3S A;  2EKI A;  1BT9 A;  1DYQ A;  1GAQ B;  2KQS A;  2MEK A;  1GFP A;  3V8U A;  2LUM A;  2SEB D;  2IPK D;  3Q3M C;  3VAW A;  1DOI A;  4F4B A;  4KR4 A;  2N7D A;  3CSF A;  3HVZ A;  4LCD E;  2J0M A;  3ZKJ C;  3T3O A;  4AS1 A;  2R88 A;  4HJG E;  4RF1 A;  4M00 A;  1E0Z A;  4RGO S;  1JML A;  1WM3 A;  1V9J A;  2Y0H A;  5TIS O;  4W9I A;  4BUM X;  3QQ8 B;  3EGR A;  1EWY C;  1Q9F A;  1WIA A;  4WWP A;  4F1S A;  3KYD D;  3SFD B;  5BMI A;  3AN1 A;  1N5X A;  2D5G A;  3NRZ A;  4YSY B;  2MW5 A;  2KZ7 B;  2E6X A;  2DX5 B;  3DZM A;  1C4P A;  1U4A A;  3JYU A;  3Q3F A;  3BK2 A;  4L1B A;  2MA9 B;  3KUC B;  3ZGZ A;  2M4N A;  4O3Z A;  3ZNI D;  3L13 A;  2I2Y A;  2V9H A;  2BYE A;  2MNH A;  5J2R A;  3A1Q B;  4AYI D;  2PRN A;  2K25 A;  3VR8 B;  1E7P B;  3SFE B;  2XE1 A;  3W5U B;  3W5V B;  4H2A A;  1KFY B;  2JRH A;  2BB5 A;  1BUI C;  2D11 A;  4XYC A;  1FRR A;  2CU3 A;  4O49 A;  5JDP A;  5AEK B;  2KNB A;  3AE3 B;  3AA6 B;  2A5U A;  2LHF A;  2QTK A;  2MRP A;  4ZHP A;  1K52 A;  2R2Q A;  3GE3 C;  1ZW7 A;  4BKG A;  1JRP A;  5DPW A;  1VZ6 A;  3AU5 A;  3JTY A;  3ZQ4 A;  2AEH A;  2KJH B;  5EE9 A;  2IY0 B;  3B2G A;  4BAX A;  1GFQ A;  3BVZ A;  3C8Y A;  1TY0 A;  1HEZ E;  1IGD A;  2Z0D B;  1JW9 D;  1TJE A;  2ZCB A;  1DOX A;  2L3Z A;  1ZHW A;  4N58 A;  1KF6 B;  5LLI A;  4NPN A;  1EF5 A;  3PRN A;  4K1R B;  2LGX A;  4MDK E;  4RM9 A;  3VDZ A;  3BK1 A;  3Q8C A;  3BYY B;  5IA7 A;  3KLS X;  1TBE A;  4TQ0 A;  2LHD A;  1WYG A;  3PGR A;  1YNT E;  3LK3 A;  1YX6 B;  1GB4 A;  2Y0K A;  3O65 B;  1V81 A;  3U2S C;  3AI5 A;  2K8B A;  3A0B O;  2W9N A;  1WFY A;  2R4L A;  4G76 A;  2DBY A;  2KFJ A;  2KWU B;  5GV0 A;  1EU4 A;  4RMA A;  3PVL A;  4J3O D;  3A9K A;  3I57 A;  1C4C A;  3MFG A;  1QT9 A;  1UGM A;  2XG6 A;  1QQR A;  4C7Y A;  1UH6 A;  3NZ3 A;  1P7F A;  3KUZ A;  3AA7 A;  2I38 A;  4GDK B;  5TR5 A;  1HQR D;  4DHJ D;  3C5O A;  1V1P A;  3DWG C;  5PRN A;  1YMH E;  2FUG 1;  2KJ6 A;  4NZL B;  5DPT A;  5FKA C;  2LVP A;  2RPV A;  5TSS A;  2D3C A;  2LD9 A;  4WH4 A;  3NZS A;  2BYT A;  1FNV A;  2MHL A;  4LSH A;  5ADX K;  4FUV A;  4J6I A;  1XCQ L;  4AWJ A;  4A8X C;  5FR3 A;  1FXI A;  3PRZ A;  3PSE B;  1D4B A;  4RL9 A;  4DHJ B;  1OEY J;  1UBQ A;  3R2I A;  1UNS A;  2MCN B;  2KWV B;  1QOF A;  1N6Z A;  4IW0 A;  3QRA A;  1Z5S B;  2PLP A;  3E9S A;  4XDD A;  1JWM D;  4AJY B;  3BVM A;  3Q8B A;  1FPY A;  2Y5B B;  1AN8 A;  3UIO B;  3VUY A;  3RZW C;  2W82 A;  2QC8 A;  4ZRJ A;  1N5W A;  3ZUN A;  1UD7 A;  3TL5 A;  3KVF B;  3DHG C;  3HK0 A;  3R7R A;  4LSF A;  1WR6 E;  4OHJ A;  1WR1 A;  3Q8F A;  4NJ7 A;  2KLC A;  2Q5W D;  4R3D A;  5B5E O;  4K3C A;  2ZJD A;  3KZI O;  2X27 X;  4OVZ A;  4A3O A;  3AA0 A;  1JRU A;  1Q10 A;  3BYT B;  3DHH C;  2DAJ A;  1XO3 A;  2FUH B;  2AYO B;  2BS2 B;  1WRI A;  3PS6 A;  3SEB A;  1ZE3 D;  4DK5 A;  3A4R A;  1Y8R C;  4N9F 4;  4CQN A;  3L10 B;  1I4R A;  1HTO A;  3RMK C;  4W9G A;  4EUT A;  1Q5W B;  1PHO A;  4XC2 A;  5KAI O;  3RI7 C;  2MJE A;  2L7R A;  2GBR A;  1C77 A;  3AAA A;  4DHZ E;  3SY9 A;  4K7U A;  2BWF A;  3DBR B;  4DDG D;  5HKH A;  2CHZ A;  3PT2 B;  1GFM A;  4MGI E;  4Q2J A;  2XEW A;  4OZB A;  4C4V B;  2HD5 B;  2C7M B;  1IYF A;  2GRI A;  1TT5 B;  2KAC A;  4DXF A;  2KKC A;  4AOF A;  2A4Z A;  1I4X A;  2JXX A;  3O13 A;  2GBM A;  2CJO A;  3DWM A;  4A90 A;  1C9F A;  4DWF A;  1SJE D;  2NTT A;  4C00 A;  2B3A A;  4FXC A;  1KOT A;  4XNK A;  1DOY A;  3H9D A;  4YTP B;  3QHT A;  2XK5 B;  4HK2 A;  4KSL C;  2JT4 B;  1JRO A;  3NZU A;  3U4E G;  4GHB A;  1ZOY B;  4ZRI A;  3PZ7 A;  4DQO C;  4N6E B;  3A9J A;  2M1M A;  3V61 A;  4F7Z A;  1K8R B;  1I4G A;  2KC2 A;  4M02 A;  3FKY A;  2G9H D;  4KSK C;  2FGQ X;  3LK2 A;  2KK8 A;  2QIL A;  2G1E A;  3VHT C;  2D3A A;  4ZRQ A;  3Q8E A;  2LJI A;  2PTL A;  3N9Y C;  1WE6 A;  4JGH B;  4K7S A;  4UB8 O;  1EM7 A;  1KH0 A;  1L5P A;  2N9K A;  2BGF A;  5LXH A;  1VR9 A;  2UYZ B;  1BH3 A;  4II2 B;  5DL8 A;  5KHO A;  4D64 A;  2FID A;  3BIN A;  2IGD A;  3EMN X;  4LNK A;  1QOG A;  3IAM 1;  5D3I B;  3WAO A;  2K0L A;  1V86 A;  3B1L X;  1SGH A;  2AWT A;  2M07 A;  3NS8 A;  2BW2 A;  3FIL B;  2KFK A;  1J19 A;  3IVF A;  4JX1 C;  4KX6 B;  2WXF A;  3EA6 A;  2OMF A;  1Z2M A;  2IGG A;  3UQB A;  3SYB A;  4TQ1 A;  2BF8 B;  4AKR B;  4RH6 A;  3GOE A;  1F2R C;  1P4T A;  4FQE A;  2N1V A;  2G4D B;  4PS3 A;  1MI0 A;  1UF0 A;  2IO1 B;  4W9F A;  2R8A A;  1G6J A;  2BVC A;  3TEZ A;  5DL7 A;  4RFB A;  3IBE A;  1STE A;  5G3A A;  1N61 A;  4G11 A;  3AB5 A;  1SJH D;  3SY7 A;  2K0P A;  5H92 C;  5IO9 A;  1F77 A;  1WRD B;  1BML C;  1I4P A;  1YN5 A;  3L0W B;  4MH0 E;  5JHB A;  1C78 A;  3ZW3 A;  4ANX A;  2HJ8 A;  4G3X B;  2KQ4 X;  3AE2 B;  2E3T A;  4AJW A;  4KGR A;  3K9P B;  3V60 A;  2Z8L A;  2KVR A;  1ZDV A;  2JWU A;  4WQO B;  2KTF A;  1GFO A;  3MC8 A;  4ANW A;  2F1V A;  1XLQ A;  1WSP A;  5GTI O;  4GOC A;  2RDG A;  3QA8 A;  1VCB A;  3W9C B;  1RYJ A;  2BBC A;  3UIN B;  5EE0 A;  2Z59 B;  4FHJ A;  2ZPY A;  3JSV A;  1TGZ B;  2XE3 A;  1P1A A;  2PJH A;  3H7P A;  4KKI A;  1WXM A;  1PUT A;  5G38 A;  1VZ7 A;  2NTS A;  4ICU A;  2IYD B;  4AUQ C;  2WXG A;  3VTV A;  1TKG A;  1HA5 A;  2QSD A;  1PRN A;  3HUI A;  2LI5 A;  2K9X A;  1VLB A;  1J7C A;  4NQK E;  2W81 C;  1EWC A;  2WXL A;  1GOZ A;  3D32 A;  1RFA A;  1YIW A;  1I35 A;  4B95 A;  4MEM A;  2LVO A;  3B9J A;  2J53 A;  4M8M A;  4MGY E;  5HG2 A;  3N3K B;  3VZT X;  1WMH B;  4ZYS A;  3IT4 B;  3NVY A;  3I63 C;  4TV3 A;  2BTE A;  4IWP A;  4TKN A;  3Q8A A;  4HDQ A;  2D3G A;  3GZN B;  4P1B C;  3GS2 A;  1FD6 A;  1FFU A;  2HTM E;  4OW0 A;  4DXG A;  1WI0 A;  2FIF A;  2WP9 B;  3DQV A;  3M62 B;  2WXJ A;  2WX1 A;  4JWU C;  1MM4 A;  2INC C;  5FR6 A;  3L08 A;  5J18 A;  1IP9 A;  1OSM A;  4L23 A;  3AA1 A;  2ZCC A;  4LJP B;  4M8N A;  1F0Z A;  1HXX A;  3DVG Y;  2YEP F;  5HFY A;  4REZ A;  3U52 E;  2KTR B;  3ZJT A;  4GDL B;  3VY9 X;  1UGJ A;  3WA0 A;  2LGD A;  4HXD A;  1LO5 D;  2IZV B;  3DBR I;  4IKG A;  2WXQ A;  2KAN A;  3POR A;  3L54 A;  4AKM A;  2FAZ A;  3SU8 X;  2ON8 A;  3T0S A;  2HJ1 A;  3RUI B;  3AU4 A;  2ZVN A;  1FFV A;  1V97 A;  3RNF C;  2K6Q A;  3ZXR A;  1BXW A;  1QF6 A;  1YS5 A;  2NPT B;  4KDI C;  4WJQ A;  2AL3 A;  2JZ3 B;  3PRM B;  1Y56 A;  2KHW B;  1KLG D;  3PGE A;  4M01 A;  1T6B X;  1TS3 A;  5CX3 A;  3IHP C;  3RNA C;  4HPP A;  1NEK B;  1PGA A;  2WJQ A;  2J0K A;  3N30 A;  1QOA A;  3L17 A;  1E10 A;  1ACC A;  4YXD B;  2ZPN A;  2KZ7 A;  5BYR A;  2HE7 A;  2KD0 A;  4KGT A;  1QJ8 A;  1X1M A;  3ZDM C;  2IBI B;  1L0V B;  1KM7 A;  5IAA C;  1E8Z A;  3PRP B;  3VH4 B;  2LWP A;  2WU2 B;  4P16 A;  3VE2 A;  3H7S A;  4PUX A;  2MWS B;  2NR2 A;  3WCQ A;  2MP2 B;  3NSG A;  3A1Q A;  1FNU A;  2WQY B;  4OZC A;  2MQJ A;  5D7G A;  2KWD A;  4MT5 A;  1OTR B;  2MHJ A;  4IOI E;  2M56 B;  3ZJU A;  3HHM A;  1VRA B;  4HKQ A;  4YSZ B;  4KIK B;  1F52 A;  2ACZ B;  2N9E B;  1OQQ A;  3V05 A;  3ZRF A;  1SE2 A;  1R4N B;  2B76 B;  4C56 C;  3BII D;  4FOZ A;  2KQ7 A;  3AA6 A;  1AW7 A;  3AH7 A;  4KV2 A;  1IZN B;  2M0A A;  3TCA A;  3ZO5 B;  2RR9 A;  3VQI A;  1WXS A;  2LFI A;  4YSX B;  4MSQ B;  3W1S A;  2NS5 A;  1D5M C;  2ODJ A;  3NUH B;  1KRH A;  1GC6 A;  3MC0 B;  5H8Y E;  3W1Y A;  4KVG B;  4HLE A;  3N1Y C;  5MPO A;  3AE9 B;  5E79 O;  4M0W B;  2JXT A;  3AAE B;  2J0J A;  1WE7 A;  2H88 B;  4GGQ A;  3H6N A;  3P4S B;  3PHW B;  1C76 A;  1VD2 A;  3LXF A;  3BRY A;  5J17 A;  1D6E C;  1HZ6 A;  4US9 A;  3QAR A;  4AYD C;  3Q6B A;  1T0R C;  2FNJ B;  2QEJ C;  1E9M A;  4GLS C;  5H2F O;  4AYE C;  5DCN A;  2JQR B;  2KLG A;  4ZDV A;  4AYN A;  5D94 A;  1HXT A;  3AE5 B;  1YJJ A;  2GBJ A;  1ZKH A;  4GF4 A;  3MHZ A;  4D2K A;  3T24 A;  4CO7 A;  4LSE A;  1FMA D;  2DYB A;  4LDT D;  4AFK A;  4QQ1 A;  5E6N A;  2WYQ A;  4BOS C;  4DHZ B;  4HCN B;  4BKT A;  3ML8 A;  4JFB A;  4UB6 O;  5T5F A;  5HI1 A;  2L1A A;  3LB8 C;  2RDB C;  3WAN A;  3HOE A;  1UBI A;  1LGR A;  4PS8 A;  4UDU C;  1XCT L;  2K39 A;  4XDC A;  4GDK A;  3NHE B;  1G90 A;  1NI3 A;  2KAJ A;  5L83 A;  1AAR A;  2LMC A;  2N2L A;  2WXP A;  4U9C A;  3TJP A;  4EZL A;  4MGZ E;  1RLF A;  1XLN A;  1XLO A;  4RGM A;  3TBL D;  1L6U A;  5G55 A;  1UUP A;  3VUW A;  3NJT A;  1WX8 A;  2IGH A;  4LJO B;  4N75 A;  2KDF B;  1ZHT A;  2BS3 B;  2DZI A;  1Q0W B;  4W9L A;  4KRA A;  1JWA D;  1WGK A;  2BT6 A;  2BYV E;  4JPS A;  2CJN A;  3V3X A;  1VZ8 A;  3LJ3 A;  3PGS A;  1XT9 B;  1UWM A;  1F9J A;  2LRU A;  2RSU A;  5IP4 D;  1YQB A;  4FUL A;  2MX2 A;  3PZD A;  1J7A A;  4NNJ B;  3P63 A;  2G45 B;  3AV8 A;  1T3Q A;  3TIX A;  2KC0 A;  2QDF A;  2KXP B;  4EZK A;  1WJN A;  3GZN I;  4II3 B;  3JVZ X;  1WZ3 A;  4HPM B;  2KMM A;  1RFK A;  4LK0 M;  3DA3 A;  6PRN A;  1YD8 U;  1NVI D;  4XGA B;  3CST A;  4WQM A;  3UIP B;  1JCK B;  4BBN F;  1V6E A;  1ZHZ A;  3Q14 C;  1RWS A;  1PDX A;  2GLS A;  4CYE A;  1FCL A;  4JIO U;  1CJE A;  1R7S A;  3TUO A;  3IG3 A;  4PR7 A;  3UI3 A;  3J9C A;  1XF5 L;  1Q9G A;  2JF5 A;  5G5G A;  4FN2 A;  1AWD A;  1B9R A;  1L2N A;  4BZA A;  2AXT O;  1BXT A;  4FSO A;  1XD3 B;  5C3J B;  3HM3 A;  2J4X A;  4L2Y A;  5JHA A;  4RLB A;  1FNW A;  3N20 C;  4WWM A;  3OJ3 A;  2ERV A;  1YJI A;  1MG4 A;  5JZE B;  1KTK A;  2WXO A;  3V6E B;  2MBB B;  4DDI D;  1V49 A;  3EEC A;  1E5W A;  1SE9 A;  2W3R A;  1IPG A;  5JXV A;  2D10 A;  3RYT A;  1EUV B;  5CHF A;  4FZL A;  2XTR A;  4FRT A;  1XLP A;  3WU2 O;  1I7H A;  2RDH A;  2CR5 A;  4ANV A;  2PW9 A;  2V0G A;  3RUL A;  3R2T A;  2LFU A;  5GMV A;  2FCM A;  2IY1 B;  2V4I B;  3RD2 A;  1ZDX A;  4TSS A;  2K8H A;  3AE6 B;  4MEL A;  3DHI C;  1ZPS A;  2BKR B;  2KZR A;  2XK5 A;  2QIE B;  1MPF A;  2L52 A;  4EKU A;  4D65 A;  1ZHY A;  4KGS A;  1FIQ A;  4B0E A;  4K3B A;  3G7G A;  2BPS A;  3VVW B;  5DL5 A;  1I4Q A;  1WGH A;  4ARI A;  2V3S A;  2K8C A;  2PE9 A;  2JY6 A;  2PPH A;  1QJ9 A;  2BB6 A;  2V1Y A;  3KW5 B;  2AX5 A;  2MBO A;  3VY8 X;  2BKF A;  2L76 A;  3P4P B;  3I3T B;  1E8W A;  5FK9 C;  1S1Q B;  3POX A;  3T9L A;  4FA6 A;  4AYM C;  4JCH A;  3SHQ A;  1GPX A;  2DZJ A;  1I42 A;  1RAX A;  1ZGU B;  5BO4 B;  3EUB 2;  3AEC B;  1VDV A;  1R4N I;  3M95 A;  3S2A A;  4B6W A;  1RM6 C;  1KJT A;  2KDM A;  4FJZ A;  1RRB A;  4XX5 A;  5C2T B;  3KUD B;  2WU5 B;  4GCS A;  3DBS A;  3TEW A;  2DYO A;  3TZG A;  1LM8 B;  2L05 A;  2PEA A;  3ZDT A;  2REX A;  2WGS A;  4LNI A;  2BYF A;  4KKJ A;  3FIL A;  2O4V A;  3H8H A;  4O3W A;  4FBJ B;  3RNE C;  1UZX B;  1WGD A;  4IG7 B;  1FXT B;  1SSN A;  3GB1 A;  4KZC A;  3AEA B;  1K53 A;  2X9K A;  2AQ1 B;  2LRW A;  2M19 A;  1CQV A;  2D3B A;  4MM3 B;  3R7Q A;  3HVD A;  4TUU A;  4AKR A;  1PGX A;  2ZEQ A;  1I4H A;  2R4P A;  1T1L A;  3C0R B;  1E6E B;  2ZLD A;  1V80 A;  3WAP A;  1GFN A;  4RJW A;  3DBL B;  4NAW A;  4BBN C;  1A5R A;  2XE2 A;  2NBV B;  2D2Q A;  4B9K A;  2XE5 A;  4WJN A;  3ZIM A;  1C1Y B;  5AZH A;  2TSS A;  3ML9 A;  4LNN A;  4WWN A;  1V5O A;  2W54 A;  2GOW A;  3RZF A;  4DXA B;  1R4M B;  1EU3 A;  3ZNZ B;  3PZ8 A;  1CMX B;  3CF6 E;  2WLB A;  3W1S C;  5C1Z A;  2C60 A;  3IT6 B;  3LK2 B;  4HVB A;  2JZP A;  1PYW D;  2ZZP B;  2LHE A;  1FO4 A;  1P3Q U;  4RGT A;  1JWB D;  4O3Y A;  1K51 A;  3ETR A;  3RPF C;  3R3M A;  1V8C A;  4GCQ A;  3AE4 B;  2DYM A;  1UWX A;  3NVV A;  4E1S A;  3L16 A;  1A70 A;  4HPL B;  1FCC C;  3T8M A;  2N4F A;  1IBX B;  4X57 B;  3ZVV A;  1WJ4 A;  4ZYN A;  4XNL A;  2F1C X;  5ADX L;  4OVU A;  2IO2 B;  2Y3A A;  2ICI A;  2MBQ A;  2CHW A;  4W9J A;  1PGB A;  2FCN A;  2L8J A;  4LLG M;  3VRA B;  1CZP A;  3U8Z A;  3VXW A;  4MH8 A;  1L4D B;  1K50 A;  3LYY A;  4WAA A;  2GBN A;  3T3N A;  2YNK A;  1TTN A;  2WNM A;  2N9L A;  2JRI B;  3ZRC A;  3KQ4 A;  2WHI A;  4KR8 A;  2IWV A;  3RN9 C;  3DWO X;  4XE0 A;  4QAY A;  2DZM A;  3KYC D;  3PGU A;  3W2D A;  1WMH A;  4IDI A;  3MJ5 A;  2I1J A;  3OWE B;  4ASW C;  2HDE A;  4NJC A;  1FXA A;  1WJU A;  4G0N B;  2YVC A;  2GI9 A;  3NS1 A;  4ZHO A;  2KO3 A;  2OJW A;  5E6P A;  2C7H A;  5LNK 1;  1V5T A;  3PF1 A;  4NAM A;  5B66 O;  4EEW A;  4DBG A;  2KYW A;  2MJD A;  3A0H O;  1ZUD 2;  1P7E A;  4BVU C;  2L00 B;  2WXM A;  1KLU D;  1HE8 A;  2YPV A;  2K5P A;  1OPF A;  4E74 A;  2IWW A;  2V3N A;  3LK4 1;  4GB9 A;  3QX1 A;  2AQ3 B;  4BKS A;  2MJ3 A;  4AP4 C;  1MFW A;  1ZP0 B;  5D2M B;  3IFW B;  3I9V 1;  5G39 A;  2AL6 A;  2KTR A;  4GDL A;  1MVK A;  3VH3 B;  1E7V A;  3UGB B;  3SZV A;  3VFK A;  2CKH B;  1P98 A;  1ESF A;  3IAS 1;  3NY5 A;  3SDL C;  4IM3 A;  2C9W B;  3EFC A;  2MSE D;  4GN1 A;  1J7B A;  5D6J B;  2C7N B;  4HWI B;  2R89 A;  1MM5 A;  4O4U A;  2NPT A;  2F1T A;  1MJD A;  4P1C C;  1YJ1 A;  2QHO A;  2O6V D;  1NDD A;  4E71 A;  2LJ5 A;  1Q1O A;  3AUL A;  4XWW A;  2HTH A;  3Q3J A;  3GP7 A;  1T0S C;  2O2V B;  1SB3 C;  3RNB C;  2CS4 A;  5CHV C;  5AFU L;  2K6D B;  4W9C A;  1YQ3 B;  2O6V B;  2KT7 A;  2ONQ A;  2WWZ A;  2N7J A;  1NBF C;  2FCQ A;  1E7U A;  2R61 A;  4PYU A;  1E8Y A;  1WXV A;  1P9D U;  2IDY A;  3K9O B;  5CHW A;  2BS4 B;  1SE4 A;  2MLB A;  1N60 A;  5D5D A;  4NJ6 A;  2N9X A;  1SEB D;  1WM2 A;  4LSI A;  1N62 A;  1JAL A;  2KDY A;  3RT3 B;  4EFO A;  4PJ0 O;  2PVG C;  4A3P A;  1L0X B;  3OG5 A;  2BWE S;  2J1N A;  1E90 A;  1D3Z A;  2J7Q B;  3DVN U;  1WGG A;  2OHF A;  3ECI A;  2NBW B;  2WXI A;  1FRD A;  3OAW A;  4KDL B;  3R8B A;  3AEF B;  3NG0 A;  4EZJ A;  3T20 A;  2WS3 B;  2ZFG A;  4NY0 A;  2EMS A;  3VR9 B;  1EO6 A;  4HRS A;  3AE1 B;  3KH0 A;  4AUI A;  4HJK A;  2J42 A;  1ZHX A;  3M63 B;  3RNC C;  4PK1 A;  3VZW X;  3WI4 A;  3B0A A;  2LGI A;  3PTF C;  4WUR A;  1SIF A;  2W55 A; 
#chains in the Genus database with same CATH homology
 3POU A;  3RFZ B;  4XNK A;  1UWM A;  1DOY A;  1OQR A;  1NYR A;  3RBH A;  4YTP B;  4O3X B;  4P6V F;  1ET9 A;  1J7A A;  3P63 A;  4M0W A;  3AAE A;  1JRO A;  3AV8 A;  1T3Q A;  2Y2X A;  3U4E G;  1T5X D;  4GHB A;  1ZOY B;  4OZA A;  2KC0 A;  3PZ7 A;  2FBW B;  2KXP B;  2XTQ A;  4DQO C;  1TKY A;  4N6E B;  4A6Q A;  1I4G A;  4XWT A;  5AUI A;  2G9H D;  4PT5 A;  2KMM A;  2FGQ X;  1RFK A;  3LK2 A;  2QIL A;  4LK0 M;  3DA3 A;  6PRN A;  2G1E A;  1NVI D;  4Z3T A;  2PKO A;  1ENF A;  4ZRQ A;  5D3D A;  2Y0L A;  3Q8E A;  4WQM A;  3U7Z A;  1JCK B;  2LJI A;  2PTL A;  1YN3 A;  3N9Y C;  1JWS D;  1ZHZ A;  2PVO D;  2J4U P;  1RWS A;  1EM7 A;  1PDX A;  1SIJ A;  1TY2 A;  2RMM A;  2XNA C;  1FCL A;  1CJE A;  1KH0 A;  7PRN A;  1R7S A;  1L5P A;  3FAH A;  2N9K A;  4ITK A;  4JE3 B;  3TUO A;  3UI3 A;  3J9C A;  2N2M A;  3AM9 A;  3SR6 A;  1XF5 L;  1Q9G A;  1VR9 A;  5G5G A;  1BH3 A;  1OFF A;  5DL8 A;  1L4Z B;  1AWD A;  1L6V A;  5EE1 A;  1B9R A;  1SBB B;  4D64 A;  4FRX A;  1JWU D;  3AMZ A;  5DL6 A;  3UPG A;  2ZW0 A;  4HRO A;  1TS5 A;  2IGD A;  1BXT A;  3EMN X;  2GB1 A;  4FSO A;  1QOG A;  4WAF A;  3IAM 1;  1DGJ A;  5D3I B;  5C3J B;  2J4X A;  2DWQ A;  4L2Y A;  5BYS A;  2K0L A;  4RLB A;  2NMQ A;  4FZM A;  1FNW A;  2PMV A;  2W80 C;  3UU2 A;  2K4T A;  4WWM A;  2ERV A;  1YJI A;  2M07 A;  4B61 A;  1HZ5 A;  2X38 A;  2BW2 A;  3CWI A;  3FIL B;  3TEX A;  4ZRP A;  5BMH A;  1KTK A;  4YT0 B;  2WXO A;  4JX1 C;  4KX6 B;  2WXF A;  2W3R A;  2OED A;  3P42 A;  3EA6 A;  2OMF A;  2IGG A;  3FC4 A;  3SYS A;  3SYB A;  4TQ1 A;  1PFD A;  4FSP A;  5JXV A;  3VZU X;  4FZL A;  2XTR A;  3P4R B;  4FRT A;  1E54 A;  4RLC A;  1XLP A;  1ZXH A;  4AKR B;  1L0Y B;  1I7H A;  4RH6 A;  2RDH A;  1SF0 A;  4RJX A;  3PQS A;  1F2R C;  3SZD A;  2PW9 A;  1P4T A;  2V0G A;  2SAK A;  1VJK A;  1XEE A;  3R2T A;  2LFU A;  4EE2 A;  4AQ7 A;  2AQ2 B;  4RF0 A;  2WDV B;  4YTN B;  1MI0 A;  2V4I B;  3TEZ A;  1ZDX A;  5DL7 A;  4RFB A;  4TSS A;  3AE6 B;  1QIL A;  1H6S 1;  1ZPS A;  2WXN A;  4C7Z A;  3AEG B;  1STE A;  5BYQ A;  2VZK D;  1N61 A;  2QIE B;  4FZN A;  1TS2 A;  3AB5 A;  2LEK A;  1MPF A;  2L52 A;  1SJH D;  3SY7 A;  1V1O A;  2K0P A;  5H92 C;  4D65 A;  1ZHY A;  4KGS A;  1FIQ A;  1F77 A;  4B0E A;  4MAC A;  3BWU D;  3AA1 B;  1BML C;  1I4P A;  1YN5 A;  2GE4 A;  4YWG G;  4A9A A;  4G75 A;  1C78 A;  2INP E;  3G7G A;  2KXP A;  1HXY D;  5DL5 A;  1AYF A;  1I4Q A;  2J52 A;  4ARI A;  2KQ4 X;  3AE2 B;  2E3T A;  2WXH A;  4JWS C;  4KGR A;  4N59 A;  2Z8L A;  1SXT A;  1QJ9 A;  1ZDV A;  2BB6 A;  2JWU A;  3ZYY X;  3HRD D;  2VZK B;  2WDR B;  1IZN A;  4RNA A;  2W3S A;  2EKI A;  1BT9 A;  1DYQ A;  1CK1 A;  3AE8 B;  2AX5 A;  1GAQ B;  4USA A;  1QLB B;  1GFO A;  2MEK A;  1HXU A;  2Y5C A;  1GFP A;  3VY8 X;  3V8U A;  3P4P B;  3Q69 A;  1XXG A;  2F1V A;  1IGC A;  2LUM A;  5FK9 C;  1XLQ A;  3POX A;  1TZO A;  1WSP A;  5BMG A;  4AYM C;  4JCH A;  3UAQ A;  2SEB D;  2RDG A;  2IPK D;  1GPX A;  3EUB 2;  3W9C B;  3AEC B;  1VDV A;  1FM0 D;  1RYJ A;  1DOI A;  4F4B A;  4KR4 A;  2BBC A;  3T3O A;  3HVZ A;  5EE0 A;  4FMS A;  1RM6 C;  2KDM A;  4AS1 A;  2L32 A;  2XN9 C;  5C2T B;  4HJG E;  4RF1 A;  2WU5 B;  4GCS A;  1E0Z A;  2XE3 A;  5AUK A;  4RGO S;  1JML A;  5E6J A;  2Y0H A;  4KKI A;  1PUT A;  3TEW A;  1VZ7 A;  2NTS A;  4BUM X;  2DYO A;  3TZG A;  5I4D A;  4O4X A;  2WXG A;  3EGR A;  2QMT A;  1EWY C;  1Q9F A;  1TKG A;  1HA5 A;  2QSD A;  1PRN A;  1N63 A;  3HOL A;  2O4V A;  1ROE A;  2K9X A;  3FIL A;  4O3W A;  3H8H A;  3HUI A;  1VLB A;  3E56 A;  1J7C A;  3SFD B;  5BMI A;  2W81 C;  1EWC A;  2WXL A;  1GOZ A;  3AN1 A;  3LK3 B;  1SSN A;  3GB1 A;  1N5X A;  2D5G A;  3AEA B;  1K53 A;  4RCO A;  2AQ1 B;  3B9J A;  3NRZ A;  2EEL A;  2J53 A;  4YSY B;  2M19 A;  1C79 A;  5HG2 A;  2KZ7 B;  3VZT X;  2E6X A;  1CQV A;  2WXK A;  4ZYS A;  4MM3 B;  3HVD A;  3IT4 B;  3NVY A;  3K19 A;  1C4P A;  2QJL A;  4AKR A;  2BTE A;  1PGX A;  3BK2 A;  3Q8A A;  4L1B A;  1I4H A;  2WDQ B;  3ZGZ A;  1E6E B;  2H89 B;  3GS2 A;  1FFU A;  2HTM E;  1FD6 A;  4O3Z A;  2ZLD A;  4OW0 A;  2INN E;  4DXG A;  1GFN A;  4RJW A;  2I2Y A;  3AA7 B;  2XE2 A;  3O0E A;  3POQ A;  2MNH A;  2XE5 A;  3QRC A;  2WP9 B;  3DA4 A;  4AYI D;  4O1N A;  2WXJ A;  4JWU C;  4HEA 1;  1MM4 A;  1V1P B;  2PRN A;  8PRN A;  2TSS A;  3VR8 B;  3PO0 A;  1E7P B;  2W54 A;  2XE1 A;  3SFE B;  1OSM A;  4L23 A;  2JMM A;  3W5U B;  3AA1 A;  3W5V B;  3HW9 A;  4H2A A;  4AZL A;  1KFY B;  2BB5 A;  1BUI C;  1EU3 A;  1F0Z A;  3PZ8 A;  3VE1 A;  1HXX A;  2JYT A;  1FRR A;  3VRB B;  2CU3 A;  2WLB A;  4O49 A;  2YEP F;  5JDP A;  3IT6 B;  1FEH A;  3AE3 B;  3LK2 B;  5HFY A;  4REZ A;  3U52 E;  2JZP A;  3AA6 B;  2LHF A;  2QTK A;  1PYW D;  2LHE A;  4ZHP A;  1FO4 A;  4GDL B;  3ZJT A;  3VY9 X;  1K52 A;  1UGJ A;  3L4P A;  4RGT A;  3ZJV A;  4ZOH C;  1JWB D;  1LO5 D;  2MH7 A;  2KN4 A;  4IKG A;  2WXQ A;  4O3Y A;  1K51 A;  3ETR A;  3RPF C;  3POR A;  3HWB A;  4AKM A;  1V8C A;  4GCQ A;  3AE4 B;  1JRP A;  4WIP A;  2DYM A;  1UWX A;  1VZ6 A;  3NVV A;  2ON8 A;  3T0S A;  4E1S A;  2IJ0 A;  1A70 A;  1FCC C;  3JTY A;  3ZQ4 A;  1FFV A;  1WXQ A;  5EE9 A;  1V97 A;  1IBX B;  3B2G A;  1BXW A;  4RGN A;  1QF6 A;  1YS5 A;  1GFQ A;  3KWV A;  3BVZ A;  1TY0 A;  4XNL A;  5ADX L;  1HEZ E;  1IGD A;  1JW9 D;  1TJE A;  3C8Y A;  1DOX A;  4TMA B;  2Y3A A;  2ICI A;  1ZHW A;  4N58 A;  1PGB A;  2XMX A;  2K22 A;  3NVZ A;  4LLG M;  3VRA B;  1Y56 A;  1CZP A;  1KF6 B;  1KLG D;  4MH8 A;  3PRN A;  1L4D B;  1K50 A;  3LYY A;  5G26 A;  1T6B X;  4B0M A;  1TS3 A;  3BK1 A;  2YNK A;  3BYY B;  2WNM A;  3Q8C A;  5GXG B;  3T3N A;  1JQ4 A;  3KLS X;  2N9L A;  1D5Z C;  3TSS A;  2POR A;  1NEK B;  3TEY A;  4TQ0 A;  5EE2 A;  2LHD A;  2M06 A;  1PGA A;  1WYG A;  1YNT E;  3AEB B;  3LK3 A;  2V3P A;  3KQ4 A;  2Y0K A;  2JX5 A;  5G5H A;  1GB4 A;  3U2S C;  1QOA A;  1TYG B;  4KR8 A;  1E10 A;  1ACC A;  4XE0 A;  4G76 A;  1ET6 A;  2DBY A;  3AA0 B;  4YXD B;  2KZ7 A;  5BYR A;  3W2D A;  5GV0 A;  4IDI A;  4KGT A;  1QJ8 A;  1IUE A;  1EU4 A;  3MJ5 A;  3OWE B;  3ABV B;  2HDE A;  4J3O D;  1L0V B;  3AEE B;  4NJC A;  1FXA A;  3I57 A;  1WWT A;  1C4C A;  3MFG A;  2GI9 A;  3NS1 A;  1QT9 A;  4ZHO A;  2XG6 A;  2WU2 B;  4P16 A;  3VE2 A;  5LNK 1;  4PUX A;  1QQR A;  3NZ3 A;  4C7Y A;  1P7F A;  4NAM A;  3WCQ A;  1M4V A;  1D5X C;  3AA7 A;  5AFU K;  1QJP A;  2I38 A;  4GDK B;  3AAA B;  3NSG A;  3P4Q B;  2MJD A;  1FNU A;  2WQY B;  4OZC A;  1HQR D;  1P7E A;  3C5O A;  1V1P A;  1ZUD 2;  2KWD A;  5D7G A;  3DWG C;  5PRN A;  1YMH E;  2FUG 1;  2WXM A;  4MT5 A;  4FES A;  4NZL B;  1KLU D;  5FKA C;  4IOI E;  2M56 B;  3KVD D;  3ZJU A;  2YPV A;  2K5P A;  1VRA B;  2RPV A;  1OPF A;  5TSS A;  4YSZ B;  4HKQ A;  1MHX A;  4WH4 A;  2BYT A;  4GCP A;  1FNV A;  2V3N A;  2MHL A;  3LK4 1;  4LSH A;  4FUV A;  5ADX K;  1XCQ L;  5T8I A;  4A8X C;  5FR3 A;  2ACZ B;  1FXI A;  2AQ3 B;  1OQQ A;  3IXS A;  3V05 A;  2MJ3 A;  1SE2 A;  2K3U A;  4C56 C;  5FVN A;  2B76 B;  1D4B A;  1NEN B;  4YTM B;  1ZP0 B;  2FE8 A;  4RL9 A;  3GP6 A;  4FOZ A;  2PIA A;  3BII D;  3I9V 1;  3AA6 A;  1AW7 A;  2WXR A;  1ORM A;  3AH7 A;  3A2S X;  1IZN B;  1MVK A;  2M0A A;  3R2I A;  1UNS A;  3FYX A;  3VQI A;  1ZXI A;  3AED B;  1QOF A;  4KKJ A;  2Y7S A;  3SZV A;  3QRA A;  2L83 A;  2LFI A;  2PLP A;  4YSX B;  3W1S A;  1ESF A;  3LK4 2;  1D5M C;  3E9S A;  3IAS 1;  2ODJ A;  1JWM D;  1KRH A;  3NUH B;  4XDD A;  3MC0 B;  3BVM A;  1YN4 A;  5H8Y E;  1J7B A;  3Q8B A;  5MPO A;  4D5U A;  3AE9 B;  1B1Z A;  2JXT A;  3AAE B;  1IBX A;  4FT6 A;  2FGR A;  1AN8 A;  1MM5 A;  4O4U A;  2H88 B;  2F1T A;  2W82 A;  3P4S B;  1N5W A;  2ZW1 A;  1C4A A;  1C76 A;  3LXF A;  1D6E C;  1HZ6 A;  4US9 A;  3URY A;  4AYD C;  2QEJ C;  1E9M A;  4GLS C;  4LSF A;  3B2F A;  4AYE C;  4OHJ A;  4XWW A;  5HHD G;  2JQR B;  3Q8F A;  5EE3 A;  4AYN A;  3GP7 A;  3P1M A;  3PQU A;  1HXT A;  1SB3 C;  1F2R I;  1MPE A;  1YQ4 B;  3AE5 B;  1YJJ A;  1NYQ A;  2Q5W D;  4R3D A;  5AFU L;  4GF4 A;  3BZD B;  2JU6 X;  3MHZ A;  1MHH E;  4D2K A;  1TS4 A;  3CIR B;  2X27 X;  1YQ3 B;  3T24 A;  2JSV X;  3WI5 A;  3AA0 A;  4OVZ A;  4LSE A;  1Q10 A;  1FMA D;  2ONQ A;  3BYT B;  4US8 A;  4AFK A;  2N7J A;  4QQ1 A;  1XO3 A;  2Y5P A;  2BS2 B;  1WRI A;  2R61 A;  3SEB A;  1ZE3 D;  4JFB A;  2IDY A;  4CQN A;  5T5F A;  2BS4 B;  5HI1 A;  1SE4 A;  1I4R A;  1N60 A;  2L1A A;  3LB8 C;  5D5D A;  3HOE A;  4A55 A;  1SEB D;  4LSI A;  4NAW B;  1XCT L;  1PHO A;  1JAL A;  1N62 A;  3NVW A;  2KDY A;  2MJE A;  4UDU C;  4XDC A;  1C77 A;  3AAA A;  3SY9 A;  2PVG C;  1G90 A;  1NI3 A;  4LTU A;  2KAJ A;  1QOB A;  1SE3 A;  4C80 A;  2DLB A;  1L0X B;  3AE7 B;  2J1N A;  1QKZ A;  2N0S B;  2LMC A;  2YEP B;  2N2L A;  2WXP A;  1GB1 A;  5IYU A;  2OHF A;  4U9C A;  1GFM A;  4Q2J A;  4ARC A;  4OZB A;  3KWL A;  2JYE A;  3MP9 A;  1XLN A;  2WXI A;  1FRD A;  1XLO A;  1THQ A;  4RGM A;  3AEF B;  3R8B A;  1TKE A;  1L6U A;  2GRI A;  3T20 A;  3BVG A;  4C69 X;  2WS3 B;  1UUP A;  2ZFG A;  4E1T A;  2KAC A;  4DXF A;  4HKZ E;  2IGH A;  3VR9 B;  4HRS A;  1I4X A;  1ZHT A;  3AE1 B;  3O13 A;  4AUI A;  2BS3 B;  2CJO A;  3DWM A;  4A90 A;  2J42 A;  1ZHX A;  1C9F A;  1SJE D;  2NTT A;  4KRA A;  1JWA D;  3VZW X;  3WI4 A;  1WGK A;  2BT6 A;  4JPS A;  2CJN A;  2LGI A;  3V3X A;  4FXC A;  4WUR A;  1VZ8 A;  2W55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...