4N59A

The crystal structure of pectocin m2 at 2.3 angstroms
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
270
structure length
262
Chain Sequence
ATYKVKDVTTGAEIEVPDDKYILDEFEKQGVNLPYSCRAGACSSCVALISSGEVDQSDGSFLSEKQEKKYILTCCSYPKSDCTIETGYEDKILEDFEIELAETGLEFFNDLKDSLPRSGEILSGVTAPFEAFDHYLFGNGVERSININDVGFNINVSQIPPIMSLLNGKNVGRFDIGSDFVRNTALDGYSVAAYLGNITMRTEGVLNVKSDGTWQYEGVIRSYNDTYDANPSTHRGALGEWSGTPYEIRIPGELKIKENGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectocin M2
publication title Structure of the atypical bacteriocin pectocin M2 implies a novel mechanism of protein uptake.
pubmed doi rcsb
source organism Pectobacterium carotovorum subsp. brasiliensis
molecule tags Hydrolase
total genus 78
structure length 262
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF14859 Colicin_M Colicin M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.140 Mainly Beta Beta Barrel Porin Porin 4n59A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4n59A01
1XLNA 1DGJA 3W9CB 2WDVB 1FIQA 2K22A 1E10A 2E3TA 1VLBA 2BS3B 1V97A 1FRRA 1RM6C 2WU5B 4US9A 5C2TB 1XLOA 1NEKB 1L5PA 1T3QA 2OHFA 3AMZA 1OFFA 4WWMA 1XLPA 3NRZA 1E9MA 4ZHPA 3DWMA 2KAJA 4A9AA 2G1EA 1JRPA 1AYFA 3P1MA 1QLBB 3SFEB 2JX5A 5EE3A 3FC4A 1NI3A 1NYRA 3LXFA 3AV8A 1E0ZA 1NVID 5G5GA 4YSYB 3HRDD 3AE9B 1DOXA 1YQ3B 4ITKA 1TJEA 1XO3A 1R7SA 1ZUD2 3W5VB 4G75A 3B2GA 3RPFC 2XTRA 1N62A 1PDXA 1TYGB 3NVVA 3ABVB 1WGKA 3HVZA 2N0SB 2QIEB 1FXIA 1WRIA 1N60A 2K9XA 3B9JA 3AM9A 1WYGA 3SFDB 1J7AA 4P6VF 3WCQA 4YXDB 1DOYA 4G76A 3AE4B 1B9RA 3AEFB 1VDVA 1DOIA 1RFKA 5EE1A 1A70A 1OQRA 2WP9B 4FZLA 2B76B 4C7YA 1FXAA 3AEEB 1I7HA 2CJOA 1PUTA 3AEBB 3AECB 3AE2B 1SB3C 4C80A 3ETRA 3AE1B 2W54A 4YSXB 4N59A 3P4SB 3AE8B 1SIJA 2XMXA 4HRSA 1ROEA 1QOAA 4N6EB 2WS3B 3B2FA 4FXCA 2L83A 1NENB 4KX6B 1FMAD 1CJEA 1TKYA 3AEAB 1AWDA 1JALA 1EWYC 3CIRB 1TKEA 2QJLA 3HUIA 4WQMA 5G5HA 3W5UB 5EE9A 3P4RB 2PKOA 2ACZB 1QOGA 1KF6B 4YTPB 3VR8B 1N61A 3SR6A 1JW9D 3PO0A 4ZHOA 1YJIA 1FFUA 4IDIA 2M56B 3AE6B 3AEGB 1QF6A 4FZMA 1RWSA 1KFYB 1N63A 4C7ZA 4N58A 3AE5B 3LB8C 1GPXA 3VR9B 4USAA 1ZP0B 1CZPA 1E6EB 3CWIA 3P4QB 2Y5CA 5EE0A 2WLBA 1OQQA 2DWQA 1QOFA 2KMMA 2LEKA 1J7BA 3NVZA 1UWMA 1PFDA 3AH7A 3L4PA 1JQ4A 1YJJA 3P63A 2W3RA 4JWUC 2W3SA 2MH7A 5C3JB 1WXQA 3AE7B 2CJNA 2BT6A 1YQ4B 2DBYA 2H88B 4YT0B 1FRDA 4FZNA 2MJEA 1F0ZA 1IUEA 1JWAD 4US8A 1XLQA 2K5PA 3ZYYX 1TKGA 3NS1A 2H89B 3NVYA 1QOBA 1RYJA 2MJ3A 3AB5A 2M19A 2WDRB 3FAHA 3BIID 1ZOYB 1JWBD 2AX5A 5MPOA 3VRAB 1GAQB 4LTUA 4YTMB 4YSZB 1QT9A 2BS4B 2WU2B 3DA3A 2XTQA 4HROA 5AUIA 3AE3B 2JQRB 1SF0A 4YTNB 5AUKA 4JWSC 3DA4A 1FM0D 1L6VA 1KRHA 2PVGC 3P4PB 1V8CA 3AEDB 1NYQA 2WQYB 2W55A 3DWGC 1N5WA 2L52A 3NVWA 1WWTA 4JX1C 2FBWB 3KWLA 2MJDA 3AN1A 1JROA 2HTME 4ZOHC 5GXGB 1FO4A 1J7CA 1N5XA 3EUB2 2PVOD 5H8YE 5H92C 1ZXIA 1FFVA 2BS2B 2PIAA 2WDQB 1VJKA 3VRBB 2EKIA 2CU3A 1L0VB 1L6UA 2Q5WD 1E7PB
chains in the Genus database with same CATH superfamily
4WJOA 1WJNA 4FADA 1AN8A 3FILA 1H8CA 1P1AA 5PRNA 3DWMA 4J6IA 3BK2A 5AEKB 4FUVA 4OHJA 1I35A 1KTKA 4GCPA 1ZUD2 5E6JA 5G38A 1ZHZA 1JRUA 4KVGB 1C4CA 3TJPA 2YPVA 4EFOA 2XE2A 2QIEB 5HI1A 3WCQA 3B1LX 4DQOC 3IVFA 2JQYA 4W9DA 3VTVA 1OQRA 2B76B 3ML8A 2R4LA 3AE2B 4LJOB 1IGDA 2HDEA 4PUXA 4GDLA 3DVGY 1NENB 1AWDA 4NJCA 2LWPA 1UZXB 2UYZB 2Y0HA 1GFOA 3KH0A 3VZWX 4ZHOA 4AKRB 2KJ6A 2GBKA 2ZFGA 4AKMA 4FHKA 3NSGA 2KLGA 4Z3TA 1ZP0B 4IM2A 1V81A 5BYSA 1GFMA 2LEKA 5BMHA 1ZHTA 1WR1A 3RCZA 3N30A 3GZNB 1RLFA 4A6QA 2MEKA 2DBYA 5JXVA 2X9KA 3NS1A 2PPHA 2QTKA 3EMNX 3QAQA 2KC0A 3EA6A 4MSMB 4DHZE 2RDBC 4AQ7A 3PGUA 2LHEA 3HOLA 1DYQA 4RJWA 5JDPA 1BT0A 2MBBB 3AN1A 2LRUA 3I5JC 2BTEA 2DAFA 2WDQB 4MEMA 3ZXVA 1L0VB 3RNGC 5J17A 1FD6A 1Q9FA 5GMVA 1ZE3D 1C76A 1JWUD 3DQVA 2WXNA 3Q8AA 4GIVA 4US9A 4DXAB 1TZOA 4RGMA 4ZHPA 2MP2B 3KUDB 3WAOA 2LFIA 2G1EA 2NS5A 2GRIA 5FKAC 4BBNF 3TBLD 4ZRQA 2CKHB 3TIXA 3A1QA 3CSTA 2WXGA 2BWES 3PPAA 1D6EC 5DPWA 3HVZA 2K6QA 2KTFA 3AM9A 2WXJA 3RNCC 1MM5A 4II3B 4RJXA 1P4TA 1VDVA 3U8ZA 4GDKA 1JCKB 1I7HA 3R2TA 5BYRA 2G4DB 2INNE 5D3IB 3WAMA 4NY0A 2Y3AA 2V3NA 1WJUA 4KX6B 1ZW7A 2I38A 3AEAB 4WQMA 1HZ5A 2Y5PA 3Q3JA 4IDIA 3Q8BA 2YVCA 2V0GA 1KFYB 3AE5B 4NAMA 3V3XA 3VR9B 4RF1A 1QQRA 1JWSD 2KMMA 1QOFA 1SJHD 2N9EB 2YEPB 3A0BO 3MC0B 1MG4A 1FRDA 3DVGX 3A9JA 1WGHA 1D4BA 1S1QB 4XWTA 1S5LO 2ZVOA 2L32A 2FGRA 1L4ZB 2L0TA 4KR4A 4AKRA 4WIPA 3IT6B 3L54A 1RAXA 4PK1A 1JWBD 1V9JA 3Q3FA 3PQSA 3DA3A 1GC6A 4HROA 2NTTA 2MCNB 4O4UA 1C9FA 1F1HA 3EUB2 4E1SA 1B1ZA 5AFUK 1KM7A 1ZXIA 3W1YA 4CYEA 1EUVB 4O1NA 3IAS1 1LXDA 3H6NA 4EUTA 1SE4A 2KDFB 2ICIA 3GE8C 4P1CC 5CTRC 1XLOA 4RNAA 3AMZA 3A9KA 4AUQC 4EZLA 4ZRPA 4C00A 2JX5A 1THQA 2WGSA 1WE6A 3QA8A 4Q2JA 5G5GA 1NBFC 4RL9A 4I6PA 3RNFC 1WZ3A 2PEAA 3SFDB 3AA7B 4IWPA 3PT2B 2WP9B 2KANA 2N1WA 4EZJA 2MP2A 2XNAC 2V4LA 4GN1A 1SIJA 2L83A 4CO7A 2BB6A 3ZVVA 2CHZA 2VH2A 3SU8X 3OJ4B 3A2SX 3DBHB 1FFUA 3T3OA 1RWSA 3KUCB 4QAYA 5AFUL 4LNFA 1HTOA 1R4MB 4HKQA 4USAA 1Q1OA 1CZPA 4M01A 1JMLA 1WXVA 1GC7A 3HW9A 2ZZPB 1JQ4A 3NS8A 2LGDA 1LFDA 2MBQA 1WXQA 3V05A 3NOBA 4YT0B 4FZNA 4KGRA 2GB1A 4KV2A 2KC2A 2RSUA 3ZNHB 2MHJA 2NMQA 3KZIO 1K50A 2H89B 1FEHA 5IP4D 4WJPA 2REXA 2RMMA 3UIOB 2XTQA 1L6VA 1OQYA 4GMVA 2WVPA 5JHBA 3WA0A 3UIPB 4H2AA 2EKEC 1GB4A 4FOZA 4BZAA 4HJKA 4JIOU 1J7CA 1ZDVA 2PMVA 2IBIB 4U9CA 2Z59B 3BRZA 3KW5B 4ZRJA 3RULA 1A5RA 1WYWB 3APFA 1YX5B 3C19A 1YS5A 1ZXHA 3TCAA 1ZKHA 2JRIB 2N7EA 2XE5A 1JRPA 1HE8A 1NDDA 4HXDA 2PORA 1WIAA 2TSSA 3M62B 4AYMC 3HRDD 1PYWD 7PRNA 2K0PA 4FJZA 2KJRA 4FA6A 4B6WA 3ABVB 4LSFA 5DL5A 2RD0A 4JGHB 2WWZA 5HKHA 2C7MB 4XYCA 2V4IB 3P4SB 4BKSA 4CQNA 5B66O 1PRNA 4W9LA 4RH6A 3PREA 1QJ9A 3DWNA 2MA9B 5EE9A 3ENEA 2L7RA 4GHBA 3SR6A 4TQ1A 3H7SA 5D3DA 3WIMA 3AA7A 4HPMB 2DYOA 5E79O 8PRNA 5EE0A 4HJGE 4NNJB 4FULA 3ZRFA 3C0RB 4FQEA 2W3SA 4DHJD 4GLSC 3IAM1 3AE7B 2RPVA 1IP9A 2PRNA 4TSSA 1UH6A 3MC9A 4O3XB 2OJWA 4D64A 2CU1A 2OEDA 1KH0A 1AARA 4C69X 3W2DA 4RGTA 3Q3MC 2KK8A 3BIID 2AX5A 4LTUA 2L1AA 2KDBA 4K7SA 4RLBA 4W9JA 3E56A 1P9DU 1AW7A 2ZW0A 1HZ6A 4YTNB 3N20C 1MFWA 1WMHB 2D3GA 2KD0A 3DWGC 4O3ZA 4ZOHC 2R89A 4PYUA 3RYTA 2WYQA 2PVOD 1UGMA 3GP6A 1VJKA 5E6NA 1HXUA 5IA7A 1T0QC 4GCSA 1V5OA 5G2NA 3DZMA 1G6JA 3FILB 1VLBA 1RM6C 2ERVA 2LMCA 2LI5A 3P42A 1WXMA 3GS2A 3FKYA 2MLBA 3Q69A 1QJ8A 4AP4C 2AYOB 3OAWA 2KX0A 2IWVA 2KMCA 3QJZA 2JZ3B 2PJHA 3T20A 1L4DB 4RLCA 5D7GA 2GMIC 2BYEA 4OZBA 4M8MA 3VQIA 4CHKA 3UQBA 4LNOA 2DENB 3I63C 4KRAA 2FAZA 3URYA 1IYFA 4P6VF 3X0WA 3AE4B 2WXIA 1DOIA 2WX0A 2NCNA 4PYZA 3POQA 4NJ6A 4LSIA 4FZLA 4FRTA 1SIFA 3AULA 2DYMA 1WXAA 4N59A 1IBXA 4GDLB 4W9GA 4D5UA 4NJ7A 4AJWA 2DHZA 1XT9B 2L3ZA 4L23A 2KQ4X 4DBGA 1KF6B 2PE6B 1NI2A 1YJIA 2IJ0A 4D65A 4QQ1A 4RFBA 4RGOS 2QC8A 1WY8A 3ECIA 2HJ1A 5G26A 1I4GA 1E7VA 3H9DA 1V1OA 3H1UA 3L17A 3T8MA 4MJSB 1IUEA 3O0EA 2ON8A 4O4XA 3JCUO 2M0XA 1WM3A 3LJ3A 4W9KA 1E54A 3DWOX 3AB5A 3UU2A 2N9XA 1TS4A 5EDSA 1LO5D 2BBCA 1MJDA 5AUIA 4IW0A 3D32A 1WE7A 4IWOA 1Z2MA 3NVWA 4IWQA 1FO4A 1ET6A 3PTFC 4TMAB 2LRWA 4OVZA 3UI3A 1J19A 2EKIA 1ZHWA 5KHOA 1ET9A 1XLNA 4ASWC 4YWGG 3ZQ4A 2WXRA 1FIQA 3K9OB 6PRNA 2E3TA 5BYQA 2N2MA 5HG2A 5CX3A 4WWNA 3SD5A 2HJ8A 1L5PA 1MM4A 3PHXB 1GG3A 2RGFA 1WMHA 3KWVA 3HOEA 1E8YA 2SEBD 2AL6A 4WAAA 2FIFA 3A1QB 1ACCA 4DXGA 1Q10A 3DBLB 1C78A 3DBRB 1TYGB 2XN9C 1H6S1 2N0SB 1WYGA 4W9FA 1BT9A 5DPSA 3J9CA 2R4NA 4GDKB 4ANVA 4A3OA 2XE1A 4NAWA 2K0LA 1FCCC 1HEZE 1P0RA 2WHIA 4FJVB 3BWUD 3QIJA 3VTWA 1UF0A 3B2FA 3AA0B 1TKYA 2KTRA 4M00A 1EWYC 1GNUA 2LFUA 2Y5BB 2OOBB 2GI9A 2UWQA 4XE0A 4CTDA 3L10B 4FZMA 2OMFA 3TMPB 3A0HO 1UBQA 3U4EG 2FNJB 4DK5A 4EZKA 3L4PA 3T9LA 1WI0A 3Q14C 2J1NA 2KZ7A 4W9CA 1I4XA 4I6LB 1WRDB 4DWFA 4YL8A 1WFYA 3A9JB 2JZPA 3VE2A 1JWAD 2W9NA 3VUWA 3WANA 2BPSA 3PRNA 4HDOA 1F52A 4RCOA 3NVYA 2M19A 3PHWB 2GBRA 2WU2B 1N6ZA 1MPEA 3AE3B 3W5UB 1FM0D 1V8CA 3LDZE 3VUXA 2AXTO 2MBHA 1VZ8A 2KQ7A 3KWLA 2R88A 4JPSA 1TY0A 2MX2A 4EEWA 3HHMA 4XDCA 4WWOA 4BKGA 4MJSA 3IG3A 3VVWB 4N74A 2UU7A 4DHJB 1IGCA 2IYDB 2N7DA 2WDVB 2DZKA 2KZRA 3BINA 4P1BC 3SZDA 5G39A 2BKRB 1FNUA 4B0EA 3QARA 3ZTDA 2OHFA 1E9MA 1D5ZC 3A9KB 2KAJA 5ADXK 4TV3A 1Y56A 1QILA 3ZJVA 4K7UA 5JH5C 3DPDA 1XO3A 2KO3A 2FGQX 2KACA 2KFJA 5FR6A 3CMMB 2IO3B 4URKA 1U4AA 2Z8LA 4C7YA 4C80A 2IDYA 1E8ZA 4FXCA 2J4UP 3HM6X 4OW0A 2N2LA 3N9YC 3P4RB 2ACZB 1D3ZA 1TS5A 2WXOA 3B08A 4S17A 4YTPB 1WZ0A 1CK1A 2WDTB 4AWJA 3AE6B 4KSKC 3UGBB 4C7ZA 2MWSB 2KKCA 1I4RA 2IY0B 1PQSA 1R4NI 3HIZA 2JXTA 4E3CA 1SEBD 1C77A 5FK9C 4GCQA 5C3JB 2KJHB 3AU4A 1WSPA 1BUIC 3AA0A 3NHEB 5ADXL 4ACFA 4B0MA 1C1YB 3R8BA 3L16A 2J42A 3VXWA 2KWVB 4KDLB 3BS0A 1UUPA 5MPOA 3N1XC 3NZUA 4YSZB 2J52A 2BGFA 2LD9A 4A55A 4RF0A 1YNTE 2D2QA 1KRHA 1NYQA 2MW5A 2LUMA 1UGJA 3KVFB 3R3MA 3TEYA 4OZCA 2RR9A 4K7WA 3SYSA 1V80A 2KXJA 3DHGC 3V60A 2BB5A 3BVZA 3T24A 4F8CB 2M1MA 2ZPNA 4F1SA 2O2VA 1MI0A 3V6EB 1XD3B 2PLPA 1GFPA 2ZCCA 3W1SA 3HK0A 4A9AA 3RT3B 1P7FA 3LK42 2D3AA 4MACA 3V6CB 3OG5A 3UINB 3QRCA 2KHWB 1QJPA 3W5VB 3ZW3A 3PVLA 1J7AA 2KFKA 3PRZA 3SZVA 3N1YC 4J3OD 2C7NB 4OVVA 3VFKA 2XEWA 4FN2A 2XMXA 3VH4B 1QOAA 4MT5A 1IPGA 2WXKA 2EMSA 3IFWB 1KOTA 3APDA 1FNWA 2VH1A 2A5UA 2R8AA 2LVPA 1QOGA 3RNEC 4AYNA 5DPRA 3AEGB 5EE2A 3ZNID 3VHTC 3Q3OC 3ZDMC 3QC8B 5FR3A 2Y0LA 1LM8B 2WLBA 2MQJA 3P2BA 3P63A 4JWUC 1V1PA 1PGAA 4BOSC 4DDID 4DXFA 3PGEA 2DNFA 1C79A 4MGYE 4HCNB 4HCPB 1F2RC 1S3SG 2FE8A 4M8NA 3ZYYX 3ZO5B 1GFQA 2MJ3A 3RN9C 3AA6A 3FAHA 5GTHO 4IM0A 1QT9A 2KWUB 5E6OA 4A3PA 4JWSC 1SXTA 3GZNI 1V86A 2C9WB 2WQYB 2ZPYA 1Y8RC 4AFKA 1ZGUB 2R61A 4LK0M 1I4HA 1T0RC 2JYEA 3KYCD 2DX5B 1HTQA 2MNHA 1TBEA 2CU3A 2Z0DB 1EU3A 4K3CA 1F0ZA 2XTRA 5TSSA 4OZAA 3W9CB 1XCTL 3DVNU 4A90A 5C2TB 2GBMA 3PRPB 4HDQA 3U2SC 3N3KB 2YNKA 3PLVA 1ZHXA 4WQOB 4HKZE 4REZA 5IYUA 1EWCA 1NI3A 1NYRA 3LXFA 3QWZB 5CHFA 3AV8A 2KLCA 3HVDA 3I3TB 2JVCA 5AZFA 1EF5A 1TJEA 1WJ4A 5TR5A 1STEA 4GB9A 1FXTB 2LVOA 3SY7A 1WRIA 1V49A 2L0FA 1GOZA 2J4XA 2R2QA 3VTUA 2XK5A 1RFKA 3BYTB 1WH3A 1L0YB 3EFUA 2GBNA 1EF1A 1F9JA 2W54A 2CS4A 2WXHA 3GB1A 1IBXB 2F1CX 1IZNA 1JALA 2QJLA 1F2RI 3AAEB 5L83A 2Y2XA 5DL7A 2W81C 2SAKA 1M94A 2JWUA 2G9HD 3IT4B 4N58A 3RBHA 2M0AA 4KGSA 3AAAA 2N9PC 3M63B 3I9V1 3NY5A 1FCLA 1E5WA 2I1KA 4LDTD 4KZCA 2L05A 1YN4A 5D2MB 2KVRA 3DDCB 2KOXA 1TY2A 3Q8FA 4G11A 3T0SA 2K1FA 4ZRIA 3HWBA 3ALBA 3POUA 1K52A 3GE3C 1UD7A 4P16A 4PJ0O 4AYEC 2BQQA 1T16A 4KR8A 2QMTA 5C23A 5AUKA 3ZLZA 4JL9A 3AEDB 4FBJB 3C5OA 1WF9A 2V3PA 5GXGB 1VR9A 2W82A 2L76A 4B95A 4KDIC 2MRPA 4ARIA 3L08A 1LGRA 3U7DA 2LGYA 2QHOA 2Z0EB 3N32A 1HXTA 1NEKB 5IO9A 3ZRCA 1YIWA 5I4DA 3P1MA 2I2YA 1GUAB 1QLBB 2LXAA 2NBWB 2QCZA 2G4SA 5EE3A 3QQ8B 4HPLB 1HXYD 3DHIC 1NVID 2JPHA 5L95C 1UELA 1ISNA 1DOYA 4IKGA 2WJRA 2WXPA 1PUTA 2LZ6A 3AEBB 1ZHYA 4E74A 4EKUA 1TTNA 4DHZB 4NAWB 1WM2A 2JRHA 4HRSA 1TGZB 5JZEB 5T8IA 1HXXA 3R7QA 2KTRB 3O13A 2PKOA 3NG0A 4ANXA 1VZ7A 5CHVC 2M56B 2NTSA 1QF6A 2JYTA 3UQAA 1N63A 1EO6A 3LB8C 3PZDA 3MJ5A 3P4QB 2KNBA 2QSDA 1BXWA 2WXLA 4RM8A 2KDIA 3AA1B 3NVZA 1YQBA 1UWMA 2V9HA 2W80C 1YJJA 3VUYA 4JLCA 2G45B 4MSQB 5D94A 5JHAA 2LHDA 2H88B 2KZ7B 1XF5L 2INCC 1VCBA 5LNK1 2INDC 3DBHI 3AAEA 3EECA 2CR5A 3MJWA 1SGHA 2K5PA 4HLEA 1FPYA 1R4MI 2R4OA 2BYTA 1WR6E 4ZYNA 3K19A 2JXXA 1GAQB 3LK2A 3QX1A 3NZSA 3ZXRA 1E90A 3WI5A 4FHJA 2IGDA 4ICVA 3P4PB 4LNNA 1MPFA 2GLSA 4WJQA 2E6XA 2FUHB 2LXCA 2WXMA 4HWIB 3LK3B 1FFVA 3JW0X 1L6UA 2Q5WD 2LGSA 4IM3A 3ZGZA 5T5FA 2G3QB 4GF4A 1E8XA 2IPKD 2LHFA 3SHQA 4EE2A 4BAXA 2X8XX 4C56C 4XNKA 2JY6A 1WXSA 4K1RB 2IGGA 2ZJDA 1MVKA 1EU4A 3HM3A 3QCAA 2DZIA 3PQUA 3TUOA 1MG8A 4G75A 5AZGA 1TZ1A 4YXDB 4AOFA 4G76A 2GBJA 2WX1A 4KIKA 1T1LA 1FXAA 1WGYA 4AYDC 3AI5A 5KAFO 3DCGA 3OWEB 4L1BA 3BRYA 4A8XC 2WS3B 4II2B 2NPTA 1FMAD 2L00B 4D2KA 2NBVB 2N4FA 3VY9X 1XEEA 3ONSA 3JSVB 1JW9D 2FCNA 4M0WB 3WAPA 4XZ4A 1I42A 1OPFA 1QKZA 2MHLA 2DYBA 3UPGA 3CWIA 2VRRB 1ESFA 2JSVX 2ZEQA 2Y5CA 1PFDA 1G90A 3AH7A 1WX8A 2W3RA 5DCNA 4UB6O 1XQQA 5GV0A 1SE9A 1OTRB 2M8SA 3CSFA 4KKIA 2KWCA 1E8WA 2ZNVB 3MTNB 1OSMA 1T6BX 4AZLA 1UWXA 4N9F4 4ZDVA 3ZNZB 1V6EA 2JZZA 2WXQA 5HFYA 4K81A 3R7RA 2CHXA 2WJQA 4C4VB 3AA1A 3RZFA 1MHHE 5DL6A 1N5WA 3IXSA 2FCMA 2HTME 1WX7A 2AEHA 4LDTB 2C5LC 5H8YE 5LXHA 2KDYA 1RRBA 4R3DA 3RI7C 2YEPF 1E7PB 1GFNA 2KXPA 1DGJA 1P3QU 1V97A 1FRRA 2KC1A 3KVDD 4F4BA 2KN4A 2O2VB 4HVBA 1XLPA 1OEYJ 2WXFA 4W9IA 1TS3A 4UDUC 3GP7A 2NR2A 2K25A 4AYID 3FC4A 1OGWA 3PORA 4ZYSA 4FRXA 4XX5A 3NJTA 4ITKA 2D3BA 3LK3A 3WI4A 2JWZA 3ZNGC 3U7ZA 4IOIE 1YX6B 1FXIA 2KFKB 1WGRA 1A70A 1YMHE 4MGKE 1YJ1A 1T0YA 1SB3C 1YN5A 4NZLB 4N6EB 3WALA 3G7GA 2MBEA 3E9SA 2K8CA 5DPTA 5G5HA 3H7PB 4IC7B 3R2IA 2ONQA 2X38A 5DL8A 3DBSA 3VR8B 4TQ0A 3N1ZC 3BY4B 3OJ3A 2KX3A 4RMAA 2PE9A 2KDEB 4GOCA 2J0KA 1GJZA 5LLIA 3PZ8A 3JTYA 4ICUA 4WJNA 2EMTA 5AZHA 2KN5A 2O6VA 4JFBA 4TKNA 1V1PB 3CF6E 4XWWA 1ZPSA 2N7JA 2NVUI 2K6DB 2KYWA 2PTLA 3JSVA 3U52E 1TKGA 1YD8U 2K8BA 4LJPB 4M0WA 2BYFA 3AA6B 4B9KA 4YTMB 3MP9A 1KJTA 4S0RA 5E6PA 4XC2A 3BVGA 2N1VA 4JQWC 3L13A 1JROA 4AUIA 2ZNVC 4I6NB 2PIAA 4FSPA 3VRBB 2R4PA 3AEFB 2D3CA 3A4RA 3RZWC 4P7IA 2LGXA 2K22A 1E10A 1T0SC 3V61A 4X57B 4PS7A 4WURA 4NPNA 1YOVB 2F1TA 1OFFA 2JT4B 4C4VA 3SDLC 1PGXA 3UAQA 5H2FO 2IY1B 1L7YA 3LK41 4YSYB 1WJ6A 2HD5B 2HE7A 1R7SA 3C8YA 2CHWA 2ODJA 1SE3A 3B9JA 4G0NB 4FT6A 1B9RA 3PSEB 2LJ5A 2XK5B 1K8RB 3W1SC 1HQRD 2CJOA 3PF1A 4YSXB 3PZ7A 1ROEA 3BVMA 3DBLI 2K8HA 4ANWA 2PW9A 3DBRI 1IZNB 3HUIA 3M3JA 1XCQL 3MHZA 2A4ZA 3RUIB 3DVNV 5IOIA 4KZ0A 3BZDB 4KSLC 3AAAB 1E6EB 2INPE 2KWDA 2AL3A 3ZTCA 2M07A 4WAFA 1KLGD 1TT5B 2BWFA 3TZGA 1LQBA 5G3AA 1C4PA 4K3BA 2VZKD 3KLSX 4HEA1 3H7PA 3MFGA 2IO1B 1T5XD 1RYJA 1KLUD 1ZOYB 3PLUA 2ASQA 2DZMA 5LXIB 3VAWA 3ZIMA 3QHTA 5IAAC 2JQRB 1WGGA 3OLMD 3M95A 1UBIA 3UF8A 3DOWA 5C1ZA 2QDFA 1N5XA 2AWTA 2MBOA 3JYUA 5HHDG 1D5MC 3LYYA 4N75A 2YLMA 3IHPC 4GXBA 2LASA 5B5EO 4MGIE 2WU5B 4FSOA 3ZJTA 3PV1A 3ML9A 3QK0A 4ARCA 2D07B 4WWMA 1Q0WB 3NRZA 4G50A 4NQKE 3TEWA 1K53A 4O3WA 4MM3B 3B0AA 1E0ZA 1DOXA 1YQ3B 1BH3A 4IG7B 3SY9A 4IUMB 4LLGM 2D11A 1PDXA 1CMXB 2ZW1A 4FJYA 2FCQA 2K9XA 1C3TA 5TISO 2BW2A 5EE1A 2O6VD 3PGRA 2K3UA 2D5GA 3AECB 4BVUC 1I4QA 3T3NA 4W9EA 3A4SC 2NBUA 3AU5A 1L2NA 1CJEA 4GSWA 1WGDA 4E1TA 2FCSA 4FESA 1SJED 4WH4A 4OVUA 3BK1A 3TSSA 3PGSA 1P98A 1HA5A 2KT7A 1ZDXA 3PS6A 4KGTA 2RPQA 1RFAA 3X23A 3GOEA 4XGAB 2BVCA 2J0MA 2RDHA 2D10A 4BUMX 3SEBA 2RDGA 2N9KA 2BT6A 2IO2B 1D5XC 3EFCA 2MJEA 3VZTX 3O65B 1TS2A 3EC8A 5IN7A 2I1JA 1BXTA 4XNLA 2WDRB 3ZKJC 2FUG1 5KAIO 2OJRA 2KQSA 3LK2B 3VE1A 2BS4B 2XE3A 2DAJA 2JU6X 3JVZX 1SF0A 4ZRKA 3DA4A 3L0WB 4BOZB 2L52A 3EHVA 3A33B 1KLVA 3U30A 2FBWB 3Q8CA 2F1VA 4M02A 1OEYA 1SBBB 5BMGA 3RNAC 3BYYB 3NUHB 3S2AA 4MDKE 2BS3B 2KDMA 4PS3A 2GE4A 1K51A 1T3QA 4RM9A 3K9PB 5BMIA 3SYBA 1AYFA 3TEXA 3AXCA 4GGQA 1PGBA 5J18A 3AE9B 3KYDD 1JWMD 2IGHA 4F7ZA 3B2GA 1XXGA 1N62A 4G3XB 4BBNC 2K4TA 3Q2AC 2LUEA 2IZVB 4FLHA 4LNKA 2J7QB 3APCA 3TL5A 4KIKB 1SSNA 2V3SA 1P7EA 4DDGD 3ETRA 3AE1B 4MM3A 2KMAA 2BKFA 1BMLC 2J53A 3MC8A 2R2OA 3FYXA 1F77A 2NPTB 4L2YA 1TKEA 1I4PA 2J0JA 2AQ1B 3PO0A 2M4NA 2C60A 3I57A 2XG6A 2V1YA 1OQQA 3DHHC 4MH0E 3VH3B 2QEJC 1V2YA 2MH7A 4LCDE 4PS8A 2M17A 4EOYA 5IKCM 2CJNA 3VDZA 4ANUA 2BYVE 4LSHA 1SE2A 2QILA 3RNBC 2EELA 3H8HA 2JUOA 2IWWA 4UB8O 2AQ2B 2FIDA 4JCHA 2XBBC 1X1MA 2GOWA 3EGRA 3VRAB 2X27X 3TEZA 2IO0B 4O49A 1M4VA 2DLBA 4W9HA 2PVGC 3KQ4A 4O3YA 4MH8A 4GU2A 4JX1C 3POXA 2JF5A 3Q8EA 1UNSA 2BS2B 3MHSD 3VY8X 3V62A 3Q3NC 5H92C 4MELA 1QZEA 2VZKB 2KXPB 2BF8B 5FVNA 3VZUX 3NZ3A 4MGZE 1L0XB 3PRMB 2ZVNA 1EM7A 2LGIA 2LVQA 3KUZA 3SFEB 4IL6O 1ENFA 4TUUA 2K39A 5KHQA 1Q9GA 3RPFC 3RMKC 3NVVA 1WGKA 1E7UA 1N60A 2MSED 2N9LA 5J2RA 1WX9A 1ORMA 3Q6BA 3AEEB 1VZ6A 2M06A 2HTHA 1R4NB 2KVZA 3AE8B 2ZLDA 4HPPA 4A20A 3ZDTA 1C4AA 2C7HA 4AJYB 4RGNA 4PT5A 3IBEA 1CQVA 3CIRB 4WWPA 5D6JB 3R66C 1N61A 3ZJUA 1FNVA 1J8CA 2L8JA 3WU2O 3ZUNA 1GPXA 1VD2A 5G55A 4HK2A 4XDDA 3RD2A 2DWQA 1VRAB 1J7BA 3V8UA 4FMSA 5CHWA 4AS1A 2O6VB 4BKTA 1YQ4B 1H4RA 1Z5SB 4E71A 2Y0KA 4KKJA 2Y7SA 3RFZB 4US8A 1XLQA 2DZJA 2WNMA 5GTIO 1QOBA 1GB1A 4BKSD 1MHXA 1PHOA 2JMMA 1TIFA 1J0GA 2O4VA 4JE3B 3QRAA 4PR7A 4LNIA 4LSEA 2ZCBA 2LJIA 5D5DA 2W55A 4BFRA 1YN3A 1WWTA 2AQ3B 2MJDA 4NQLB 4B61A 2B3AA 5BO4B 1V5TA 1Q5WB
chains in the Genus database with same CATH topology
4GCSA 1AN8A 4OZAA 3W9CB 1XCTL 3FILA 2K22A 1E10A 3FILB 1VLBA 4A90A 5C2TB 1RM6C 2ERVA 4WURA 2LMCA 3P42A 3GS2A 5PRNA 2F1TA 1OFFA 3U2SC 2YNKA 3DWMA 3Q69A 1QJ8A 1ZHXA 3BK2A 1PGXA 3UAQA 4HKZE 4REZA 5IYUA 4FUVA 4OHJA 1EWCA 1NI3A 1NYRA 3LXFA 3T20A 1L4DB 4RLCA 3LK41 3AV8A 5D7GA 4YSYB 3HVDA 1KTKA 1TJEA 1R7SA 4GCPA 1ZUD2 5E6JA 4OZBA 3VQIA 1ZHZA 1STEA 3C8YA 2ODJA 1SE3A 1C4CA 2YPVA 2XE2A 3SY7A 4KRAA 1WRIA 2QIEB 3B9JA 5HI1A 3URYA 3WCQA 1GOZA 4P6VF 3R2TA 5BYRA 2J4XA 3AE4B 4FT6A 1B9RA 2WXIA 1DOIA 1RFKA 3BYTB 1OQRA 3POQA 4LSIA 4FZLA 2B76B 4FRTA 1L0YB 1HQRD 2CJOA 3AE2B 2DYMA 2W54A 4YSXB 4N59A 3PZ7A 1IGDA 2WXHA 3GB1A 2HDEA 4PUXA 1IBXA 1ROEA 1IBXB 4GDLB 4D5UA 3BVMA 1NENB 1AWDA 1IZNA 4NJCA 1JALA 2PW9A 4L23A 1IZNB 2KQ4X 1F2RI 3AAEB 2QJLA 3HUIA 2Y2XA 2Y0HA 1KF6B 1XCQL 1GFOA 3VZWX 3MHZA 5DL7A 4ZHOA 2W81C 1YJIA 4AKRB 2IJ0A 2ZFGA 2SAKA 4D65A 4AKMA 4QQ1A 2JWUA 4RFBA 2G9HD 3IT4B 4N58A 3RBHA 2M0AA 3BZDB 4RGOS 3NSGA 3AAAA 4KGSA 4Z3TA 3AAAB 1E6EB 1ZP0B 2INPE 2KWDA 3I9V1 5BYSA 1FCLA 2M07A 4WAFA 1KLGD 1GFMA 2LEKA 5BMHA 1ZHTA 5G26A 1YN4A 3TZGA 1I4GA 1C4PA 4A6QA 2VZKD 2MEKA 2DBYA 1V1OA 3KLSX 4HEA1 1TY2A 5JXVA 3MFGA 3Q8FA 1IUEA 3O0EA 2ON8A 4O4XA 3T0SA 3NS1A 1E54A 3HWBA 1T5XD 1RYJA 2QTKA 3EMNX 3POUA 2KC0A 3UU2A 1K52A 1KLUD 1TS4A 1ZOYB 4P16A 4AYEC 3EA6A 4KR8A 2QMTA 1LO5D 2BBCA 5AUIA 2JQRB 5AUKA 4AQ7A 1QF6A 3AEDB 2LHEA 3C5OA 3HOLA 1DYQA 3NVWA 4RJWA 5JDPA 3AN1A 2V3PA 5GXGB 1ET6A 1FO4A 4TMAB 4OVZA 1N5XA 1VR9A 3UI3A 2W82A 2BTEA 5HHDG 2WDQB 1D5MC 2EKIA 1L0VB 3LYYA 1ZHWA 1ET9A 4ARIA 1Q9FA 1XLNA 1FD6A 1ZE3D 4YWGG 1C76A 3ZQ4A 2WXRA 1FIQA 1JWUD 6PRNA 2WXNA 2E3TA 5BYQA 2WU5B 3Q8AA 2N2MA 4US9A 4FSOA 5HG2A 3ZJTA 1HXTA 1TZOA 1NEKB 4ARCA 1L5PA 4WWMA 4RGMA 3NRZA 4ZHPA 1MM4A 3TEWA 1K53A 2G1EA 2LFIA 2GRIA 5I4DA 3KWVA 3P1MA 2I2YA 5FKAC 1QLBB 3HOEA 4O3WA 2SEBD 4MM3B 5EE3A 4ZRQA 1HXYD 1E0ZA 1NVID 1ACCA 1DOXA 2WXGA 1YQ3B 4DXGA 1Q10A 1BH3A 3SY9A 1C78A 4LLGM 1D6EC 1PDXA 1TYGB 2XN9C 2ZW1A 3HVZA 1H6S1 2N0SB 2K9XA 3AM9A 1WYGA 2WXJA 1DOYA 1MM5A 4IKGA 1BT9A 4RJXA 1P4TA 2BW2A 1VDVA 5EE1A 3J9CA 4GDKB 1JCKB 2K3UA 1I7HA 2XE1A 2D5GA 1PUTA 2WXPA 3AEBB 1ZHYA 2INNE 1I4QA 2K0LA 1FCCC 1HEZE 3AECB 5D3IB 4NAWB 3T3NA 3BWUD 2Y3AA 4HRSA 2V3NA 3B2FA 4KX6B 3AA0B 2I38A 1CJEA 1TKYA 3AEAB 5T8IA 1HXXA 4E1TA 1EWYC 4WQMA 2LFUA 4FESA 1SJED 3O13A 2GI9A 1HZ5A 2PKOA 4WH4A 4XE0A 3BK1A 3TSSA 2Y5PA 1VZ7A 1HA5A 4IDIA 2M56B 1ZDXA 2NTSA 3Q8BA 4FZMA 2JYTA 2V0GA 2OMFA 1KFYB 1N63A 3AE5B 4NAMA 3LB8C 3V3XA 4KGTA 3MJ5A 3VR9B 4RF1A 3P4QB 2QSDA 3U4EG 1QQRA 1BXWA 1JWSD 1QOFA 2KMMA 2WXLA 3AA1B 3NVZA 1SJHD 1UWMA 2RDHA 2YEPB 3L4PA 2W80C 4BUMX 1YJJA 3SEBA 2RDGA 3MC0B 2J1NA 2KZ7A 2BT6A 2N9KA 2LHDA 1I4XA 2KZ7B 1D5XC 1FRDA 3VZTX 1XF5L 1TS2A 2H88B 2MJEA 5LNK1 1D4BA 3AAEA 2JZPA 4XWTA 3VE2A 1JWAD 3PRNA 2K5PA 2L32A 2FGRA 1L4ZB 4RCOA 4KR4A 4AKRA 1BXTA 4WIPA 2BYTA 3NVYA 4XNLA 3IT6B 3K19A 2M19A 2WDRB 1JWBD 2FUG1 1GAQB 3LK2A 3LK2B 3PQSA 3VE1A 2BS4B 3DA3A 2WU2B 4HROA 2XE3A 1MPEA 3WI5A 2JU6X 2NTTA 1SF0A 3AE3B 2IGDA 3W5UB 3DA4A 1FM0D 3P4PB 1V8CA 4O4UA 1C9FA 1MPFA 2L52A 1VZ8A 2E6XA 2FBWB 3KWLA 3Q8CA 2F1VA 2WXMA 4JPSA 1TY0A 3EUB2 4E1SA 4XDCA 1B1ZA 5AFUK 1ZXIA 3LK3B 1FFVA 4O1NA 1L6UA 3IAS1 2Q5WD 1SBBB 1IGCA 5T5FA 5BMGA 3ZGZA 1SE4A 3BYYB 3NUHB 2ICIA 2WDVB 3SZDA 4GF4A 1FNUA 2BS3B 4B0EA 2IPKD 2LHFA 1XLOA 2KDMA 4EE2A 4RNAA 2GE4A 1K51A 1T3QA 2OHFA 3AMZA 4C56C 5BMIA 1E9MA 1D5ZC 4XNKA 2KAJA 5ADXK 3SYBA 1AYFA 4ZRPA 3TEXA 2IGGA 1Y56A 1THQA 2JX5A 1QILA 1MVKA 1EU4A 4Q2JA 1PGBA 3ZJVA 5G5GA 3AE9B 4RL9A 3PQUA 1JWMD 1XO3A 2IGHA 4G75A 3TUOA 3B2GA 1XXGA 2FGQX 1N62A 2KACA 2K4TA 3SFDB 3AA7B 4YXDB 4G76A 2Z8LA 1SSNA 2WP9B 4C7YA 1FXAA 4AYDC 4C80A 1P7EA 3ETRA 3AE1B 4DQOC 2XNAC 4A8XC 4L1BA 3OWEB 1SIJA 2IDYA 1BMLC 2J53A 2WS3B 4FXCA 2L83A 3FYXA 1FMAD 2J4UP 1F77A 4OW0A 4D2KA 2BB6A 1TKEA 4L2YA 2N2LA 3VY9X 1I4PA 1XEEA 3N9YC 3P4RB 2ACZB 2AQ1B 1TS5A 2WXOA 4YTPB 1CK1A 3A2SX 1JW9D 3PO0A 1FFUA 3T3OA 3AE6B 1RWSA 5AFUL 4C7ZA 1OPFA 1QKZA 2MHLA 3I57A 1I4RA 3UPGA 4USAA 4HKQA 1CZPA 3CWIA 1JMLA 1ESFA 2JSVX 2Y5CA 2XG6A 3HW9A 2JXTA 1OQQA 1SEBD 1PFDA 1G90A 3AH7A 1C77A 5FK9C 1JQ4A 2W3RA 4GCQA 2QEJC 2MH7A 5C3JB 1WXQA 1WSPA 1BUIC 3AA0A 2CJNA 3V05A 5GV0A 4YT0B 4FZNA 5ADXL 2GB1A 4KGRA 4B0MA 4LSHA 1SE2A 4KKIA 2QILA 2EELA 3R8BA 3H8HA 2J42A 1OSMA 1T6BX 4AZLA 2NMQA 1UWXA 2AQ2B 1K50A 2H89B 4JCHA 1UUPA 1FEHA 5MPOA 2WXQA 3EGRA 3VRAB 2X27X 5HFYA 3TEZA 2RMMA 4YSZB 4O49A 1M4VA 2J52A 2XTQA 2DLBA 4A55A 4RF0A 1YNTE 1L6VA 3AA1A 2PVGC 4O3YA 1KRHA 3KQ4A 1NYQA 1MHHE 4MH8A 5DL6A 1N5WA 4H2AA 4JX1C 3POXA 4FOZA 1GB4A 3IXSA 2LUMA 2HTME 1UGJA 1J7CA 1ZDVA 2PMVA 3TEYA 3Q8EA 5H8YE 1UNSA 4U9CA 2BS2B 2KDYA 4OZCA 3VY8X 4R3DA 2YEPF 3SYSA 1E7PB 5H92C 1GFNA 2KXPA 2VZKB 1DGJA 2KXPB 2BB5A 3BVZA 3T24A 5FVNA 3VZUX 1V97A 1FRRA 3NZ3A 1MI0A 3KVDD 4F4BA 2KN4A 3AB5A 2PLPA 1YS5A 1ZXHA 1XLPA 1GFPA 1L0XB 2WXFA 1TS3A 4UDUC 1EM7A 3W1SA 4A9AA 2XE5A 2LGIA 1JRPA 3GP7A 1P7FA 3SFEB 4AYID 2PORA 1ENFA 3LK42 3FC4A 4ZYSA 3PORA 4MACA 4FRXA 2TSSA 1Q9GA 3QRCA 4AYMC 3HRDD 1PYWD 7PRNA 4ITKA 1QJPA 3LK3A 3WI4A 2K0PA 3W5VB 3RPFC 3NVVA 3ABVB 1WGKA 3U7ZA 4LSFA 4IOIE 5DL5A 1FXIA 1N60A 1J7AA 2N9LA 3SZVA 1ORMA 1A70A 1YMHE 4J3OD 3AEEB 1VZ6A 2M06A 1SB3C 2V4IB 1YN5A 3P4SB 3AE8B 4NZLB 4CQNA 2ZLDA 2XMXA 1QOAA 4N6EB 1PRNA 4MT5A 3G7GA 1C4AA 2WXKA 4RH6A 4RGNA 4PT5A 1QJ9A 3E9SA 5G5HA 1CQVA 1FNWA 3CIRB 5EE9A 3R2IA 1QOGA 2ONQA 4GHBA 5DL8A 2X38A 3VR8B 1N61A 3SR6A 4TQ0A 3ZJUA 4AYNA 4TQ1A 1FNVA 3AEGB 5EE2A 5D3DA 3AA7A 2DYOA 1GPXA 5FR3A 2Y0LA 4XDDA 8PRNA 5EE0A 2WLBA 3PZ8A 3JTYA 2DWQA 1VRAB 1J7BA 4HJGE 3V8UA 4FMSA 4AS1A 3P63A 4JWUC 2W3SA 1V1PA 4JFBA 1PGAA 3IAM1 4GLSC 4DXFA 1V1PB 2RPVA 3AE7B 1YQ4B 2PRNA 4TSSA 1C79A 4XWWA 1F0ZA 2Y0KA 4KKJA 1F2RC 2Y7SA 4O3XB 1ZPSA 4D64A 2FE8A 2N7JA 2OEDA 4US8A 3RFZB 1KH0A 1XLQA 2PTLA 5TSSA 3ZYYX 3U52E 2WNMA 1TKGA 4C69X 1GFQA 4M0WA 3W2DA 1QOBA 2MJ3A 1GB1A 3AA6A 4RGTA 3FAHA 3BIID 2AX5A 3AA6B 1MHXA 4LTUA 4YTMB 1PHOA 2L1AA 2JMMA 4RLBA 1QT9A 3E56A 3MP9A 2O4VA 1AW7A 3QRAA 2ZW0A 1HZ6A 4JE3B 4YTNB 4JWSC 4LSEA 1SXTA 3BVGA 2WQYB 2LJIA 5D5DA 2W55A 3DWGC 4AFKA 1YN3A 1WWTA 2R61A 4LK0M 1I4HA 2AQ3B 2MJDA 4O3ZA 1JROA 4B61A 4ZOHC 4AUIA 2JYEA 2PVOD 3GP6A 2PIAA 1VJKA 4FSPA 3VRBB 2MNHA 2CU3A 1HXUA 3AEFB 1EU3A 2XTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XLN A;  1DGJ A;  3W9C B;  2WDV B;  1FIQ A;  2K22 A;  1E10 A;  2E3T A;  1VLB A;  2BS3 B;  1V97 A;  1FRR A;  1RM6 C;  2WU5 B;  4US9 A;  5C2T B;  1XLO A;  1NEK B;  1L5P A;  1T3Q A;  2OHF A;  3AMZ A;  1OFF A;  4WWM A;  1XLP A;  3NRZ A;  1E9M A;  4ZHP A;  3DWM A;  2KAJ A;  4A9A A;  2G1E A;  1JRP A;  1AYF A;  3P1M A;  1QLB B;  3SFE B;  2JX5 A;  5EE3 A;  3FC4 A;  1NI3 A;  1NYR A;  3LXF A;  3AV8 A;  1E0Z A;  1NVI D;  5G5G A;  4YSY B;  3HRD D;  3AE9 B;  1DOX A;  1YQ3 B;  4ITK A;  1TJE A;  1XO3 A;  1R7S A;  1ZUD 2;  3W5V B;  4G75 A;  3B2G A;  3RPF C;  2XTR A;  1N62 A;  1PDX A;  1TYG B;  3NVV A;  3ABV B;  1WGK A;  3HVZ A;  2N0S B;  2QIE B;  1FXI A;  1WRI A;  1N60 A;  2K9X A;  3B9J A;  3AM9 A;  1WYG A;  3SFD B;  1J7A A;  4P6V F;  3WCQ A;  4YXD B;  1DOY A;  4G76 A;  3AE4 B;  1B9R A;  3AEF B;  1VDV A;  1DOI A;  1RFK A;  5EE1 A;  1A70 A;  1OQR A;  2WP9 B;  4FZL A;  2B76 B;  4C7Y A;  1FXA A;  3AEE B;  1I7H A;  2CJO A;  1PUT A;  3AEB B;  3AEC B;  3AE2 B;  1SB3 C;  4C80 A;  3ETR A;  3AE1 B;  2W54 A;  4YSX B;  4N59 A;  3P4S B;  3AE8 B;  1SIJ A;  2XMX A;  4HRS A;  1ROE A;  1QOA A;  4N6E B;  2WS3 B;  3B2F A;  4FXC A;  2L83 A;  1NEN B;  4KX6 B;  1FMA D;  1CJE A;  1TKY A;  3AEA B;  1AWD A;  1JAL A;  1EWY C;  3CIR B;  1TKE A;  2QJL A;  3HUI A;  4WQM A;  5G5H A;  3W5U B;  5EE9 A;  3P4R B;  2PKO A;  2ACZ B;  1QOG A;  1KF6 B;  4YTP B;  3VR8 B;  1N61 A;  3SR6 A;  1JW9 D;  3PO0 A;  4ZHO A;  1YJI A;  1FFU A;  4IDI A;  2M56 B;  3AE6 B;  3AEG B;  1QF6 A;  4FZM A;  1RWS A;  1KFY B;  1N63 A;  4C7Z A;  4N58 A;  3AE5 B;  3LB8 C;  1GPX A;  3VR9 B;  4USA A;  1ZP0 B;  1CZP A;  1E6E B;  3CWI A;  3P4Q B;  2Y5C A;  5EE0 A;  2WLB A;  1OQQ A;  2DWQ A;  1QOF A;  2KMM A;  2LEK A;  1J7B A;  3NVZ A;  1UWM A;  1PFD A;  3AH7 A;  3L4P A;  1JQ4 A;  1YJJ A;  3P63 A;  2W3R A;  4JWU C;  2W3S A;  2MH7 A;  5C3J B;  1WXQ A;  3AE7 B;  2CJN A;  2BT6 A;  1YQ4 B;  2DBY A;  2H88 B;  4YT0 B;  1FRD A;  4FZN A;  2MJE A;  1F0Z A;  1IUE A;  1JWA D;  4US8 A;  1XLQ A;  2K5P A;  3ZYY X;  1TKG A;  3NS1 A;  2H89 B;  3NVY A;  1QOB A;  1RYJ A;  2MJ3 A;  3AB5 A;  2M19 A;  2WDR B;  3FAH A;  3BII D;  1ZOY B;  1JWB D;  2AX5 A;  5MPO A;  3VRA B;  1GAQ B;  4LTU A;  4YTM B;  4YSZ B;  1QT9 A;  2BS4 B;  2WU2 B;  3DA3 A;  2XTQ A;  4HRO A;  5AUI A;  3AE3 B;  2JQR B;  1SF0 A;  4YTN B;  5AUK A;  4JWS C;  3DA4 A;  1FM0 D;  1L6V A;  1KRH A;  2PVG C;  3P4P B;  1V8C A;  3AED B;  1NYQ A;  2WQY B;  2W55 A;  3DWG C;  1N5W A;  2L52 A;  3NVW A;  1WWT A;  4JX1 C;  2FBW B;  3KWL A;  2MJD A;  3AN1 A;  1JRO A;  2HTM E;  4ZOH C;  5GXG B;  1FO4 A;  1J7C A;  1N5X A;  3EUB 2;  2PVO D;  5H8Y E;  5H92 C;  1ZXI A;  1FFV A;  2BS2 B;  2PIA A;  2WDQ B;  1VJK A;  3VRB B;  2EKI A;  2CU3 A;  1L0V B;  1L6U A;  2Q5W D;  1E7P B; 
#chains in the Genus database with same CATH topology
 4WJO A;  1WJN A;  4FAD A;  1AN8 A;  3FIL A;  1H8C A;  1P1A A;  5PRN A;  3DWM A;  4J6I A;  3BK2 A;  5AEK B;  4FUV A;  4OHJ A;  1I35 A;  1KTK A;  4GCP A;  1ZUD 2;  5E6J A;  5G38 A;  1ZHZ A;  1JRU A;  4KVG B;  1C4C A;  3TJP A;  2YPV A;  4EFO A;  2XE2 A;  2QIE B;  5HI1 A;  3WCQ A;  3B1L X;  4DQO C;  3IVF A;  2JQY A;  4W9D A;  3VTV A;  1OQR A;  2B76 B;  3ML8 A;  2R4L A;  3AE2 B;  4LJO B;  1IGD A;  2HDE A;  4PUX A;  4GDL A;  3DVG Y;  1NEN B;  1AWD A;  4NJC A;  2LWP A;  1UZX B;  2UYZ B;  2Y0H A;  1GFO A;  3KH0 A;  3VZW X;  4ZHO A;  4AKR B;  2KJ6 A;  2GBK A;  2ZFG A;  4AKM A;  4FHK A;  3NSG A;  2KLG A;  4Z3T A;  1ZP0 B;  4IM2 A;  1V81 A;  5BYS A;  1GFM A;  2LEK A;  5BMH A;  1ZHT A;  1WR1 A;  3RCZ A;  3N30 A;  3GZN B;  1RLF A;  4A6Q A;  2MEK A;  2DBY A;  5JXV A;  2X9K A;  3NS1 A;  2PPH A;  2QTK A;  3EMN X;  3QAQ A;  2KC0 A;  3EA6 A;  4MSM B;  4DHZ E;  2RDB C;  4AQ7 A;  3PGU A;  2LHE A;  3HOL A;  1DYQ A;  4RJW A;  5JDP A;  1BT0 A;  2MBB B;  3AN1 A;  2LRU A;  3I5J C;  2BTE A;  2DAF A;  2WDQ B;  4MEM A;  3ZXV A;  1L0V B;  3RNG C;  5J17 A;  1FD6 A;  1Q9F A;  5GMV A;  1ZE3 D;  1C76 A;  1JWU D;  3DQV A;  2WXN A;  3Q8A A;  4GIV A;  4US9 A;  4DXA B;  1TZO A;  4RGM A;  4ZHP A;  2MP2 B;  3KUD B;  3WAO A;  2LFI A;  2G1E A;  2NS5 A;  2GRI A;  5FKA C;  4BBN F;  3TBL D;  4ZRQ A;  2CKH B;  3TIX A;  3A1Q A;  3CST A;  2WXG A;  2BWE S;  3PPA A;  1D6E C;  5DPW A;  3HVZ A;  2K6Q A;  2KTF A;  3AM9 A;  2WXJ A;  3RNC C;  1MM5 A;  4II3 B;  4RJX A;  1P4T A;  1VDV A;  3U8Z A;  4GDK A;  1JCK B;  1I7H A;  3R2T A;  5BYR A;  2G4D B;  2INN E;  5D3I B;  3WAM A;  4NY0 A;  2Y3A A;  2V3N A;  1WJU A;  4KX6 B;  1ZW7 A;  2I38 A;  3AEA B;  4WQM A;  1HZ5 A;  2Y5P A;  3Q3J A;  4IDI A;  3Q8B A;  2YVC A;  2V0G A;  1KFY B;  3AE5 B;  4NAM A;  3V3X A;  3VR9 B;  4RF1 A;  1QQR A;  1JWS D;  2KMM A;  1QOF A;  1SJH D;  2N9E B;  2YEP B;  3A0B O;  3MC0 B;  1MG4 A;  1FRD A;  3DVG X;  3A9J A;  1WGH A;  1D4B A;  1S1Q B;  4XWT A;  1S5L O;  2ZVO A;  2L32 A;  2FGR A;  1L4Z B;  2L0T A;  4KR4 A;  4AKR A;  4WIP A;  3IT6 B;  3L54 A;  1RAX A;  4PK1 A;  1JWB D;  1V9J A;  3Q3F A;  3PQS A;  3DA3 A;  1GC6 A;  4HRO A;  2NTT A;  2MCN B;  4O4U A;  1C9F A;  1F1H A;  3EUB 2;  4E1S A;  1B1Z A;  5AFU K;  1KM7 A;  1ZXI A;  3W1Y A;  4CYE A;  1EUV B;  4O1N A;  3IAS 1;  1LXD A;  3H6N A;  4EUT A;  1SE4 A;  2KDF B;  2ICI A;  3GE8 C;  4P1C C;  5CTR C;  1XLO A;  4RNA A;  3AMZ A;  3A9K A;  4AUQ C;  4EZL A;  4ZRP A;  4C00 A;  2JX5 A;  1THQ A;  2WGS A;  1WE6 A;  3QA8 A;  4Q2J A;  5G5G A;  1NBF C;  4RL9 A;  4I6P A;  3RNF C;  1WZ3 A;  2PEA A;  3SFD B;  3AA7 B;  4IWP A;  3PT2 B;  2WP9 B;  2KAN A;  2N1W A;  4EZJ A;  2MP2 A;  2XNA C;  2V4L A;  4GN1 A;  1SIJ A;  2L83 A;  4CO7 A;  2BB6 A;  3ZVV A;  2CHZ A;  2VH2 A;  3SU8 X;  3OJ4 B;  3A2S X;  3DBH B;  1FFU A;  3T3O A;  1RWS A;  3KUC B;  4QAY A;  5AFU L;  4LNF A;  1HTO A;  1R4M B;  4HKQ A;  4USA A;  1Q1O A;  1CZP A;  4M01 A;  1JML A;  1WXV A;  1GC7 A;  3HW9 A;  2ZZP B;  1JQ4 A;  3NS8 A;  2LGD A;  1LFD A;  2MBQ A;  1WXQ A;  3V05 A;  3NOB A;  4YT0 B;  4FZN A;  4KGR A;  2GB1 A;  4KV2 A;  2KC2 A;  2RSU A;  3ZNH B;  2MHJ A;  2NMQ A;  3KZI O;  1K50 A;  2H89 B;  1FEH A;  5IP4 D;  4WJP A;  2REX A;  2RMM A;  3UIO B;  2XTQ A;  1L6V A;  1OQY A;  4GMV A;  2WVP A;  5JHB A;  3WA0 A;  3UIP B;  4H2A A;  2EKE C;  1GB4 A;  4FOZ A;  4BZA A;  4HJK A;  4JIO U;  1J7C A;  1ZDV A;  2PMV A;  2IBI B;  4U9C A;  2Z59 B;  3BRZ A;  3KW5 B;  4ZRJ A;  3RUL A;  1A5R A;  1WYW B;  3APF A;  1YX5 B;  3C19 A;  1YS5 A;  1ZXH A;  3TCA A;  1ZKH A;  2JRI B;  2N7E A;  2XE5 A;  1JRP A;  1HE8 A;  1NDD A;  4HXD A;  2POR A;  1WIA A;  2TSS A;  3M62 B;  4AYM C;  3HRD D;  1PYW D;  7PRN A;  2K0P A;  4FJZ A;  2KJR A;  4FA6 A;  4B6W A;  3ABV B;  4LSF A;  5DL5 A;  2RD0 A;  4JGH B;  2WWZ A;  5HKH A;  2C7M B;  4XYC A;  2V4I B;  3P4S B;  4BKS A;  4CQN A;  5B66 O;  1PRN A;  4W9L A;  4RH6 A;  3PRE A;  1QJ9 A;  3DWN A;  2MA9 B;  5EE9 A;  3ENE A;  2L7R A;  4GHB A;  3SR6 A;  4TQ1 A;  3H7S A;  5D3D A;  3WIM A;  3AA7 A;  4HPM B;  2DYO A;  5E79 O;  8PRN A;  5EE0 A;  4HJG E;  4NNJ B;  4FUL A;  3ZRF A;  3C0R B;  4FQE A;  2W3S A;  4DHJ D;  4GLS C;  3IAM 1;  3AE7 B;  2RPV A;  1IP9 A;  2PRN A;  4TSS A;  1UH6 A;  3MC9 A;  4O3X B;  2OJW A;  4D64 A;  2CU1 A;  2OED A;  1KH0 A;  1AAR A;  4C69 X;  3W2D A;  4RGT A;  3Q3M C;  2KK8 A;  3BII D;  2AX5 A;  4LTU A;  2L1A A;  2KDB A;  4K7S A;  4RLB A;  4W9J A;  3E56 A;  1P9D U;  1AW7 A;  2ZW0 A;  1HZ6 A;  4YTN B;  3N20 C;  1MFW A;  1WMH B;  2D3G A;  2KD0 A;  3DWG C;  4O3Z A;  4ZOH C;  2R89 A;  4PYU A;  3RYT A;  2WYQ A;  2PVO D;  1UGM A;  3GP6 A;  1VJK A;  5E6N A;  1HXU A;  5IA7 A;  1T0Q C;  4GCS A;  1V5O A;  5G2N A;  3DZM A;  1G6J A;  3FIL B;  1VLB A;  1RM6 C;  2ERV A;  2LMC A;  2LI5 A;  3P42 A;  1WXM A;  3GS2 A;  3FKY A;  2MLB A;  3Q69 A;  1QJ8 A;  4AP4 C;  2AYO B;  3OAW A;  2KX0 A;  2IWV A;  2KMC A;  3QJZ A;  2JZ3 B;  2PJH A;  3T20 A;  1L4D B;  4RLC A;  5D7G A;  2GMI C;  2BYE A;  4OZB A;  4M8M A;  3VQI A;  4CHK A;  3UQB A;  4LNO A;  2DEN B;  3I63 C;  4KRA A;  2FAZ A;  3URY A;  1IYF A;  4P6V F;  3X0W A;  3AE4 B;  2WXI A;  1DOI A;  2WX0 A;  2NCN A;  4PYZ A;  3POQ A;  4NJ6 A;  4LSI A;  4FZL A;  4FRT A;  1SIF A;  3AUL A;  2DYM A;  1WXA A;  4N59 A;  1IBX A;  4GDL B;  4W9G A;  4D5U A;  4NJ7 A;  4AJW A;  2DHZ A;  1XT9 B;  2L3Z A;  4L23 A;  2KQ4 X;  4DBG A;  1KF6 B;  2PE6 B;  1NI2 A;  1YJI A;  2IJ0 A;  4D65 A;  4QQ1 A;  4RFB A;  4RGO S;  2QC8 A;  1WY8 A;  3ECI A;  2HJ1 A;  5G26 A;  1I4G A;  1E7V A;  3H9D A;  1V1O A;  3H1U A;  3L17 A;  3T8M A;  4MJS B;  1IUE A;  3O0E A;  2ON8 A;  4O4X A;  3JCU O;  2M0X A;  1WM3 A;  3LJ3 A;  4W9K A;  1E54 A;  3DWO X;  3AB5 A;  3UU2 A;  2N9X A;  1TS4 A;  5EDS A;  1LO5 D;  2BBC A;  1MJD A;  5AUI A;  4IW0 A;  3D32 A;  1WE7 A;  4IWO A;  1Z2M A;  3NVW A;  4IWQ A;  1FO4 A;  1ET6 A;  3PTF C;  4TMA B;  2LRW A;  4OVZ A;  3UI3 A;  1J19 A;  2EKI A;  1ZHW A;  5KHO A;  1ET9 A;  1XLN A;  4ASW C;  4YWG G;  3ZQ4 A;  2WXR A;  1FIQ A;  3K9O B;  6PRN A;  2E3T A;  5BYQ A;  2N2M A;  5HG2 A;  5CX3 A;  4WWN A;  3SD5 A;  2HJ8 A;  1L5P A;  1MM4 A;  3PHX B;  1GG3 A;  2RGF A;  1WMH A;  3KWV A;  3HOE A;  1E8Y A;  2SEB D;  2AL6 A;  4WAA A;  2FIF A;  3A1Q B;  1ACC A;  4DXG A;  1Q10 A;  3DBL B;  1C78 A;  3DBR B;  1TYG B;  2XN9 C;  1H6S 1;  2N0S B;  1WYG A;  4W9F A;  1BT9 A;  5DPS A;  3J9C A;  2R4N A;  4GDK B;  4ANV A;  4A3O A;  2XE1 A;  4NAW A;  2K0L A;  1FCC C;  1HEZ E;  1P0R A;  2WHI A;  4FJV B;  3BWU D;  3QIJ A;  3VTW A;  1UF0 A;  3B2F A;  3AA0 B;  1TKY A;  2KTR A;  4M00 A;  1EWY C;  1GNU A;  2LFU A;  2Y5B B;  2OOB B;  2GI9 A;  2UWQ A;  4XE0 A;  4CTD A;  3L10 B;  4FZM A;  2OMF A;  3TMP B;  3A0H O;  1UBQ A;  3U4E G;  2FNJ B;  4DK5 A;  4EZK A;  3L4P A;  3T9L A;  1WI0 A;  3Q14 C;  2J1N A;  2KZ7 A;  4W9C A;  1I4X A;  4I6L B;  1WRD B;  4DWF A;  4YL8 A;  1WFY A;  3A9J B;  2JZP A;  3VE2 A;  1JWA D;  2W9N A;  3VUW A;  3WAN A;  2BPS A;  3PRN A;  4HDO A;  1F52 A;  4RCO A;  3NVY A;  2M19 A;  3PHW B;  2GBR A;  2WU2 B;  1N6Z A;  1MPE A;  3AE3 B;  3W5U B;  1FM0 D;  1V8C A;  3LDZ E;  3VUX A;  2AXT O;  2MBH A;  1VZ8 A;  2KQ7 A;  3KWL A;  2R88 A;  4JPS A;  1TY0 A;  2MX2 A;  4EEW A;  3HHM A;  4XDC A;  4WWO A;  4BKG A;  4MJS A;  3IG3 A;  3VVW B;  4N74 A;  2UU7 A;  4DHJ B;  1IGC A;  2IYD B;  2N7D A;  2WDV B;  2DZK A;  2KZR A;  3BIN A;  4P1B C;  3SZD A;  5G39 A;  2BKR B;  1FNU A;  4B0E A;  3QAR A;  3ZTD A;  2OHF A;  1E9M A;  1D5Z C;  3A9K B;  2KAJ A;  5ADX K;  4TV3 A;  1Y56 A;  1QIL A;  3ZJV A;  4K7U A;  5JH5 C;  3DPD A;  1XO3 A;  2KO3 A;  2FGQ X;  2KAC A;  2KFJ A;  5FR6 A;  3CMM B;  2IO3 B;  4URK A;  1U4A A;  2Z8L A;  4C7Y A;  4C80 A;  2IDY A;  1E8Z A;  4FXC A;  2J4U P;  3HM6 X;  4OW0 A;  2N2L A;  3N9Y C;  3P4R B;  2ACZ B;  1D3Z A;  1TS5 A;  2WXO A;  3B08 A;  4S17 A;  4YTP B;  1WZ0 A;  1CK1 A;  2WDT B;  4AWJ A;  3AE6 B;  4KSK C;  3UGB B;  4C7Z A;  2MWS B;  2KKC A;  1I4R A;  2IY0 B;  1PQS A;  1R4N I;  3HIZ A;  2JXT A;  4E3C A;  1SEB D;  1C77 A;  5FK9 C;  4GCQ A;  5C3J B;  2KJH B;  3AU4 A;  1WSP A;  1BUI C;  3AA0 A;  3NHE B;  5ADX L;  4ACF A;  4B0M A;  1C1Y B;  3R8B A;  3L16 A;  2J42 A;  3VXW A;  2KWV B;  4KDL B;  3BS0 A;  1UUP A;  5MPO A;  3N1X C;  3NZU A;  4YSZ B;  2J52 A;  2BGF A;  2LD9 A;  4A55 A;  4RF0 A;  1YNT E;  2D2Q A;  1KRH A;  1NYQ A;  2MW5 A;  2LUM A;  1UGJ A;  3KVF B;  3R3M A;  3TEY A;  4OZC A;  2RR9 A;  4K7W A;  3SYS A;  1V80 A;  2KXJ A;  3DHG C;  3V60 A;  2BB5 A;  3BVZ A;  3T24 A;  4F8C B;  2M1M A;  2ZPN A;  4F1S A;  2O2V A;  1MI0 A;  3V6E B;  1XD3 B;  2PLP A;  1GFP A;  2ZCC A;  3W1S A;  3HK0 A;  4A9A A;  3RT3 B;  1P7F A;  3LK4 2;  2D3A A;  4MAC A;  3V6C B;  3OG5 A;  3UIN B;  3QRC A;  2KHW B;  1QJP A;  3W5V B;  3ZW3 A;  3PVL A;  1J7A A;  2KFK A;  3PRZ A;  3SZV A;  3N1Y C;  4J3O D;  2C7N B;  4OVV A;  3VFK A;  2XEW A;  4FN2 A;  2XMX A;  3VH4 B;  1QOA A;  4MT5 A;  1IPG A;  2WXK A;  2EMS A;  3IFW B;  1KOT A;  3APD A;  1FNW A;  2VH1 A;  2A5U A;  2R8A A;  2LVP A;  1QOG A;  3RNE C;  4AYN A;  5DPR A;  3AEG B;  5EE2 A;  3ZNI D;  3VHT C;  3Q3O C;  3ZDM C;  3QC8 B;  5FR3 A;  2Y0L A;  1LM8 B;  2WLB A;  2MQJ A;  3P2B A;  3P63 A;  4JWU C;  1V1P A;  1PGA A;  4BOS C;  4DDI D;  4DXF A;  3PGE A;  2DNF A;  1C79 A;  4MGY E;  4HCN B;  4HCP B;  1F2R C;  1S3S G;  2FE8 A;  4M8N A;  3ZYY X;  3ZO5 B;  1GFQ A;  2MJ3 A;  3RN9 C;  3AA6 A;  3FAH A;  5GTH O;  4IM0 A;  1QT9 A;  2KWU B;  5E6O A;  4A3P A;  4JWS C;  1SXT A;  3GZN I;  1V86 A;  2C9W B;  2WQY B;  2ZPY A;  1Y8R C;  4AFK A;  1ZGU B;  2R61 A;  4LK0 M;  1I4H A;  1T0R C;  2JYE A;  3KYC D;  2DX5 B;  1HTQ A;  2MNH A;  1TBE A;  2CU3 A;  2Z0D B;  1EU3 A;  4K3C A;  1F0Z A;  2XTR A;  5TSS A;  4OZA A;  3W9C B;  1XCT L;  3DVN U;  4A90 A;  5C2T B;  2GBM A;  3PRP B;  4HDQ A;  3U2S C;  3N3K B;  2YNK A;  3PLV A;  1ZHX A;  4WQO B;  4HKZ E;  4REZ A;  5IYU A;  1EWC A;  1NI3 A;  1NYR A;  3LXF A;  3QWZ B;  5CHF A;  3AV8 A;  2KLC A;  3HVD A;  3I3T B;  2JVC A;  5AZF A;  1EF5 A;  1TJE A;  1WJ4 A;  5TR5 A;  1STE A;  4GB9 A;  1FXT B;  2LVO A;  3SY7 A;  1WRI A;  1V49 A;  2L0F A;  1GOZ A;  2J4X A;  2R2Q A;  3VTU A;  2XK5 A;  1RFK A;  3BYT B;  1WH3 A;  1L0Y B;  3EFU A;  2GBN A;  1EF1 A;  1F9J A;  2W54 A;  2CS4 A;  2WXH A;  3GB1 A;  1IBX B;  2F1C X;  1IZN A;  1JAL A;  2QJL A;  1F2R I;  3AAE B;  5L83 A;  2Y2X A;  5DL7 A;  2W81 C;  2SAK A;  1M94 A;  2JWU A;  2G9H D;  3IT4 B;  4N58 A;  3RBH A;  2M0A A;  4KGS A;  3AAA A;  2N9P C;  3M63 B;  3I9V 1;  3NY5 A;  1FCL A;  1E5W A;  2I1K A;  4LDT D;  4KZC A;  2L05 A;  1YN4 A;  5D2M B;  2KVR A;  3DDC B;  2KOX A;  1TY2 A;  3Q8F A;  4G11 A;  3T0S A;  2K1F A;  4ZRI A;  3HWB A;  3ALB A;  3POU A;  1K52 A;  3GE3 C;  1UD7 A;  4P16 A;  4PJ0 O;  4AYE C;  2BQQ A;  1T16 A;  4KR8 A;  2QMT A;  5C23 A;  5AUK A;  3ZLZ A;  4JL9 A;  3AED B;  4FBJ B;  3C5O A;  1WF9 A;  2V3P A;  5GXG B;  1VR9 A;  2W82 A;  2L76 A;  4B95 A;  4KDI C;  2MRP A;  4ARI A;  3L08 A;  1LGR A;  3U7D A;  2LGY A;  2QHO A;  2Z0E B;  3N32 A;  1HXT A;  1NEK B;  5IO9 A;  3ZRC A;  1YIW A;  5I4D A;  3P1M A;  2I2Y A;  1GUA B;  1QLB B;  2LXA A;  2NBW B;  2QCZ A;  2G4S A;  5EE3 A;  3QQ8 B;  4HPL B;  1HXY D;  3DHI C;  1NVI D;  2JPH A;  5L95 C;  1UEL A;  1ISN A;  1DOY A;  4IKG A;  2WJR A;  2WXP A;  1PUT A;  2LZ6 A;  3AEB B;  1ZHY A;  4E74 A;  4EKU A;  1TTN A;  4DHZ B;  4NAW B;  1WM2 A;  2JRH A;  4HRS A;  1TGZ B;  5JZE B;  5T8I A;  1HXX A;  3R7Q A;  2KTR B;  3O13 A;  2PKO A;  3NG0 A;  4ANX A;  1VZ7 A;  5CHV C;  2M56 B;  2NTS A;  1QF6 A;  2JYT A;  3UQA A;  1N63 A;  1EO6 A;  3LB8 C;  3PZD A;  3MJ5 A;  3P4Q B;  2KNB A;  2QSD A;  1BXW A;  2WXL A;  4RM8 A;  2KDI A;  3AA1 B;  3NVZ A;  1YQB A;  1UWM A;  2V9H A;  2W80 C;  1YJJ A;  3VUY A;  4JLC A;  2G45 B;  4MSQ B;  5D94 A;  5JHA A;  2LHD A;  2H88 B;  2KZ7 B;  1XF5 L;  2INC C;  1VCB A;  5LNK 1;  2IND C;  3DBH I;  3AAE A;  3EEC A;  2CR5 A;  3MJW A;  1SGH A;  2K5P A;  4HLE A;  1FPY A;  1R4M I;  2R4O A;  2BYT A;  1WR6 E;  4ZYN A;  3K19 A;  2JXX A;  1GAQ B;  3LK2 A;  3QX1 A;  3NZS A;  3ZXR A;  1E90 A;  3WI5 A;  4FHJ A;  2IGD A;  4ICV A;  3P4P B;  4LNN A;  1MPF A;  2GLS A;  4WJQ A;  2E6X A;  2FUH B;  2LXC A;  2WXM A;  4HWI B;  3LK3 B;  1FFV A;  3JW0 X;  1L6U A;  2Q5W D;  2LGS A;  4IM3 A;  3ZGZ A;  5T5F A;  2G3Q B;  4GF4 A;  1E8X A;  2IPK D;  2LHF A;  3SHQ A;  4EE2 A;  4BAX A;  2X8X X;  4C56 C;  4XNK A;  2JY6 A;  1WXS A;  4K1R B;  2IGG A;  2ZJD A;  1MVK A;  1EU4 A;  3HM3 A;  3QCA A;  2DZI A;  3PQU A;  3TUO A;  1MG8 A;  4G75 A;  5AZG A;  1TZ1 A;  4YXD B;  4AOF A;  4G76 A;  2GBJ A;  2WX1 A;  4KIK A;  1T1L A;  1FXA A;  1WGY A;  4AYD C;  3AI5 A;  5KAF O;  3DCG A;  3OWE B;  4L1B A;  3BRY A;  4A8X C;  2WS3 B;  4II2 B;  2NPT A;  1FMA D;  2L00 B;  4D2K A;  2NBV B;  2N4F A;  3VY9 X;  1XEE A;  3ONS A;  3JSV B;  1JW9 D;  2FCN A;  4M0W B;  3WAP A;  4XZ4 A;  1I42 A;  1OPF A;  1QKZ A;  2MHL A;  2DYB A;  3UPG A;  3CWI A;  2VRR B;  1ESF A;  2JSV X;  2ZEQ A;  2Y5C A;  1PFD A;  1G90 A;  3AH7 A;  1WX8 A;  2W3R A;  5DCN A;  4UB6 O;  1XQQ A;  5GV0 A;  1SE9 A;  1OTR B;  2M8S A;  3CSF A;  4KKI A;  2KWC A;  1E8W A;  2ZNV B;  3MTN B;  1OSM A;  1T6B X;  4AZL A;  1UWX A;  4N9F 4;  4ZDV A;  3ZNZ B;  1V6E A;  2JZZ A;  2WXQ A;  5HFY A;  4K81 A;  3R7R A;  2CHX A;  2WJQ A;  4C4V B;  3AA1 A;  3RZF A;  1MHH E;  5DL6 A;  1N5W A;  3IXS A;  2FCM A;  2HTM E;  1WX7 A;  2AEH A;  4LDT B;  2C5L C;  5H8Y E;  5LXH A;  2KDY A;  1RRB A;  4R3D A;  3RI7 C;  2YEP F;  1E7P B;  1GFN A;  2KXP A;  1DGJ A;  1P3Q U;  1V97 A;  1FRR A;  2KC1 A;  3KVD D;  4F4B A;  2KN4 A;  2O2V B;  4HVB A;  1XLP A;  1OEY J;  2WXF A;  4W9I A;  1TS3 A;  4UDU C;  3GP7 A;  2NR2 A;  2K25 A;  4AYI D;  3FC4 A;  1OGW A;  3POR A;  4ZYS A;  4FRX A;  4XX5 A;  3NJT A;  4ITK A;  2D3B A;  3LK3 A;  3WI4 A;  2JWZ A;  3ZNG C;  3U7Z A;  4IOI E;  1YX6 B;  1FXI A;  2KFK B;  1WGR A;  1A70 A;  1YMH E;  4MGK E;  1YJ1 A;  1T0Y A;  1SB3 C;  1YN5 A;  4NZL B;  4N6E B;  3WAL A;  3G7G A;  2MBE A;  3E9S A;  2K8C A;  5DPT A;  5G5H A;  3H7P B;  4IC7 B;  3R2I A;  2ONQ A;  2X38 A;  5DL8 A;  3DBS A;  3VR8 B;  4TQ0 A;  3N1Z C;  3BY4 B;  3OJ3 A;  2KX3 A;  4RMA A;  2PE9 A;  2KDE B;  4GOC A;  2J0K A;  1GJZ A;  5LLI A;  3PZ8 A;  3JTY A;  4ICU A;  4WJN A;  2EMT A;  5AZH A;  2KN5 A;  2O6V A;  4JFB A;  4TKN A;  1V1P B;  3CF6 E;  4XWW A;  1ZPS A;  2N7J A;  2NVU I;  2K6D B;  2KYW A;  2PTL A;  3JSV A;  3U52 E;  1TKG A;  1YD8 U;  2K8B A;  4LJP B;  4M0W A;  2BYF A;  3AA6 B;  4B9K A;  4YTM B;  3MP9 A;  1KJT A;  4S0R A;  5E6P A;  4XC2 A;  3BVG A;  2N1V A;  4JQW C;  3L13 A;  1JRO A;  4AUI A;  2ZNV C;  4I6N B;  2PIA A;  4FSP A;  3VRB B;  2R4P A;  3AEF B;  2D3C A;  3A4R A;  3RZW C;  4P7I A;  2LGX A;  2K22 A;  1E10 A;  1T0S C;  3V61 A;  4X57 B;  4PS7 A;  4WUR A;  4NPN A;  1YOV B;  2F1T A;  1OFF A;  2JT4 B;  4C4V A;  3SDL C;  1PGX A;  3UAQ A;  5H2F O;  2IY1 B;  1L7Y A;  3LK4 1;  4YSY B;  1WJ6 A;  2HD5 B;  2HE7 A;  1R7S A;  3C8Y A;  2CHW A;  2ODJ A;  1SE3 A;  3B9J A;  4G0N B;  4FT6 A;  1B9R A;  3PSE B;  2LJ5 A;  2XK5 B;  1K8R B;  3W1S C;  1HQR D;  2CJO A;  3PF1 A;  4YSX B;  3PZ7 A;  1ROE A;  3BVM A;  3DBL I;  2K8H A;  4ANW A;  2PW9 A;  3DBR I;  1IZN B;  3HUI A;  3M3J A;  1XCQ L;  3MHZ A;  2A4Z A;  3RUI B;  3DVN V;  5IOI A;  4KZ0 A;  3BZD B;  4KSL C;  3AAA B;  1E6E B;  2INP E;  2KWD A;  2AL3 A;  3ZTC A;  2M07 A;  4WAF A;  1KLG D;  1TT5 B;  2BWF A;  3TZG A;  1LQB A;  5G3A A;  1C4P A;  4K3B A;  2VZK D;  3KLS X;  4HEA 1;  3H7P A;  3MFG A;  2IO1 B;  1T5X D;  1RYJ A;  1KLU D;  1ZOY B;  3PLU A;  2ASQ A;  2DZM A;  5LXI B;  3VAW A;  3ZIM A;  3QHT A;  5IAA C;  2JQR B;  1WGG A;  3OLM D;  3M95 A;  1UBI A;  3UF8 A;  3DOW A;  5C1Z A;  2QDF A;  1N5X A;  2AWT A;  2MBO A;  3JYU A;  5HHD G;  1D5M C;  3LYY A;  4N75 A;  2YLM A;  3IHP C;  4GXB A;  2LAS A;  5B5E O;  4MGI E;  2WU5 B;  4FSO A;  3ZJT A;  3PV1 A;  3ML9 A;  3QK0 A;  4ARC A;  2D07 B;  4WWM A;  1Q0W B;  3NRZ A;  4G50 A;  4NQK E;  3TEW A;  1K53 A;  4O3W A;  4MM3 B;  3B0A A;  1E0Z A;  1DOX A;  1YQ3 B;  1BH3 A;  4IG7 B;  3SY9 A;  4IUM B;  4LLG M;  2D11 A;  1PDX A;  1CMX B;  2ZW1 A;  4FJY A;  2FCQ A;  2K9X A;  1C3T A;  5TIS O;  2BW2 A;  5EE1 A;  2O6V D;  3PGR A;  2K3U A;  2D5G A;  3AEC B;  4BVU C;  1I4Q A;  3T3N A;  4W9E A;  3A4S C;  2NBU A;  3AU5 A;  1L2N A;  1CJE A;  4GSW A;  1WGD A;  4E1T A;  2FCS A;  4FES A;  1SJE D;  4WH4 A;  4OVU A;  3BK1 A;  3TSS A;  3PGS A;  1P98 A;  1HA5 A;  2KT7 A;  1ZDX A;  3PS6 A;  4KGT A;  2RPQ A;  1RFA A;  3X23 A;  3GOE A;  4XGA B;  2BVC A;  2J0M A;  2RDH A;  2D10 A;  4BUM X;  3SEB A;  2RDG A;  2N9K A;  2BT6 A;  2IO2 B;  1D5X C;  3EFC A;  2MJE A;  3VZT X;  3O65 B;  1TS2 A;  3EC8 A;  5IN7 A;  2I1J A;  1BXT A;  4XNL A;  2WDR B;  3ZKJ C;  2FUG 1;  5KAI O;  2OJR A;  2KQS A;  3LK2 B;  3VE1 A;  2BS4 B;  2XE3 A;  2DAJ A;  2JU6 X;  3JVZ X;  1SF0 A;  4ZRK A;  3DA4 A;  3L0W B;  4BOZ B;  2L52 A;  3EHV A;  3A33 B;  1KLV A;  3U30 A;  2FBW B;  3Q8C A;  2F1V A;  4M02 A;  1OEY A;  1SBB B;  5BMG A;  3RNA C;  3BYY B;  3NUH B;  3S2A A;  4MDK E;  2BS3 B;  2KDM A;  4PS3 A;  2GE4 A;  1K51 A;  1T3Q A;  4RM9 A;  3K9P B;  5BMI A;  3SYB A;  1AYF A;  3TEX A;  3AXC A;  4GGQ A;  1PGB A;  5J18 A;  3AE9 B;  3KYD D;  1JWM D;  2IGH A;  4F7Z A;  3B2G A;  1XXG A;  1N62 A;  4G3X B;  4BBN C;  2K4T A;  3Q2A C;  2LUE A;  2IZV B;  4FLH A;  4LNK A;  2J7Q B;  3APC A;  3TL5 A;  4KIK B;  1SSN A;  2V3S A;  1P7E A;  4DDG D;  3ETR A;  3AE1 B;  4MM3 A;  2KMA A;  2BKF A;  1BML C;  2J53 A;  3MC8 A;  2R2O A;  3FYX A;  1F77 A;  2NPT B;  4L2Y A;  1TKE A;  1I4P A;  2J0J A;  2AQ1 B;  3PO0 A;  2M4N A;  2C60 A;  3I57 A;  2XG6 A;  2V1Y A;  1OQQ A;  3DHH C;  4MH0 E;  3VH3 B;  2QEJ C;  1V2Y A;  2MH7 A;  4LCD E;  4PS8 A;  2M17 A;  4EOY A;  5IKC M;  2CJN A;  3VDZ A;  4ANU A;  2BYV E;  4LSH A;  1SE2 A;  2QIL A;  3RNB C;  2EEL A;  3H8H A;  2JUO A;  2IWW A;  4UB8 O;  2AQ2 B;  2FID A;  4JCH A;  2XBB C;  1X1M A;  2GOW A;  3EGR A;  3VRA B;  2X27 X;  3TEZ A;  2IO0 B;  4O49 A;  1M4V A;  2DLB A;  4W9H A;  2PVG C;  3KQ4 A;  4O3Y A;  4MH8 A;  4GU2 A;  4JX1 C;  3POX A;  2JF5 A;  3Q8E A;  1UNS A;  2BS2 B;  3MHS D;  3VY8 X;  3V62 A;  3Q3N C;  5H92 C;  4MEL A;  1QZE A;  2VZK B;  2KXP B;  2BF8 B;  5FVN A;  3VZU X;  3NZ3 A;  4MGZ E;  1L0X B;  3PRM B;  2ZVN A;  1EM7 A;  2LGI A;  2LVQ A;  3KUZ A;  3SFE B;  4IL6 O;  1ENF A;  4TUU A;  2K39 A;  5KHQ A;  1Q9G A;  3RPF C;  3RMK C;  3NVV A;  1WGK A;  1E7U A;  1N60 A;  2MSE D;  2N9L A;  5J2R A;  1WX9 A;  1ORM A;  3Q6B A;  3AEE B;  1VZ6 A;  2M06 A;  2HTH A;  1R4N B;  2KVZ A;  3AE8 B;  2ZLD A;  4HPP A;  4A20 A;  3ZDT A;  1C4A A;  2C7H A;  4AJY B;  4RGN A;  4PT5 A;  3IBE A;  1CQV A;  3CIR B;  4WWP A;  5D6J B;  3R66 C;  1N61 A;  3ZJU A;  1FNV A;  1J8C A;  2L8J A;  3WU2 O;  3ZUN A;  1GPX A;  1VD2 A;  5G55 A;  4HK2 A;  4XDD A;  3RD2 A;  2DWQ A;  1VRA B;  1J7B A;  3V8U A;  4FMS A;  5CHW A;  4AS1 A;  2O6V B;  4BKT A;  1YQ4 B;  1H4R A;  1Z5S B;  4E71 A;  2Y0K A;  4KKJ A;  2Y7S A;  3RFZ B;  4US8 A;  1XLQ A;  2DZJ A;  2WNM A;  5GTI O;  1QOB A;  1GB1 A;  4BKS D;  1MHX A;  1PHO A;  2JMM A;  1TIF A;  1J0G A;  2O4V A;  4JE3 B;  3QRA A;  4PR7 A;  4LNI A;  4LSE A;  2ZCB A;  2LJI A;  5D5D A;  2W55 A;  4BFR A;  1YN3 A;  1WWT A;  2AQ3 B;  2MJD A;  4NQL B;  4B61 A;  2B3A A;  5BO4 B;  1V5T A;  1Q5W B; 
#chains in the Genus database with same CATH homology
 4GCS A;  1AN8 A;  4OZA A;  3W9C B;  1XCT L;  3FIL A;  2K22 A;  1E10 A;  3FIL B;  1VLB A;  4A90 A;  5C2T B;  1RM6 C;  2ERV A;  4WUR A;  2LMC A;  3P42 A;  3GS2 A;  5PRN A;  2F1T A;  1OFF A;  3U2S C;  2YNK A;  3DWM A;  3Q69 A;  1QJ8 A;  1ZHX A;  3BK2 A;  1PGX A;  3UAQ A;  4HKZ E;  4REZ A;  5IYU A;  4FUV A;  4OHJ A;  1EWC A;  1NI3 A;  1NYR A;  3LXF A;  3T20 A;  1L4D B;  4RLC A;  3LK4 1;  3AV8 A;  5D7G A;  4YSY B;  3HVD A;  1KTK A;  1TJE A;  1R7S A;  4GCP A;  1ZUD 2;  5E6J A;  4OZB A;  3VQI A;  1ZHZ A;  1STE A;  3C8Y A;  2ODJ A;  1SE3 A;  1C4C A;  2YPV A;  2XE2 A;  3SY7 A;  4KRA A;  1WRI A;  2QIE B;  3B9J A;  5HI1 A;  3URY A;  3WCQ A;  1GOZ A;  4P6V F;  3R2T A;  5BYR A;  2J4X A;  3AE4 B;  4FT6 A;  1B9R A;  2WXI A;  1DOI A;  1RFK A;  3BYT B;  1OQR A;  3POQ A;  4LSI A;  4FZL A;  2B76 B;  4FRT A;  1L0Y B;  1HQR D;  2CJO A;  3AE2 B;  2DYM A;  2W54 A;  4YSX B;  4N59 A;  3PZ7 A;  1IGD A;  2WXH A;  3GB1 A;  2HDE A;  4PUX A;  1IBX A;  1ROE A;  1IBX B;  4GDL B;  4D5U A;  3BVM A;  1NEN B;  1AWD A;  1IZN A;  4NJC A;  1JAL A;  2PW9 A;  4L23 A;  1IZN B;  2KQ4 X;  1F2R I;  3AAE B;  2QJL A;  3HUI A;  2Y2X A;  2Y0H A;  1KF6 B;  1XCQ L;  1GFO A;  3VZW X;  3MHZ A;  5DL7 A;  4ZHO A;  2W81 C;  1YJI A;  4AKR B;  2IJ0 A;  2ZFG A;  2SAK A;  4D65 A;  4AKM A;  4QQ1 A;  2JWU A;  4RFB A;  2G9H D;  3IT4 B;  4N58 A;  3RBH A;  2M0A A;  3BZD B;  4RGO S;  3NSG A;  3AAA A;  4KGS A;  4Z3T A;  3AAA B;  1E6E B;  1ZP0 B;  2INP E;  2KWD A;  3I9V 1;  5BYS A;  1FCL A;  2M07 A;  4WAF A;  1KLG D;  1GFM A;  2LEK A;  5BMH A;  1ZHT A;  5G26 A;  1YN4 A;  3TZG A;  1I4G A;  1C4P A;  4A6Q A;  2VZK D;  2MEK A;  2DBY A;  1V1O A;  3KLS X;  4HEA 1;  1TY2 A;  5JXV A;  3MFG A;  3Q8F A;  1IUE A;  3O0E A;  2ON8 A;  4O4X A;  3T0S A;  3NS1 A;  1E54 A;  3HWB A;  1T5X D;  1RYJ A;  2QTK A;  3EMN X;  3POU A;  2KC0 A;  3UU2 A;  1K52 A;  1KLU D;  1TS4 A;  1ZOY B;  4P16 A;  4AYE C;  3EA6 A;  4KR8 A;  2QMT A;  1LO5 D;  2BBC A;  5AUI A;  2JQR B;  5AUK A;  4AQ7 A;  1QF6 A;  3AED B;  2LHE A;  3C5O A;  3HOL A;  1DYQ A;  3NVW A;  4RJW A;  5JDP A;  3AN1 A;  2V3P A;  5GXG B;  1ET6 A;  1FO4 A;  4TMA B;  4OVZ A;  1N5X A;  1VR9 A;  3UI3 A;  2W82 A;  2BTE A;  5HHD G;  2WDQ B;  1D5M C;  2EKI A;  1L0V B;  3LYY A;  1ZHW A;  1ET9 A;  4ARI A;  1Q9F A;  1XLN A;  1FD6 A;  1ZE3 D;  4YWG G;  1C76 A;  3ZQ4 A;  2WXR A;  1FIQ A;  1JWU D;  6PRN A;  2WXN A;  2E3T A;  5BYQ A;  2WU5 B;  3Q8A A;  2N2M A;  4US9 A;  4FSO A;  5HG2 A;  3ZJT A;  1HXT A;  1TZO A;  1NEK B;  4ARC A;  1L5P A;  4WWM A;  4RGM A;  3NRZ A;  4ZHP A;  1MM4 A;  3TEW A;  1K53 A;  2G1E A;  2LFI A;  2GRI A;  5I4D A;  3KWV A;  3P1M A;  2I2Y A;  5FKA C;  1QLB B;  3HOE A;  4O3W A;  2SEB D;  4MM3 B;  5EE3 A;  4ZRQ A;  1HXY D;  1E0Z A;  1NVI D;  1ACC A;  1DOX A;  2WXG A;  1YQ3 B;  4DXG A;  1Q10 A;  1BH3 A;  3SY9 A;  1C78 A;  4LLG M;  1D6E C;  1PDX A;  1TYG B;  2XN9 C;  2ZW1 A;  3HVZ A;  1H6S 1;  2N0S B;  2K9X A;  3AM9 A;  1WYG A;  2WXJ A;  1DOY A;  1MM5 A;  4IKG A;  1BT9 A;  4RJX A;  1P4T A;  2BW2 A;  1VDV A;  5EE1 A;  3J9C A;  4GDK B;  1JCK B;  2K3U A;  1I7H A;  2XE1 A;  2D5G A;  1PUT A;  2WXP A;  3AEB B;  1ZHY A;  2INN E;  1I4Q A;  2K0L A;  1FCC C;  1HEZ E;  3AEC B;  5D3I B;  4NAW B;  3T3N A;  3BWU D;  2Y3A A;  4HRS A;  2V3N A;  3B2F A;  4KX6 B;  3AA0 B;  2I38 A;  1CJE A;  1TKY A;  3AEA B;  5T8I A;  1HXX A;  4E1T A;  1EWY C;  4WQM A;  2LFU A;  4FES A;  1SJE D;  3O13 A;  2GI9 A;  1HZ5 A;  2PKO A;  4WH4 A;  4XE0 A;  3BK1 A;  3TSS A;  2Y5P A;  1VZ7 A;  1HA5 A;  4IDI A;  2M56 B;  1ZDX A;  2NTS A;  3Q8B A;  4FZM A;  2JYT A;  2V0G A;  2OMF A;  1KFY B;  1N63 A;  3AE5 B;  4NAM A;  3LB8 C;  3V3X A;  4KGT A;  3MJ5 A;  3VR9 B;  4RF1 A;  3P4Q B;  2QSD A;  3U4E G;  1QQR A;  1BXW A;  1JWS D;  1QOF A;  2KMM A;  2WXL A;  3AA1 B;  3NVZ A;  1SJH D;  1UWM A;  2RDH A;  2YEP B;  3L4P A;  2W80 C;  4BUM X;  1YJJ A;  3SEB A;  2RDG A;  3MC0 B;  2J1N A;  2KZ7 A;  2BT6 A;  2N9K A;  2LHD A;  1I4X A;  2KZ7 B;  1D5X C;  1FRD A;  3VZT X;  1XF5 L;  1TS2 A;  2H88 B;  2MJE A;  5LNK 1;  1D4B A;  3AAE A;  2JZP A;  4XWT A;  3VE2 A;  1JWA D;  3PRN A;  2K5P A;  2L32 A;  2FGR A;  1L4Z B;  4RCO A;  4KR4 A;  4AKR A;  1BXT A;  4WIP A;  2BYT A;  3NVY A;  4XNL A;  3IT6 B;  3K19 A;  2M19 A;  2WDR B;  1JWB D;  2FUG 1;  1GAQ B;  3LK2 A;  3LK2 B;  3PQS A;  3VE1 A;  2BS4 B;  3DA3 A;  2WU2 B;  4HRO A;  2XE3 A;  1MPE A;  3WI5 A;  2JU6 X;  2NTT A;  1SF0 A;  3AE3 B;  2IGD A;  3W5U B;  3DA4 A;  1FM0 D;  3P4P B;  1V8C A;  4O4U A;  1C9F A;  1MPF A;  2L52 A;  1VZ8 A;  2E6X A;  2FBW B;  3KWL A;  3Q8C A;  2F1V A;  2WXM A;  4JPS A;  1TY0 A;  3EUB 2;  4E1S A;  4XDC A;  1B1Z A;  5AFU K;  1ZXI A;  3LK3 B;  1FFV A;  4O1N A;  1L6U A;  3IAS 1;  2Q5W D;  1SBB B;  1IGC A;  5T5F A;  5BMG A;  3ZGZ A;  1SE4 A;  3BYY B;  3NUH B;  2ICI A;  2WDV B;  3SZD A;  4GF4 A;  1FNU A;  2BS3 B;  4B0E A;  2IPK D;  2LHF A;  1XLO A;  2KDM A;  4EE2 A;  4RNA A;  2GE4 A;  1K51 A;  1T3Q A;  2OHF A;  3AMZ A;  4C56 C;  5BMI A;  1E9M A;  1D5Z C;  4XNK A;  2KAJ A;  5ADX K;  3SYB A;  1AYF A;  4ZRP A;  3TEX A;  2IGG A;  1Y56 A;  1THQ A;  2JX5 A;  1QIL A;  1MVK A;  1EU4 A;  4Q2J A;  1PGB A;  3ZJV A;  5G5G A;  3AE9 B;  4RL9 A;  3PQU A;  1JWM D;  1XO3 A;  2IGH A;  4G75 A;  3TUO A;  3B2G A;  1XXG A;  2FGQ X;  1N62 A;  2KAC A;  2K4T A;  3SFD B;  3AA7 B;  4YXD B;  4G76 A;  2Z8L A;  1SSN A;  2WP9 B;  4C7Y A;  1FXA A;  4AYD C;  4C80 A;  1P7E A;  3ETR A;  3AE1 B;  4DQO C;  2XNA C;  4A8X C;  4L1B A;  3OWE B;  1SIJ A;  2IDY A;  1BML C;  2J53 A;  2WS3 B;  4FXC A;  2L83 A;  3FYX A;  1FMA D;  2J4U P;  1F77 A;  4OW0 A;  4D2K A;  2BB6 A;  1TKE A;  4L2Y A;  2N2L A;  3VY9 X;  1I4P A;  1XEE A;  3N9Y C;  3P4R B;  2ACZ B;  2AQ1 B;  1TS5 A;  2WXO A;  4YTP B;  1CK1 A;  3A2S X;  1JW9 D;  3PO0 A;  1FFU A;  3T3O A;  3AE6 B;  1RWS A;  5AFU L;  4C7Z A;  1OPF A;  1QKZ A;  2MHL A;  3I57 A;  1I4R A;  3UPG A;  4USA A;  4HKQ A;  1CZP A;  3CWI A;  1JML A;  1ESF A;  2JSV X;  2Y5C A;  2XG6 A;  3HW9 A;  2JXT A;  1OQQ A;  1SEB D;  1PFD A;  1G90 A;  3AH7 A;  1C77 A;  5FK9 C;  1JQ4 A;  2W3R A;  4GCQ A;  2QEJ C;  2MH7 A;  5C3J B;  1WXQ A;  1WSP A;  1BUI C;  3AA0 A;  2CJN A;  3V05 A;  5GV0 A;  4YT0 B;  4FZN A;  5ADX L;  2GB1 A;  4KGR A;  4B0M A;  4LSH A;  1SE2 A;  4KKI A;  2QIL A;  2EEL A;  3R8B A;  3H8H A;  2J42 A;  1OSM A;  1T6B X;  4AZL A;  2NMQ A;  1UWX A;  2AQ2 B;  1K50 A;  2H89 B;  4JCH A;  1UUP A;  1FEH A;  5MPO A;  2WXQ A;  3EGR A;  3VRA B;  2X27 X;  5HFY A;  3TEZ A;  2RMM A;  4YSZ B;  4O49 A;  1M4V A;  2J52 A;  2XTQ A;  2DLB A;  4A55 A;  4RF0 A;  1YNT E;  1L6V A;  3AA1 A;  2PVG C;  4O3Y A;  1KRH A;  3KQ4 A;  1NYQ A;  1MHH E;  4MH8 A;  5DL6 A;  1N5W A;  4H2A A;  4JX1 C;  3POX A;  4FOZ A;  1GB4 A;  3IXS A;  2LUM A;  2HTM E;  1UGJ A;  1J7C A;  1ZDV A;  2PMV A;  3TEY A;  3Q8E A;  5H8Y E;  1UNS A;  4U9C A;  2BS2 B;  2KDY A;  4OZC A;  3VY8 X;  4R3D A;  2YEP F;  3SYS A;  1E7P B;  5H92 C;  1GFN A;  2KXP A;  2VZK B;  1DGJ A;  2KXP B;  2BB5 A;  3BVZ A;  3T24 A;  5FVN A;  3VZU X;  1V97 A;  1FRR A;  3NZ3 A;  1MI0 A;  3KVD D;  4F4B A;  2KN4 A;  3AB5 A;  2PLP A;  1YS5 A;  1ZXH A;  1XLP A;  1GFP A;  1L0X B;  2WXF A;  1TS3 A;  4UDU C;  1EM7 A;  3W1S A;  4A9A A;  2XE5 A;  2LGI A;  1JRP A;  3GP7 A;  1P7F A;  3SFE B;  4AYI D;  2POR A;  1ENF A;  3LK4 2;  3FC4 A;  4ZYS A;  3POR A;  4MAC A;  4FRX A;  2TSS A;  1Q9G A;  3QRC A;  4AYM C;  3HRD D;  1PYW D;  7PRN A;  4ITK A;  1QJP A;  3LK3 A;  3WI4 A;  2K0P A;  3W5V B;  3RPF C;  3NVV A;  3ABV B;  1WGK A;  3U7Z A;  4LSF A;  4IOI E;  5DL5 A;  1FXI A;  1N60 A;  1J7A A;  2N9L A;  3SZV A;  1ORM A;  1A70 A;  1YMH E;  4J3O D;  3AEE B;  1VZ6 A;  2M06 A;  1SB3 C;  2V4I B;  1YN5 A;  3P4S B;  3AE8 B;  4NZL B;  4CQN A;  2ZLD A;  2XMX A;  1QOA A;  4N6E B;  1PRN A;  4MT5 A;  3G7G A;  1C4A A;  2WXK A;  4RH6 A;  4RGN A;  4PT5 A;  1QJ9 A;  3E9S A;  5G5H A;  1CQV A;  1FNW A;  3CIR B;  5EE9 A;  3R2I A;  1QOG A;  2ONQ A;  4GHB A;  5DL8 A;  2X38 A;  3VR8 B;  1N61 A;  3SR6 A;  4TQ0 A;  3ZJU A;  4AYN A;  4TQ1 A;  1FNV A;  3AEG B;  5EE2 A;  5D3D A;  3AA7 A;  2DYO A;  1GPX A;  5FR3 A;  2Y0L A;  4XDD A;  8PRN A;  5EE0 A;  2WLB A;  3PZ8 A;  3JTY A;  2DWQ A;  1VRA B;  1J7B A;  4HJG E;  3V8U A;  4FMS A;  4AS1 A;  3P63 A;  4JWU C;  2W3S A;  1V1P A;  4JFB A;  1PGA A;  3IAM 1;  4GLS C;  4DXF A;  1V1P B;  2RPV A;  3AE7 B;  1YQ4 B;  2PRN A;  4TSS A;  1C79 A;  4XWW A;  1F0Z A;  2Y0K A;  4KKJ A;  1F2R C;  2Y7S A;  4O3X B;  1ZPS A;  4D64 A;  2FE8 A;  2N7J A;  2OED A;  4US8 A;  3RFZ B;  1KH0 A;  1XLQ A;  2PTL A;  5TSS A;  3ZYY X;  3U52 E;  2WNM A;  1TKG A;  4C69 X;  1GFQ A;  4M0W A;  3W2D A;  1QOB A;  2MJ3 A;  1GB1 A;  3AA6 A;  4RGT A;  3FAH A;  3BII D;  2AX5 A;  3AA6 B;  1MHX A;  4LTU A;  4YTM B;  1PHO A;  2L1A A;  2JMM A;  4RLB A;  1QT9 A;  3E56 A;  3MP9 A;  2O4V A;  1AW7 A;  3QRA A;  2ZW0 A;  1HZ6 A;  4JE3 B;  4YTN B;  4JWS C;  4LSE A;  1SXT A;  3BVG A;  2WQY B;  2LJI A;  5D5D A;  2W55 A;  3DWG C;  4AFK A;  1YN3 A;  1WWT A;  2R61 A;  4LK0 M;  1I4H A;  2AQ3 B;  2MJD A;  4O3Z A;  1JRO A;  4B61 A;  4ZOH C;  4AUI A;  2JYE A;  2PVO D;  3GP6 A;  2PIA A;  1VJK A;  4FSP A;  3VRB B;  2MNH A;  2CU3 A;  1HXU A;  3AEF B;  1EU3 A;  2XTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...