4N59A

The crystal structure of pectocin m2 at 2.3 angstroms
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
270
structure length
262
Chain Sequence
ATYKVKDVTTGAEIEVPDDKYILDEFEKQGVNLPYSCRAGACSSCVALISSGEVDQSDGSFLSEKQEKKYILTCCSYPKSDCTIETGYEDKILEDFEIELAETGLEFFNDLKDSLPRSGEILSGVTAPFEAFDHYLFGNGVERSININDVGFNINVSQIPPIMSLLNGKNVGRFDIGSDFVRNTALDGYSVAAYLGNITMRTEGVLNVKSDGTWQYEGVIRSYNDTYDANPSTHRGALGEWSGTPYEIRIPGELKIKENGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the atypical bacteriocin pectocin M2 implies a novel mechanism of protein uptake.
pubmed doi rcsb
source organism Pectobacterium carotovorum subsp. brasiliensis
molecule tags Hydrolase
molecule keywords Pectocin M2
total genus 78
structure length 262
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF14859 Colicin_M Colicin M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.140 Mainly Beta Beta Barrel Porin Porin 4n59A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4n59A01
1FRDA 1XLQA 1B9RA 4FZLA 2PIAA 2AX5A 2QJLA 1J7AA 1E9MA 2W3RA 3W9CB 3WCQA 1TYGB 1PFDA 4YSYB 1KRHA 5C2TB 1N5WA 1RFKA 2JX5A 2MJDA 3NVYA 3P4SB 5C3JB 1T3QA 3HVZA 2H88B 1ZOYB 1L6VA 2G1EA 1DGJA 2M19A 3AE4B 2W54A 3AE9B 3DWGC 3AEFB 4C80A 1FO4A 1ZUD2 5G5HA 1JWBD 1VDVA 2MJ3A 1YJIA 4WWMA 5EE3A 2WS3B 1TJEA 1FMAD 4YSZB 3AEBB 1XO3A 3ZYYX 1AYFA 2N0SB 2MJEA 3AB5A 3AEDB 3AM9A 3P63A 4JWSC 4YTMB 3CIRB 3KWLA 1E0ZA 3AECB 3DA4A 2DWQA 3ABVB 1JWAD 3AE3B 1QOFA 1E7PB 1FXIA 1GAQB 5AUIA 1FFVA 3AEEB 1YQ4B 4FZMA 4FXCA 2MH7A 3FC4A 2K9XA 4N59A 1JRPA 1YQ3B 3DA3A 1KF6B 3AH7A 4YSXB 1FIQA 1ROEA 4YTNB 1R7SA 3AEAB 1FRRA 1TKGA 3ETRA 5AUKA 1EWYC 4P6VF 2L83A 2WQYB 1WWTA 3HRDD 2XMXA 1DOXA 2WP9B 1OFFA 2PVOD 1L0VB 2PVGC 1XLNA 1JW9D 3B9JA 1SIJA 1UWMA 2XTQA 3LXFA 2W55A 3VR9B 1QOGA 4ZHOA 1NEKB 1SB3C 3AE5B 3AE7B 3NVVA 1N5XA 1FFUA 2M56B 1CZPA 5MPOA 1TKYA 3NRZA 2XTRA 2K5PA 3NVWA 1NYQA 1RYJA 1ZP0B 2HTME 1WXQA 3B2FA 1L6UA 1FM0D 2WDRB 3B2GA 5EE0A 1AWDA 4IDIA 3SFDB 4A9AA 1F0ZA 2WU2B 3AMZA 2CU3A 3RPFC 4HROA 4ITKA 1DOIA 4G75A 1L5PA 3P4QB 2Q5WD 2LEKA 3SFEB 1A70A 3EUB2 1N60A 1QOAA 1E10A 4HRSA 1QOBA 3LB8C 1IUEA 2BT6A 4N58A 3W5VB 1RM6C 1V97A 1N61A 4LTUA 4YXDB 2Y5CA 2KMMA 1VJKA 1VLBA 2PKOA 3DWMA 1WYGA 1NVID 2OHFA 1DOYA 2L52A 2QIEB 3AEGB 2BS3B 2WDVB 3HUIA 2CJNA 5GXGB 1V8CA 2WU5B 1JROA 3P4PB 1JALA 3P4RB 4JX1C 1NI3A 2BS2B 2FBWB 1OQQA 1WRIA 1ZXIA 1YJJA 4KX6B 3AN1A 3VR8B 1RWSA 5G5GA 1NYRA 2DBYA 2H89B 1E6EB 4YT0B 2B76B 1KFYB 1GPXA 2CJOA 2EKIA 4USAA 1N63A 1TKEA 2WDQB 3AE6B 1PUTA 5EE1A 4C7YA 4ZOHC 3VRBB 5H8YE 4YTPB 5EE9A 4US8A 1QT9A 3L4PA 1WGKA 3FAHA 3AV8A 1XLOA 3NS1A 4WQMA 4G76A 1FXAA 1QLBB 1I7HA 2JQRB 3AE1B 4N6EB 5H92C 3P1MA 2WLBA 3CWIA 3VRAB 1QF6A 4C7ZA 2KAJA 1JQ4A 1N62A 4JWUC 1XLPA 1PDXA 1J7BA 1OQRA 3NVZA 4FZNA 2BS4B 1CJEA 1NENB 3AE2B 2W3SA 4ZHPA 3BIID 3W5UB 2E3TA 2K22A 4US9A 3PO0A 3AE8B 1SF0A 2ACZB 3SR6A 1J7CA
chains in the Genus database with same CATH superfamily
1R4MB 4IWPA 1STEA 4R3DA 3WCQA 2Y5PA 2VZKD 1C9FA 4IM0A 1GFNA 1WM2A 3B1LX 1T0YA 4FESA 1N6ZA 2MQJA 3I3TB 1FMAD 5DPWA 4RM9A 5G3AA 4KSKC 1AYFA 1GFPA 3LK42 3AEDB 3U52E 3TUOA 3Q8BA 3DBHI 1GAQB 3L13A 3VTVA 1HE8A 1SE2A 3DHHC 2IY0B 4AFKA 4GCPA 4XDCA 1JRPA 3VAWA 1FIQA 2N1VA 2FIFA 1EWYC 3RCZA 4I6PA 1V86A 1ORMA 2Z0DB 3MC0B 1P9DU 1R4NI 4PT5A 2K5PA 1L6UA 3JYUA 3TSSA 2NS5A 1CMXB 3PRZA 4J3OD 1C4PA 2ONQA 4HRSA 2BT6A 3VE1A 3MHSD 2M07A 4WH4A 4EZJA 4CYEA 1ACCA 3DWNA 5J17A 1GG3A 3RNCC 1K8RB 1UH6A 3P4PB 3DBHB 4NAWA 1TS4A 5FKAC 4YT0B 4KGTA 4K81A 3U2SC 1V49A 1TKEA 2K0PA 3CF6E 3BVMA 4YTPB 5DL8A 5FR3A 3URYA 3GP6A 2BYEA 4W9GA 3MC8A 2IGHA 4RLCA 3BYTB 3WU2O 1SSNA 1N62A 5CX3A 1XLPA 3GE3C 4XYCA 4FT6A 4BUMX 5B5EO 2E3TA 2W80C 4FADA 2F1CX 4W9EA 3UIPB 4HJKA 4YSYB 1T0SC 5D3IB 2J52A 2MW5A 5BYRA 2LGYA 4M0WB 5BYQA 2KFKB 2V9HA 3HM6X 3IG3A 4RGMA 4TMAB 4GOCA 2A5UA 3AE9B 3UQBA 3DWGC 4O1NA 2IYDB 4K3CA 2N9EB 2KVRA 4LLGM 4Z3TA 4XE0A 3HM3A 3T3OA 3QCAA 2REXA 4O49A 4L2YA 4MACA 1JWAD 2OJWA 1YQ4B 3IHPC 4HK2A 1TT5B 3EECA 3C8YA 4RGOS 4LCDE 2YLMA 3NZSA 3AEAB 4KIKB 1WJNA 1HXYD 1FNUA 3A0BO 3DBRI 3OJ4B 2LVOA 5TR5A 1TS2A 1SB3C 1WMHB 3QJZA 2AQ1B 3WIMA 1V1PB 1WI0A 4MSQB 4RL9A 1UGMA 3SDLC 2VZKB 4DQOC 1LFDA 1VCBA 3NZ3A 4UDUC 1X1MA 1Z2MA 2CU3A 1DOIA 4G75A 2ERVA 2WXQA 5KAIO 1WYWB 4W9DA 3AA0A 3N9YC 2FCMA 2KWVB 4LSEA 2PORA 3RBHA 4HPMB 4AZLA 1PGXA 3A9KB 4JX1C 4O4UA 1JALA 4W9CA 3E9SA 2WHIA 1HXTA 4BKSD 1GB1A 3C19A 1WGDA 2UWQA 4KV2A 4NZLB 3CWIA 1EF5A 3KYCD 1JQ4A 2KWUB 1J7BA 2BS4B 2D3BA 1JWUD 5CHVC 2DZIA 2V0GA 2KTRB 2W81C 4PUXA 1WF9A 2JWUA 1ET6A 3TL5A 1GFOA 4PYUA 1XF5L 1KJTA 1SXTA 4OHJA 4FLHA 1BXWA 4TSSA 2MP2B 3BVGA 3UINB 1Y56A 4RLBA 2PW9A 4FJZA 2LXAA 3R2TA 1KLUD 5JH5C 4YSZB 4XZ4A 3QC8B 4LJOB 1V1OA 1E0ZA 4J6IA 2KJRA 1E54A 4L1BA 1PGBA 2LGSA 3FKYA 1FPYA 3M95A 4F1SA 4REZA 3U7DA 4LNKA 3ZW3A 2QDFA 1QQRA 3BZDB 2R2QA 1YX5B 2FUG1 2J0JA 2ZCBA 3ETRA 2IBIB 1OFFA 4ANXA 2CKHB 3A4RA 4GF4A 3AA6B 1I35A 1TS3A 4FQEA 3ZXVA 1CZPA 1TS5A 3VZTX 1FCLA 2O2VA 4EOYA 2Y3AA 3DZMA 1F0ZA 2OMFA 3P4QB 1OSMA 4MH0E 2Q5WD 3ZNID 4PYZA 2WXFA 2ZNVC 2L7RA 2JXXA 1SE3A 2N2MA 1M94A 2OHFA 1WXMA 2WJQA 1KTKA 2NCNA 3O0EA 2CJNA 5GXGB 2KWCA 3N20C 1WGYA 2CHZA 2MBEA 2EKIA 3MHZA 4P16A 3MC9A 3AE6B 3IBEA 3TIXA 2I1KA 1QT9A 2AEHA 3I63C 5KHOA 5EDSA 1I7HA 3PS6A 4O3ZA 3AAEA 3WI4A 2M17A 2KACA 4KR4A 3T24A 4AS1A 2WXKA 5DL7A 1PRNA 1ZHWA 5JHAA 1V6EA 4GCQA 2PTLA 4X57B 2ZPNA 1EUVB 4EE2A 2R8AA 3EFCA 3TBLD 2R61A 4FJYA 1T1LA 3LK3B 1SEBD 3BVZA 2JU6X 7PRNA 5HG2A 1V9JA 2IPKD 1T3QA 1QJ9A 3IVFA 1AW7A 1D6EC 2DYOA 2LI5A 4C4VA 2LGXA 3GS2A 4DXAB 1YX6B 3TEWA 2G4SA 4MJSB 2KJHB 2DAJA 3NY5A 2D11A 1IZNA 1BXTA 5HKHA 3CIRB 2IO0B 1PGAA 4RCOA 1PYWD 1VZ7A 8PRNA 1T16A 4G11A 4NJ7A 2XE3A 4OVZA 4RH6A 2WNMA 2XMXA 2PVOD 4BOZB 4K1RB 2C7HA 1IBXA 3PLVA 1QOGA 3Q3FA 1U4AA 3PTFC 3DVNV 4IUMB 1C3TA 4XNLA 3ONSA 2BTEA 2XE1A 2WX1A 1XT9B 2KC0A 4TKNA 2PE9A 5IO9A 3LB8C 3E56A 3PGRA 4ASWC 1S1QB 1IGCA 3GE8C 4GDKB 2ZPYA 3H9DA 1MJDA 2CR5A 2NR2A 1YJJA 1J0GA 2B76B 2G45B 2BWFA 3X23A 3K19A 3A9JA 3Q3JA 4ZYSA 3PT2B 3AV8A 1YD8U 3WAOA 5IP4D 5H92C 2KKCA 3PRPB 4BKTA 2EELA 4FN2A 3HOLA 1Q0WB 2INDC 2WJRA 2VH2A 3QHTA 1Y8RC 1MVKA 2E6XA 3U4EG 4N74A 2XEWA 2WXIA 1CJEA 1NENB 4AYNA 1MI0A 2L05A 5L83A 4ANWA 2M8SA 1UD7A 2L32A 1WH3A 2PIAA 3RYTA 5IYUA 2ZW0A 2FGRA 3OG5A 1KRHA 5C2TB 1I42A 4FRTA 4B0EA 2NBVB 4ZRQA 3UPGA 2J4UP 4HPLB 4BBNF 1I4RA 2QHOA 3RI7C 3GB1A 4LDTB 1V2YA 3OAWA 2D3AA 4CHKA 2SAKA 1HTQA 2FCNA 2LFUA 4G3XB 2Z8LA 2IWWA 3SEBA 2J4XA 4QQ1A 2VRRB 1K51A 3PREA 1E7PB 4C4VB 1ZGUB 2INPE 2R4PA 1KM7A 1ROEA 2RDGA 4GXBA 1ESFA 3Q3NC 3VXWA 1V5OA 5ADXK 1TGZB 3A9KA 3V60A 1MM4A 2AL3A 1L0VB 4ZHOA 3B9JA 1SIJA 5HFYA 5B66O 5IA7A 2BB5A 1YNTE 3EHVA 1FM0D 2K0LA 3SFDB 4FJVB 4HCPB 3PGSA 4HROA 1J8CA 2IO2B 3TJPA 4M0WA 1RM6C 4CQNA 1XD3B 2BF8B 1NDDA 2WDTB 2R88A 4NAMA 2AL6A 2N7EA 3BRYA 4RF1A 2DZKA 2BS2B 2J0KA 3SD5A 4HVBA 4ZDVA 4AUQC 2JZPA 4ZYNA 3IAS1 2NBWB 4DHJB 2KFKA 3KUDB 1TIFA 4IC7B 1V81A 3AU5A 1VZ6A 2KX3A 2ZW1A 3TEXA 4G76A 2JQRB 3A2SX 2LD9A 3ECIA 1WXVA 3VRAB 3T20A 3EGRA 2GE4A 2KAJA 1GC6A 4JWUC 3QA8A 1T5XD 3KYDD 1TY0A 1MHHE 2D2QA 1V80A 3SR6A 4BZAA 3QX1A 1N5WA 5CHWA 1ET9A 4KIKA 1S3SG 2G1EA 4FA6A 3VZUX 1YMHE 2HJ1A 3KZIO 1ZUD2 1F2RC 2O6VA 2LHDA 4M8NA 5DPTA 3AEBB 3W2DA 2G9HD 2XNAC 3ZNHB 3JSVA 3WI5A 4BKGA 2IY1B 4UB6O 4FMSA 3AEEB 3T3NA 5E6NA 1KF6B 1YQBA 1ZKHA 3ENEA 3ZKJC 3LK2A 4C69X 5AUKA 2GBNA 2L83A 4KDIC 4HXDA 2PJHA 4ANUA 2I2YA 3V6CB 2KXJA 3KUCB 2NBUA 1JW9D 1N5XA 2IDYA 2C9WB 3NRZA 1IGDA 2HTME 5AZGA 4IDIA 2JXTA 3AAEB 3PQSA 4ZRKA 3V6EB 2KMAA 4D5UA 3W1SA 2QCZA 4C00A 1VLBA 4WJNA 1KH0A 1DOYA 3SHQA 3HUIA 2HD5B 3EA6A 1KLGD 2RR9A 4FHKA 1EU4A 2YVCA 5IOIA 2OEDA 2MP2A 2MBHA 4B0MA 2XG6A 2NPTB 1XCTL 3FAHA 2GBMA 1F1HA 4FSOA 1QJPA 4WQMA 1QLBB 4O4XA 2KT7A 5DCNA 3L0WB 3WA0A 4G50A 3ZO5B 4MGZE 3VFKA 2N9KA 2ZZPB 4XNKA 2J53A 1Q10A 2YPVA 3WANA 4OZCA 2IO1B 2BKRB 4B9KA 4IG7B 4A3OA 1RFKA 2KOXA 1PHOA 3Q69A 1ZOYB 4H2AA 1VDVA 2D5GA 4W9FA 2WS3B 4LSIA 5E79O 1SJHD 2KDEB 1XO3A 2V4LA 3ZYYX 3RNBC 2MJEA 3PGEA 4WAFA 3R3MA 1B1ZA 3ABVB 2L76A 4DHJD 2BBCA 4FZMA 2PPHA 3KLSX 2PE6B 3H7PA 2Y0KA 1ZHTA 3BS0A 4FXCA 1E8WA 1CQVA 1P98A 1UNSA 1QZEA 3S2AA 3V3XA 5E6JA 1FRRA 1TKGA 2JZ3B 4HJGE 4I6NB 5DPSA 2Z59B 1MHXA 4C56C 2HJ8A 4DK5A 3R7QA 4HPPA 3JSVB 3CSTA 1NYQA 3H1UA 1QILA 5D5DA 4A9AA 1F52A 3VHTC 4F7ZA 1WR1A 1YN5A 1J19A 4WWPA 1V97A 3N1ZC 2BS3B 1A5RA 2A4ZA 2MNHA 1NI3A 2FBWB 1OQQA 1ZXIA 2KMCA 1WGGA 2FGQX 4RGTA 2DBYA 2AWTA 3LK3A 4K3BA 1WRDB 1WX9A 4URKA 4AYDC 1WGKA 1P3QU 4XX5A 3TZGA 1C78A 1P7EA 1F2RI 4O3YA 2R4OA 4JPSA 3P2BA 4EKUA 2ODJA 2LZ6A 3PSEB 2J42A 1GFQA 2FAZA 4JE3B 1E5WA 4ZHPA 5J18A 5GV0A 3BIID 3W5UB 1BT0A 2LXCA 4JIOU 1FNWA 1Q5WB 2N4FA 5KAFO 3T9LA 5PRNA 4MM3A 1J7CA 2DENB 1D3ZA 1E9MA 1LQBA 3ZRFA 2KHWB 2JRHA 3U30A 3A0HO 5I4DA 4FULA 3I9V1 1TTNA 4II3B 3DHIC 3RD2A 1DGJA 4XGAB 4C80A 1I4PA 1YJIA 5EE3A 4AP4C 2KJ6A 2O6VD 4LDTD 2MHJA 2WVPA 4JWSC 5IN7A 2DWQA 3AE3B 2QSDA 3QARA 1FFVA 4GMVA 2R2OA 4F8CB 1UBIA 3Q3OC 4MELA 1HXUA 2PRNA 1EU3A 4GDLA 4GSWA 4E1SA 4JGHB 3APFA 1QJ8A 2BKFA 3R2IA 3WAMA 2I1JA 4GHBA 2V1YA 1MPEA 4PS8A 3B08A 3JVZX 3PPAA 2XTRA 1SBBB 3GP7A 1ZPSA 4DHZB 1ZW7A 2O4VA 3SYSA 2Y0LA 2WXNA 2XBBC 1L5PA 3KH0A 1H4RA 3ZNZB 3H7SA 2X27X 3VY9X 3PZ8A 2Y5CA 2EMSA 1UGJA 1WYGA 1L4DB 2WDVB 3VY8X 4JL9A 3AA0B 1HZ5A 4WJOA 3RNAC 3P4RB 1EO6A 4KX6B 3RN9C 1RWSA 3HIZA 1E6EB 1KFYB 1GPXA 5BMIA 2GLSA 1UF0A 4QAYA 2ON8A 2WGSA 1RAXA 3VRBB 2ZEQA 2N2LA 5LXIB 1ENFA 3RULA 3P1MA 2JF5A 2KN4A 4GB9A 3RFZB 2Y7SA 3O13A 5G55A 2W3SA 1WGHA 2DZMA 3K9OB 4US9A 2LRUA 3PV1A 4GU2A 1WXSA 3DBSA 1LM8B 1BMLC 5C23A 2GBKA 4IWQA 1D4BA 1XXGA 1JWSD 2KX0A 4O3WA 2NPTA 1VR9A 3KQ4A 2DAFA 3AEFB 4OVVA 4MM3B 2DYBA 5BO4B 3O65B 4NY0A 4A90A 2K3UA 2N0SB 3ZNGC 2WXHA 3P63A 1GNUA 3ZDMC 3MTNB 1OGWA 2IO3B 4B95A 2MBQA 3Q2AC 2D3GA 2Z0EB 2NTTA 2JWZA 1FNVA 1AN8A 2LASA 1I4HA 2MA9B 1GJZA 5E6PA 3Q3MC 3HRDD 1P1AA 2WP9B 5D3DA 4AYMC 2RDHA 1XLNA 3NVVA 3VDZA 4GN1A 1SJED 3DVGX 3NVWA 2DLBA 1E7UA 4BOSC 2WDRB 3B2GA 1AWDA 3H7PB 3SYBA 5AFUL 2LHFA 2KD0A 3POXA 3SFEB 4MSMB 1H8CA 4MGYE 3VTUA 1QOBA 4KDLB 4ACFA 2XN9C 1UZXB 4LTUA 3AAAA 4AKRB 4D64A 1VJKA 2KMMA 4LJPB 1YJ1A 3L16A 2KXPB 2GOWA 1TBEA 3G7GA 2INCC 1V8CA 3NSGA 4JFBA 1RLFA 1TZOA 3UQAA 1WRIA 1D5ZC 2LUMA 1E7VA 2NMQA 5FR6A 2R4NA 4W9JA 3L4PA 2RGFA 2WXMA 3BINA 4RFBA 5FK9C 3PRNA 3NG0A 3V61A 1PDXA 1E8YA 2FIDA 2JYTA 4FBJB 5G2NA 4E3CA 3Q14C 3ZIMA 2ACZB 2QMTA 4AJYB 3C5OA 2AX5A 1EWCA 2BQQA 2JY6A 2V3NA 3EC8A 2FE8A 2MWSB 2MJDA 5C3JB 3LK2B 2WYQA 4NJ6A 1L6VA 4GGQA 3QAQA 3BK2A 4M01A 4A55A 3ML9A 1XEEA 4HKZE 5G5HA 4W9IA 3JCUO 1Z5SB 2PLPA 3A4SC 4MEMA 1TJEA 4IM3A 4W9HA 5AZFA 3AU4A 4BAXA 3AM9A 4GIVA 2KYWA 1UBQA 2MSED 3MJWA 3AECB 4M00A 3RNGC 4AKMA 4MJSA 1WY8A 3VTWA 4PS7A 3PRMB 1NBFC 2LGIA 2KN5A 4TUUA 2C5LC 3PZ7A 1L4ZB 3POQA 3ZJVA 2WQYB 1S5LO 2EKEC 3FILB 1YIWA 2JPHA 3LXFA 3BYYB 4OZBA 3NZUA 3LJ3A 5GMVA 1MG8A 4DWFA 4D65A 3RT3B 4L23A 5JHBA 5AZHA 3ZLZA 1A70A 2N9LA 4PK1A 1E10A 3ZTDA 2RPVA 2M4NA 4YL8A 3ZDTA 4F4BA 1YN4A 5G39A 1NVID 2IGGA 5HI1A 3FYXA 3HVDA 4S0RA 1YN3A 3UF8A 2WU5B 5D7GA 4DBGA 2F1VA 3VR8B 4KSLC 5G5GA 1NYRA 3OJ3A 3C0RB 2XK5A 3KW5B 1N63A 3AAAB 3LDZE 4ARIA 1XCQL 1L0XB 2KXPA 2N7DA 1C1YB 3VUXA 1K50A 1SE9A 3A9JB 3VVWB 2F1TA 1T0RC 4C7ZA 6PRNA 1WZ0A 2ZVNA 3N32A 4AOFA 2ZNVB 2N9PC 3HHMA 1ZE3D 3NHEB 5ADXL 3DBLB 4GDLB 2DYMA 2X9KA 2LJ5A 2JYEA 5L95C 2H88B 1FD6A 3DVNU 4KKIA 4AJWA 3AA1A 1JWBD 2O6VB 2ZVOA 2TSSA 1E8ZA 3N1XC 2WXOA 5H2FO 1LGRA 2D3CA 3AB5A 1NI2A 2X38A 4E74A 4MGKE 1FXIA 3ZUNA 4E71A 1GFMA 4FUVA 2R4LA 3PQUA 3DA3A 3AH7A 4OZAA 2MBOA 2MBBB 1R7SA 3UI3A 2KVZA 2I38A 2DX5B 1WM3A 4P6VF 4S17A 5DPRA 2LFIA 3SY7A 1QKZA 1MG4A 1UWMA 5C1ZA 1NEKB 3DPDA 1V5TA 4O3XB 3V8UA 3D32A 1TKYA 1MM5A 1RYJA 1WXQA 3ZQ4A 4MGIE 3T0SA 3RPFC 4ITKA 1WJ6A 3SZDA 2M1MA 1QOAA 2KDFB 2LGDA 1IUEA 1C4AA 1Q9GA 1GUAB 2JMMA 1OEYA 4KGRA 1WGRA 1WXAA 3DWMA 3K9PB 2IWVA 2QIEB 1G90A 4HDQA 1ZXHA 4LNNA 4MH8A 4WWNA 3CMMB 3OLMD 2K6DB 2K8HA 3Q8CA 5IAAC 2WDQB 4C7YA 1PUTA 1RFAA 4ZOHC 1THQA 1BUIC 2M06A 3ALBA 1WE7A 3KVDD 3Q8AA 3KVFB 2K6QA 4AKRA 2K39A 1QF6A 4B6WA 3M3JA 3DQVA 3W1SC 4AYID 2O2VB 4FZNA 1ZDXA 3RMKC 1IP9A 1T6BX 2OJRA 3LK41 3N3KB 3IFWB 2KDYA 3QWZB 1C79A 1VZ8A 3IT4B 3B0AA 2EMTA 3PGUA 2LMCA 3AA7A 1ZHXA 3AE4B 4JCHA 4BBNC 2KTFA 2MJ3A 2WXRA 3PZDA 4HWIB 2FNJB 4XWTA 2L0FA 5JXVA 2GB1A 4HKQA 1HQRD 4ZRJA 3KWLA 1MPFA 2DHZA 4M8MA 1QOFA 4A8XC 2RDBC 2K25A 2BW2A 2M0AA 2V3SA 4U9CA 4D2KA 1IYFA 5D94A 1WMHA 2KANA 2K8CA 1ZHYA 4A3PA 3AXCA 2QC8A 2RPQA 3ZXRA 3T8MA 2WXJA 1BH3A 1F77A 1FFUA 2DZJA 2QEJC 3MFGA 1LXDA 5LLIA 3GZNB 1MFWA 3RUIB 3PVLA 5HHDG 1VD2A 3AMZA 4NNJB 1UELA 1HZ6A 3EUB2 3X0WA 1ISNA 1N60A 4IWOA 4LNIA 1FEHA 3POUA 4WJQA 3W5VB 3ZVVA 5AFUK 3PF1A 4OVUA 3DOWA 3N1YC 1M4VA 2LVPA 2L52A 3WAPA 2XE5A 4WQOB 2NTSA 4LNOA 2KNBA 3M63B 4MDKE 2IZVB 2B3AA 4USAA 3HK0A 2SEBD 4XC2A 3A1QA 3ZJTA 1GC7A 2CHXA 5EE9A 1KLVA 1OEYJ 1T0QC 2WXPA 1IBXB 3AE1B 5IKCM 1HTOA 1TY2A 2C60A 3EMNX 2KTRA 4ICUA 3RNEC 1OQRA 4RNAA 2MRPA 2KDIA 4HEA1 1IPGA 3R7RA 3GZNI 3FC4A 3AE8B 1I4QA 3PHWB 2ICIA 1OQYA 2KZ7A 5TISO 4W9KA 3PORA 3BRZA 2BYVE 3R8BA 2AYOB 2BB6A 3MJ5A 2J7QB 2JSVX 4ANVA 4GDKA 1C4CA 1WSPA 4RMAA 1WR6E 2MCNB 3GOEA 2FCSA 4RJXA 2D07B 4KZCA 2J0MA 4JQWC 3UAQA 3DA4A 4LSHA 4NQLB 4ARCA 2MH7A 1YOVB 1H6S1 5GTHO 5EE2A 3AA1B 4EZLA 2ZFGA 3H8HA 2V3PA 1Q9FA 4GLSC 3ZTCA 2UU7A 1I4XA 3TCAA 3VH4B 4A20A 2PVGC 1B9RA 2W55A 3AE5B 3AE7B 3IXSA 2BYTA 4P1BC 2L0TA 3B2FA 4AUIA 3VQIA 3NJTA 4CO7A 1BT9A 2UYZB 3VUYA 1WIAA 3RZFA 2X8XX 2KC2A 5BMHA 4YXDB 1JRUA 4HLEA 2L1AA 4YWGG 2PKOA 4ICVA 2C7NB 4GCSA 4WWOA 1WE6A 2KQ4X 1WJUA 2D10A 4Q2JA 2H89B 1G6JA 3QRAA 3ML8A 4KVGB 2BWES 2KC1A 1AARA 4IKGA 3NVZA 5GTIO 5G38A 3CSFA 3PHXB 3MP9A 1R4NB 2RD0A 2K22A 1GB4A 4TV3A 2KFJA 4EFOA 5DL6A 2QJLA 3W9CB 2W3RA 3DHGC 4K7SA 1SGHA 3DDCB 1PFDA 2G4DB 4NJCA 2JX5A 3P4SB 2CU1A 4FOZA 5J2RA 2M19A 2L8JA 3FILA 3HOEA 2MLBA 1I4GA 3ZRCA 4AYEC 1RRBA 1FXTB 4DXGA 4EUTA 4BVUC 1DYQA 2K1FA 3N30A 2XK5B 2KDMA 1YQ3B 3M62B 1UWXA 4YSXB 3L10B 4EZKA 4XDDA 1WWTA 3TEYA 3I57A 4AQ7A 1DOXA 3AA6A 2BYFA 2PMVA 1FCCC 1D5MC 2NVUI 2Y5BB 2FUHB 1C76A 1F9JA 2M56B 3UGBB 2LJIA 3L17A 4KRAA 1YS5A 3R66C 4WJPA 2AXTO 3DBLI 4RF0A 3V62A 4KR8A 4HDOA 4IOIE 2HDEA 4BKSA 1GOZA 3NOBA 1XQQA 1K53A 2BGFA 4JLCA 4K7WA 1L7YA 5T8IA 4I6LB 2ZLDA 2FCQA 2N9XA 2OOBB 2JZZA 4IW0A 2QTKA 4WURA 5BYSA 5EE1A 3APCA 1L0YB 4DDGD 4DDID 5E6OA 5G26A 2KQSA 2GI9A 2JVCA 4LNFA 1HXXA 2C7MB 1SIFA 5CTRC 1V1PA 2WXGA 2J1NA 1JMLA 2RSUA 2JT4B 3PO0A 4AWJA 1SF0A 3W1YA 4FZLA 4NQKE 2GMIC 1J7AA 3VH3B 1OTRB 1TYGB 3A1QB 2PEAA 2LRWA 5D2MB 3HVZA 4FHJA 2GBRA 2BPSA 3UU2A 2L00B 1FO4A 3QIJA 4K7UA 3BWUD 2MHLA 1PQSA 4LK0M 4FRXA 4NPNA 1IZNB 2XE2A 4MT5A 4FSPA 4YTMB 2AQ2B 3J9CA 3APDA 1ZHZA 1ZDVA 1EF1A 3AI5A 2ZJDA 4OW0A 2K4TA 1E8XA 4IM2A 1OPFA 1CK1A 4YTNB 2KLGA 3TMPB 2N1WA 4XWWA 5TSSA 2V4IB 2QILA 4RJWA 3H6NA 3WALA 1L2NA 1P4TA 5MPOA 3LYYA 3HWBA 2KK8A 5EE0A 4ZRIA 2HE7A 3HW9A 2WU2B 4G0NB 4N75A 2BVCA 3RNFC 2LEKA 2G3QB 1WX7A 2WWZA 3KWVA 2ASQA 4ZRPA 3U8ZA 3ZJUA 5D6JB 1EM7A 2WXLA 3SU8X 3JW0X 2R89A 3AEGB 2KZ7B 3P42A 3BY4B 3L08A 4TQ1A 2W82A 4E1TA 1WJ4A 4PS3A 2JQYA 4WIPA 3PLUA 5DL5A 5H8YE 3Q6BA 3AA7B 1WZ3A 3V05A 4US8A 2VH1A 1XLOA 3NS1A 2LUEA 5LXHA 3IT6B 3UIOB 4CTDA 3QQ8B 3Q8FA 2AQ3B 3AE2B 2WX0A 1P0RA 2JRIB 5LNK1 3Q8EA 2IJ0A 2MEKA 1FRDA 1HEZE 1XLQA 2YEPF 3BK1A 3AULA 4KGSA 3NUHB 4HCNB 3NVYA 2KQ7A 3VUWA 2HTHA 2W54A 1Q1OA 4P1CC 4WWMA 1JWMD 3DWOX 5FVNA 4TQ0A 5BMGA 5JZEB 4KKJA 4IL6O 5AUIA 4LSFA 3QK0A 1K52A 1JCKB 4KZ0A 4M02A 2YEPB 2K9XA 4N59A 3KUZA 3NS8A 3VE2A 4UB8O 3I5JC 4B61A 2ZCCA 2INNE 1WX8A 3L54A 3OWEB 2L3ZA 3DBRB 5CHFA 2CS4A 2XTQA 2DNFA 4P7IA 5JDPA 1VRAB 3VZWX 3IAM1 2MX2A 4II2B 3DVGY 4BFRA 1ZP0B 3JTYA 2CHWA 2Y0HA 2LHEA 1D5XC 4EEWA 1R4MI 4RGNA 4NAWB 3QRCA 1P7FA 2LVQA 2K8BA 4WAAA 1SE4A 2W9NA 4N58A 2JUOA 2KZRA 3TEZA 4RM8A 1N61A 2Y2XA 5KHQA 2GBJA 2LWPA 4A6QA 2KWDA 4DXFA 2M0XA 1LO5D 1JROA 1C77A 4PR7A 2GRIA 3AN1A 4N9F4 2CJOA 1KOTA 1WFYA 1E90A 3SZVA 2RMMA 1UUPA 3ZGZA 1HA5A 3A33B 3SY9A 4W9LA 5AEKB 3U7ZA 1FXAA 4N6EB 1TZ1A 2KLCA 3EFUA 2WLBA 4DHZE 2N7JA 2IGDA 2KDBA 4PJ0O 2YNKA 5T5FA 2KO3A 3RZWC 3VR9B 3DCGA
chains in the Genus database with same CATH topology
2KZ7A 1BMLC 1D4BA 3PORA 1STEA 2PIAA 4R3DA 2Y5PA 3WCQA 3R8BA 1XXGA 5IYUA 1JWSD 2ZW0A 2FGRA 2VZKD 1KRHA 5C2TB 1C9FA 4O3WA 4FRTA 2BB6A 4B0EA 3MJ5A 2JSVX 1GFNA 4ZRQA 3UPGA 4FESA 1VR9A 2J4UP 3KQ4A 1I4RA 1C4CA 3AEFB 1WSPA 3GB1A 4MM3B 2SAKA 1FMAD 4RJXA 2LFUA 4A90A 1AYFA 2K3UA 2N0SB 1GFPA 3LK42 2Z8LA 3AEDB 2WXHA 3P63A 3SEBA 3U52E 2J4XA 4QQ1A 3TUOA 3Q8BA 3UAQA 3DA4A 4LSHA 1K51A 1E7PB 1GAQB 4ARCA 1SE2A 2NTTA 2MH7A 4AFKA 4GCPA 4XDCA 1FNVA 1JRPA 1AN8A 2INPE 1H6S1 1FIQA 1ROEA 2RDGA 1I4HA 1ESFA 5EE2A 1EWYC 3AA1B 5ADXK 2ZFGA 3H8HA 3HRDD 2V3PA 1Q9FA 1ORMA 2WP9B 1MM4A 4GLSC 3MC0B 1L0VB 5D3DA 4AYMC 1I4XA 2PVGC 1XLNA 2RDHA 3B9JA 1SIJA 4ZHOA 1B9RA 2W55A 3AE5B 3AE7B 4PT5A 5HFYA 3NVVA 2BB5A 3IXSA 2BYTA 1SJED 3NVWA 2K5PA 3B2FA 1YNTE 2DLBA 1L6UA 1FM0D 2K0LA 2WDRB 3B2GA 1AWDA 3SFDB 3TSSA 4AUIA 3SYBA 3VQIA 5AFUL 2LHFA 3POXA 4HROA 4J3OD 3SFEB 1C4PA 1BT9A 2ONQA 1QOBA 4HRSA 4M0WA 2XN9C 2BT6A 3VE1A 2M07A 1RM6C 4WH4A 4CQNA 5BMHA 4LTUA 4YXDB 3AAAA 4AKRB 4D64A 1ACCA 1VJKA 2KMMA 2L1AA 2PKOA 4YWGG 2KXPB 4GCSA 2KQ4X 3G7GA 4NAMA 1V8CA 3NSGA 4JFBA 3P4PB 4RF1A 1TZOA 2BS2B 4Q2JA 1TS4A 1WRIA 5FKAC 2H89B 4YT0B 1D5ZC 4KGTA 2LUMA 3U2SC 1TKEA 2K0PA 2JZPA 3BVMA 3IAS1 3QRAA 2NMQA 4YTPB 3L4PA 2WXMA 1VZ6A 5DL8A 2ZW1A 3TEXA 4RFBA 5FK9C 4G76A 2JQRB 3URYA 3GP6A 5FR3A 3A2SX 2IGHA 3PRNA 4RLCA 3VRAB 3T20A 3BYTB 3EGRA 2GE4A 1SSNA 2KAJA 1N62A 4JWUC 1XLPA 1PDXA 1T5XD 4IKGA 3NVZA 2JYTA 4FT6A 4BUMX 3MP9A 1TY0A 2K22A 2E3TA 2W80C 1MHHE 1GB4A 2ACZB 2QMTA 3SR6A 5DL6A 3C5OA 2AX5A 1EWCA 2QJLA 2V3NA 2W3RA 3W9CB 2FE8A 1PFDA 4YSYB 5D3IB 4NJCA 2J52A 1N5WA 2JX5A 2MJDA 3P4SB 5C3JB 5BYRA 1ET9A 5BYQA 4FOZA 3LK2B 4RGMA 4TMAB 1L6VA 2G1EA 2M19A 3AE9B 3VZUX 1YMHE 3BK2A 3DWGC 3FILA 4O1NA 4A55A 3HOEA 1F2RC 1XEEA 1I4GA 1ZUD2 2LHDA 4HKZE 5G5HA 4AYEC 2PLPA 4LLGM 1TJEA 4Z3TA 4XE0A 3AEBB 3T3OA 3W2DA 4DXGA 4O49A 2G9HD 4L2YA 2XNAC 3AM9A 1DYQA 4MACA 3AECB 4AKMA 1JWAD 3WI5A 4FMSA 3AEEB 1YQ4B 3T3NA 3C8YA 2KDMA 4RGOS 1YQ3B 2LGIA 1KF6B 1UWXA 4YSXB 3PZ7A 3LK2A 4C69X 3AEAB 1HXYD 1L4ZB 1FNUA 3POQA 4XDDA 5AUKA 3ZJVA 2L83A 2WQYB 1WWTA 3TEYA 3FILB 3I57A 4JE3B 4AQ7A 1DOXA 2I2YA 3AA6A 2PMVA 1FCCC 1JW9D 3LXFA 1TS2A 1D5MC 3BYYB 1SB3C 4OZBA 1C76A 1N5XA 2M56B 2AQ1B 2IDYA 1V1PB 2LJIA 1IGDA 3NRZA 4KRAA 4RL9A 2HTME 1YS5A 4D65A 2VZKB 4DQOC 4IDIA 4L23A 3NZ3A 4UDUC 2JXTA 4RF0A 4KR8A 2CU3A 4IOIE 1DOIA 4G75A 3AAEB 2ERVA 3PQSA 2HDEA 1A70A 2N9LA 2WXQA 1E10A 1GOZA 3AA0A 4D5UA 3N9YC 3W1SA 2RPVA 1K53A 1VLBA 4F4BA 4LSEA 2PORA 1KH0A 1NVID 1YN4A 3RBHA 1DOYA 2IGGA 3HUIA 5HI1A 3FYXA 3HVDA 4AZLA 1YN3A 1PGXA 5T8IA 2WU5B 2ZLDA 4O4UA 1JALA 4JX1C 5D7GA 2F1VA 3EA6A 3VR8B 5G5GA 1NYRA 3E9SA 1KLGD 2QTKA 1N63A 4WURA 5BYSA 1EU4A 1HXTA 5EE1A 3AAAB 2OEDA 4ARIA 1XCQL 1L0XB 1L0YB 4B0MA 2XG6A 1GB1A 1XCTL 3FAHA 2KXPA 4FSOA 1QJPA 4WQMA 4NZLB 1QLBB 4O4XA 5G26A 1K50A 2GI9A 3CWIA 2F1TA 4C7ZA 1HXXA 1JQ4A 6PRNA 1J7BA 2BS4B 1JWUD 2N9KA 4XNKA 1V1PA 2WXGA 2J1NA 1JMLA 3PO0A 2J53A 2V0GA 1Q10A 2W81C 4PUXA 2YPVA 1SF0A 4FZLA 2JWUA 1ET6A 4OZCA 1J7AA 1ZE3D 1GFOA 1TYGB 5ADXL 1XF5L 1SXTA 4OHJA 4GDLB 1RFKA 2DYMA 1BXWA 4TSSA 1PHOA 3HVZA 3Q69A 2JYEA 3BVGA 2H88B 1ZOYB 1FD6A 3UU2A 1Y56A 4KKIA 4RLBA 2PW9A 4H2AA 1FO4A 3AA1A 1JWBD 1VDVA 2D5GA 3R2TA 1KLUD 2WS3B 3BWUD 4LSIA 2MHLA 4YSZB 2TSSA 1SJHD 4LK0M 1XO3A 4FRXA 3ZYYX 2WXOA 1IZNB 2XE2A 2MJEA 3AB5A 4FSPA 4MT5A 4YTMB 2AQ2B 1V1OA 4WAFA 1E0ZA 3J9CA 2X38A 1B1ZA 3ABVB 1E54A 1FXIA 1ZHZA 1ZDVA 2BBCA 1GFMA 4L1BA 3U4EG 4FZMA 1PGBA 4OW0A 3KLSX 4FXCA 2K4TA 1ZHTA 2Y0KA 4FUVA 1CQVA 4REZA 1OPFA 1UNSA 3PQUA 3DA3A 1CK1A 3AH7A 5E6JA 3V3XA 4OZAA 4YTNB 1QQRA 1R7SA 3UI3A 1FRRA 1TKGA 2FUG1 2I38A 3BZDB 3ETRA 4HJGE 4P6VF 1MHXA 4C56C 2LFIA 1OFFA 4XWWA 5TSSA 4GF4A 3AA6B 3SY7A 1QKZA 2QILA 4RJWA 2V4IB 1TS3A 1UWMA 3VR9B 1NEKB 1P4TA 5MPOA 3LYYA 3HWBA 1CZPA 4O3XB 3V8UA 1TS5A 1TKYA 1NYQA 1MM5A 1RYJA 1WXQA 3VZTX 3ZQ4A 4RNAA 1FCLA 1QILA 3T0SA 5EE0A 5D5DA 2Y3AA 4A9AA 1F0ZA 2OMFA 3HW9A 2WU2B 3RPFC 4ITKA 3P4QB 1OSMA 2Q5WD 2LEKA 3SZDA 2WXFA 1QOAA 1YN5A 1IUEA 1C4AA 3KWVA 1Q9GA 1SE3A 1V97A 4ZRPA 2JMMA 4KGRA 3ZJUA 1EM7A 3DWMA 2N2MA 2WXLA 2OHFA 2QIEB 1KTKA 3AEGB 2KZ7B 3O0EA 1G90A 2BS3B 3P42A 2CJNA 5GXGB 1ZXHA 4MH8A 2MNHA 1NI3A 2FBWB 4TQ1A 1OQQA 1ZXIA 2W82A 4E1TA 4RGTA 2FGQX 2DBYA 2EKIA 3MHZA 4P16A 3Q8CA 4WIPA 3LK3A 2WDQB 1PUTA 3AE6B 4C7YA 4ZOHC 5DL5A 1THQA 1BUIC 5H8YE 3AA7B 3V05A 2M06A 1QT9A 4US8A 4AYDC 1WGKA 3TZGA 1C78A 3KVDD 1P7EA 1F2RI 4O3YA 1XLOA 1I7HA 3NS1A 3Q8AA 4AKRA 4O3ZA 3IT6B 4JPSA 3AAEA 1QF6A 3WI4A 2ODJA 2KACA 4KR4A 3T24A 3Q8FA 2J42A 4AS1A 1GFQA 4FZNA 5DL7A 4AYID 1ZDXA 1PRNA 2AQ3B 2WXKA 5GV0A 3AE2B 1ZHWA 1T6BX 3BIID 3W5UB 4GCQA 5LNK1 3LK41 1FNWA 3Q8EA 2KDYA 2PTLA 1C79A 5PRNA 1VZ8A 2IJ0A 1J7CA 1FRDA 1HEZE 2MEKA 4EE2A 1XLQA 2YEPF 3IT4B 1E9MA 2R61A 3BK1A 4KGSA 3LK3B 1SEBD 3BVZA 2JU6X 3NUHB 7PRNA 5HG2A 3NVYA 2IPKD 5I4DA 1T3QA 1QJ9A 2LMCA 3AA7A 3I9V1 1ZHXA 1AW7A 1D6EC 1DGJA 2L32A 2W54A 2DYOA 3AE4B 4JCHA 1I4PA 4C80A 3GS2A 2MJ3A 1YJIA 2WXRA 4WWMA 1JWMD 4XWTA 5EE3A 3TEWA 5JXVA 5FVNA 4TQ0A 2GB1A 5BMGA 4HKQA 1HQRD 4JWSC 1IZNA 1BXTA 3CIRB 3KWLA 4KKJA 1MPFA 2DWQA 3AE3B 1QOFA 2QSDA 5AUIA 4LSFA 1FFVA 1PGAA 4A8XC 4RCOA 1PYWD 2BW2A 1K52A 1JCKB 2M0AA 2YEPB 1VZ7A 4N59A 2K9XA 4U9CA 3FC4A 8PRNA 2XE3A 4D2KA 3VE2A 4OVZA 1HXUA 4B61A 4RH6A 2INNE 2PRNA 2WNMA 1EU3A 4E1SA 2XMXA 1ZHYA 3OWEB 2PVOD 1QJ8A 3R2IA 4GHBA 2XTQA 1MPEA 1IBXA 1QOGA 2WXJA 5JDPA 1VRAB 1BH3A 3VZWX 1F77A 1FFUA 2QEJC 3IAM1 2XTRA 1SBBB 3MFGA 3GP7A 1ZP0B 3JTYA 2Y0HA 2LHEA 1D5XC 1ZPSA 5HHDG 4XNLA 3AMZA 2O4VA 3SYSA 4RGNA 2Y0LA 2WXNA 2XE1A 1L5PA 4NAWB 2BTEA 1HZ6A 3QRCA 3EUB2 1N60A 1P7FA 2KC0A 2X27X 1FEHA 3POUA 1SE4A 3VY9X 3LB8C 3E56A 3PZ8A 4N58A 3W5VB 3TEZA 5AFUK 1N61A 2Y2XA 2Y5CA 1UGJA 1M4VA 4A6QA 1WYGA 1L4DB 2L52A 2KWDA 1IGCA 4DXFA 2WDVB 3VY8X 3AA0B 1HZ5A 4GDKB 1LO5D 2XE5A 1JROA 3P4RB 1C77A 2NTSA 4KX6B 1YJJA 2GRIA 3AN1A 1RWSA 1E6EB 2B76B 1KFYB 1GPXA 2CJOA 3SZVA 2RMMA 1UUPA 4USAA 5BMIA 2SEBD 3K19A 2ON8A 3ZGZA 1HA5A 3VRBB 3ZJTA 5EE9A 3SY9A 4ZYSA 2N2LA 3AV8A 2WXPA 1FXAA 4N6EB 1ENFA 3U7ZA 3AE1B 1IBXB 5H92C 3P1MA 2WLBA 2EELA 3HOLA 1TY2A 2KN4A 4ZHPA 3EMNX 3RFZB 1OQRA 1MVKA 2E6XA 2N7JA 2Y7SA 1CJEA 1NENB 2IGDA 2W3SA 2WXIA 3O13A 4HEA1 2YNKA 5T5FA 4AYNA 1MI0A 4US9A 3AE8B 1I4QA 2ICIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FRD A;  1XLQ A;  1B9R A;  4FZL A;  2PIA A;  2AX5 A;  2QJL A;  1J7A A;  1E9M A;  2W3R A;  3W9C B;  3WCQ A;  1TYG B;  1PFD A;  4YSY B;  1KRH A;  5C2T B;  1N5W A;  1RFK A;  2JX5 A;  2MJD A;  3NVY A;  3P4S B;  5C3J B;  1T3Q A;  3HVZ A;  2H88 B;  1ZOY B;  1L6V A;  2G1E A;  1DGJ A;  2M19 A;  3AE4 B;  2W54 A;  3AE9 B;  3DWG C;  3AEF B;  4C80 A;  1FO4 A;  1ZUD 2;  5G5H A;  1JWB D;  1VDV A;  2MJ3 A;  1YJI A;  4WWM A;  5EE3 A;  2WS3 B;  1TJE A;  1FMA D;  4YSZ B;  3AEB B;  1XO3 A;  3ZYY X;  1AYF A;  2N0S B;  2MJE A;  3AB5 A;  3AED B;  3AM9 A;  3P63 A;  4JWS C;  4YTM B;  3CIR B;  3KWL A;  1E0Z A;  3AEC B;  3DA4 A;  2DWQ A;  3ABV B;  1JWA D;  3AE3 B;  1QOF A;  1E7P B;  1FXI A;  1GAQ B;  5AUI A;  1FFV A;  3AEE B;  1YQ4 B;  4FZM A;  4FXC A;  2MH7 A;  3FC4 A;  2K9X A;  4N59 A;  1JRP A;  1YQ3 B;  3DA3 A;  1KF6 B;  3AH7 A;  4YSX B;  1FIQ A;  1ROE A;  4YTN B;  1R7S A;  3AEA B;  1FRR A;  1TKG A;  3ETR A;  5AUK A;  1EWY C;  4P6V F;  2L83 A;  2WQY B;  1WWT A;  3HRD D;  2XMX A;  1DOX A;  2WP9 B;  1OFF A;  2PVO D;  1L0V B;  2PVG C;  1XLN A;  1JW9 D;  3B9J A;  1SIJ A;  1UWM A;  2XTQ A;  3LXF A;  2W55 A;  3VR9 B;  1QOG A;  4ZHO A;  1NEK B;  1SB3 C;  3AE5 B;  3AE7 B;  3NVV A;  1N5X A;  1FFU A;  2M56 B;  1CZP A;  5MPO A;  1TKY A;  3NRZ A;  2XTR A;  2K5P A;  3NVW A;  1NYQ A;  1RYJ A;  1ZP0 B;  2HTM E;  1WXQ A;  3B2F A;  1L6U A;  1FM0 D;  2WDR B;  3B2G A;  5EE0 A;  1AWD A;  4IDI A;  3SFD B;  4A9A A;  1F0Z A;  2WU2 B;  3AMZ A;  2CU3 A;  3RPF C;  4HRO A;  4ITK A;  1DOI A;  4G75 A;  1L5P A;  3P4Q B;  2Q5W D;  2LEK A;  3SFE B;  1A70 A;  3EUB 2;  1N60 A;  1QOA A;  1E10 A;  4HRS A;  1QOB A;  3LB8 C;  1IUE A;  2BT6 A;  4N58 A;  3W5V B;  1RM6 C;  1V97 A;  1N61 A;  4LTU A;  4YXD B;  2Y5C A;  2KMM A;  1VJK A;  1VLB A;  2PKO A;  3DWM A;  1WYG A;  1NVI D;  2OHF A;  1DOY A;  2L52 A;  2QIE B;  3AEG B;  2BS3 B;  2WDV B;  3HUI A;  2CJN A;  5GXG B;  1V8C A;  2WU5 B;  1JRO A;  3P4P B;  1JAL A;  3P4R B;  4JX1 C;  1NI3 A;  2BS2 B;  2FBW B;  1OQQ A;  1WRI A;  1ZXI A;  1YJJ A;  4KX6 B;  3AN1 A;  3VR8 B;  1RWS A;  5G5G A;  1NYR A;  2DBY A;  2H89 B;  1E6E B;  4YT0 B;  2B76 B;  1KFY B;  1GPX A;  2CJO A;  2EKI A;  4USA A;  1N63 A;  1TKE A;  2WDQ B;  3AE6 B;  1PUT A;  5EE1 A;  4C7Y A;  4ZOH C;  3VRB B;  5H8Y E;  4YTP B;  5EE9 A;  4US8 A;  1QT9 A;  3L4P A;  1WGK A;  3FAH A;  3AV8 A;  1XLO A;  3NS1 A;  4WQM A;  4G76 A;  1FXA A;  1QLB B;  1I7H A;  2JQR B;  3AE1 B;  4N6E B;  5H92 C;  3P1M A;  2WLB A;  3CWI A;  3VRA B;  1QF6 A;  4C7Z A;  2KAJ A;  1JQ4 A;  1N62 A;  4JWU C;  1XLP A;  1PDX A;  1J7B A;  1OQR A;  3NVZ A;  4FZN A;  2BS4 B;  1CJE A;  1NEN B;  3AE2 B;  2W3S A;  4ZHP A;  3BII D;  3W5U B;  2E3T A;  2K22 A;  4US9 A;  3PO0 A;  3AE8 B;  1SF0 A;  2ACZ B;  3SR6 A;  1J7C A; 
#chains in the Genus database with same CATH topology
 1R4M B;  4IWP A;  1STE A;  4R3D A;  3WCQ A;  2Y5P A;  2VZK D;  1C9F A;  4IM0 A;  1GFN A;  1WM2 A;  3B1L X;  1T0Y A;  4FES A;  1N6Z A;  2MQJ A;  3I3T B;  1FMA D;  5DPW A;  4RM9 A;  5G3A A;  4KSK C;  1AYF A;  1GFP A;  3LK4 2;  3AED B;  3U52 E;  3TUO A;  3Q8B A;  3DBH I;  1GAQ B;  3L13 A;  3VTV A;  1HE8 A;  1SE2 A;  3DHH C;  2IY0 B;  4AFK A;  4GCP A;  4XDC A;  1JRP A;  3VAW A;  1FIQ A;  2N1V A;  2FIF A;  1EWY C;  3RCZ A;  4I6P A;  1V86 A;  1ORM A;  2Z0D B;  3MC0 B;  1P9D U;  1R4N I;  4PT5 A;  2K5P A;  1L6U A;  3JYU A;  3TSS A;  2NS5 A;  1CMX B;  3PRZ A;  4J3O D;  1C4P A;  2ONQ A;  4HRS A;  2BT6 A;  3VE1 A;  3MHS D;  2M07 A;  4WH4 A;  4EZJ A;  4CYE A;  1ACC A;  3DWN A;  5J17 A;  1GG3 A;  3RNC C;  1K8R B;  1UH6 A;  3P4P B;  3DBH B;  4NAW A;  1TS4 A;  5FKA C;  4YT0 B;  4KGT A;  4K81 A;  3U2S C;  1V49 A;  1TKE A;  2K0P A;  3CF6 E;  3BVM A;  4YTP B;  5DL8 A;  5FR3 A;  3URY A;  3GP6 A;  2BYE A;  4W9G A;  3MC8 A;  2IGH A;  4RLC A;  3BYT B;  3WU2 O;  1SSN A;  1N62 A;  5CX3 A;  1XLP A;  3GE3 C;  4XYC A;  4FT6 A;  4BUM X;  5B5E O;  2E3T A;  2W80 C;  4FAD A;  2F1C X;  4W9E A;  3UIP B;  4HJK A;  4YSY B;  1T0S C;  5D3I B;  2J52 A;  2MW5 A;  5BYR A;  2LGY A;  4M0W B;  5BYQ A;  2KFK B;  2V9H A;  3HM6 X;  3IG3 A;  4RGM A;  4TMA B;  4GOC A;  2A5U A;  3AE9 B;  3UQB A;  3DWG C;  4O1N A;  2IYD B;  4K3C A;  2N9E B;  2KVR A;  4LLG M;  4Z3T A;  4XE0 A;  3HM3 A;  3T3O A;  3QCA A;  2REX A;  4O49 A;  4L2Y A;  4MAC A;  1JWA D;  2OJW A;  1YQ4 B;  3IHP C;  4HK2 A;  1TT5 B;  3EEC A;  3C8Y A;  4RGO S;  4LCD E;  2YLM A;  3NZS A;  3AEA B;  4KIK B;  1WJN A;  1HXY D;  1FNU A;  3A0B O;  3DBR I;  3OJ4 B;  2LVO A;  5TR5 A;  1TS2 A;  1SB3 C;  1WMH B;  3QJZ A;  2AQ1 B;  3WIM A;  1V1P B;  1WI0 A;  4MSQ B;  4RL9 A;  1UGM A;  3SDL C;  2VZK B;  4DQO C;  1LFD A;  1VCB A;  3NZ3 A;  4UDU C;  1X1M A;  1Z2M A;  2CU3 A;  1DOI A;  4G75 A;  2ERV A;  2WXQ A;  5KAI O;  1WYW B;  4W9D A;  3AA0 A;  3N9Y C;  2FCM A;  2KWV B;  4LSE A;  2POR A;  3RBH A;  4HPM B;  4AZL A;  1PGX A;  3A9K B;  4JX1 C;  4O4U A;  1JAL A;  4W9C A;  3E9S A;  2WHI A;  1HXT A;  4BKS D;  1GB1 A;  3C19 A;  1WGD A;  2UWQ A;  4KV2 A;  4NZL B;  3CWI A;  1EF5 A;  3KYC D;  1JQ4 A;  2KWU B;  1J7B A;  2BS4 B;  2D3B A;  1JWU D;  5CHV C;  2DZI A;  2V0G A;  2KTR B;  2W81 C;  4PUX A;  1WF9 A;  2JWU A;  1ET6 A;  3TL5 A;  1GFO A;  4PYU A;  1XF5 L;  1KJT A;  1SXT A;  4OHJ A;  4FLH A;  1BXW A;  4TSS A;  2MP2 B;  3BVG A;  3UIN B;  1Y56 A;  4RLB A;  2PW9 A;  4FJZ A;  2LXA A;  3R2T A;  1KLU D;  5JH5 C;  4YSZ B;  4XZ4 A;  3QC8 B;  4LJO B;  1V1O A;  1E0Z A;  4J6I A;  2KJR A;  1E54 A;  4L1B A;  1PGB A;  2LGS A;  3FKY A;  1FPY A;  3M95 A;  4F1S A;  4REZ A;  3U7D A;  4LNK A;  3ZW3 A;  2QDF A;  1QQR A;  3BZD B;  2R2Q A;  1YX5 B;  2FUG 1;  2J0J A;  2ZCB A;  3ETR A;  2IBI B;  1OFF A;  4ANX A;  2CKH B;  3A4R A;  4GF4 A;  3AA6 B;  1I35 A;  1TS3 A;  4FQE A;  3ZXV A;  1CZP A;  1TS5 A;  3VZT X;  1FCL A;  2O2V A;  4EOY A;  2Y3A A;  3DZM A;  1F0Z A;  2OMF A;  3P4Q B;  1OSM A;  4MH0 E;  2Q5W D;  3ZNI D;  4PYZ A;  2WXF A;  2ZNV C;  2L7R A;  2JXX A;  1SE3 A;  2N2M A;  1M94 A;  2OHF A;  1WXM A;  2WJQ A;  1KTK A;  2NCN A;  3O0E A;  2CJN A;  5GXG B;  2KWC A;  3N20 C;  1WGY A;  2CHZ A;  2MBE A;  2EKI A;  3MHZ A;  4P16 A;  3MC9 A;  3AE6 B;  3IBE A;  3TIX A;  2I1K A;  1QT9 A;  2AEH A;  3I63 C;  5KHO A;  5EDS A;  1I7H A;  3PS6 A;  4O3Z A;  3AAE A;  3WI4 A;  2M17 A;  2KAC A;  4KR4 A;  3T24 A;  4AS1 A;  2WXK A;  5DL7 A;  1PRN A;  1ZHW A;  5JHA A;  1V6E A;  4GCQ A;  2PTL A;  4X57 B;  2ZPN A;  1EUV B;  4EE2 A;  2R8A A;  3EFC A;  3TBL D;  2R61 A;  4FJY A;  1T1L A;  3LK3 B;  1SEB D;  3BVZ A;  2JU6 X;  7PRN A;  5HG2 A;  1V9J A;  2IPK D;  1T3Q A;  1QJ9 A;  3IVF A;  1AW7 A;  1D6E C;  2DYO A;  2LI5 A;  4C4V A;  2LGX A;  3GS2 A;  4DXA B;  1YX6 B;  3TEW A;  2G4S A;  4MJS B;  2KJH B;  2DAJ A;  3NY5 A;  2D11 A;  1IZN A;  1BXT A;  5HKH A;  3CIR B;  2IO0 B;  1PGA A;  4RCO A;  1PYW D;  1VZ7 A;  8PRN A;  1T16 A;  4G11 A;  4NJ7 A;  2XE3 A;  4OVZ A;  4RH6 A;  2WNM A;  2XMX A;  2PVO D;  4BOZ B;  4K1R B;  2C7H A;  1IBX A;  3PLV A;  1QOG A;  3Q3F A;  1U4A A;  3PTF C;  3DVN V;  4IUM B;  1C3T A;  4XNL A;  3ONS A;  2BTE A;  2XE1 A;  2WX1 A;  1XT9 B;  2KC0 A;  4TKN A;  2PE9 A;  5IO9 A;  3LB8 C;  3E56 A;  3PGR A;  4ASW C;  1S1Q B;  1IGC A;  3GE8 C;  4GDK B;  2ZPY A;  3H9D A;  1MJD A;  2CR5 A;  2NR2 A;  1YJJ A;  1J0G A;  2B76 B;  2G45 B;  2BWF A;  3X23 A;  3K19 A;  3A9J A;  3Q3J A;  4ZYS A;  3PT2 B;  3AV8 A;  1YD8 U;  3WAO A;  5IP4 D;  5H92 C;  2KKC A;  3PRP B;  4BKT A;  2EEL A;  4FN2 A;  3HOL A;  1Q0W B;  2IND C;  2WJR A;  2VH2 A;  3QHT A;  1Y8R C;  1MVK A;  2E6X A;  3U4E G;  4N74 A;  2XEW A;  2WXI A;  1CJE A;  1NEN B;  4AYN A;  1MI0 A;  2L05 A;  5L83 A;  4ANW A;  2M8S A;  1UD7 A;  2L32 A;  1WH3 A;  2PIA A;  3RYT A;  5IYU A;  2ZW0 A;  2FGR A;  3OG5 A;  1KRH A;  5C2T B;  1I42 A;  4FRT A;  4B0E A;  2NBV B;  4ZRQ A;  3UPG A;  2J4U P;  4HPL B;  4BBN F;  1I4R A;  2QHO A;  3RI7 C;  3GB1 A;  4LDT B;  1V2Y A;  3OAW A;  2D3A A;  4CHK A;  2SAK A;  1HTQ A;  2FCN A;  2LFU A;  4G3X B;  2Z8L A;  2IWW A;  3SEB A;  2J4X A;  4QQ1 A;  2VRR B;  1K51 A;  3PRE A;  1E7P B;  4C4V B;  1ZGU B;  2INP E;  2R4P A;  1KM7 A;  1ROE A;  2RDG A;  4GXB A;  1ESF A;  3Q3N C;  3VXW A;  1V5O A;  5ADX K;  1TGZ B;  3A9K A;  3V60 A;  1MM4 A;  2AL3 A;  1L0V B;  4ZHO A;  3B9J A;  1SIJ A;  5HFY A;  5B66 O;  5IA7 A;  2BB5 A;  1YNT E;  3EHV A;  1FM0 D;  2K0L A;  3SFD B;  4FJV B;  4HCP B;  3PGS A;  4HRO A;  1J8C A;  2IO2 B;  3TJP A;  4M0W A;  1RM6 C;  4CQN A;  1XD3 B;  2BF8 B;  1NDD A;  2WDT B;  2R88 A;  4NAM A;  2AL6 A;  2N7E A;  3BRY A;  4RF1 A;  2DZK A;  2BS2 B;  2J0K A;  3SD5 A;  4HVB A;  4ZDV A;  4AUQ C;  2JZP A;  4ZYN A;  3IAS 1;  2NBW B;  4DHJ B;  2KFK A;  3KUD B;  1TIF A;  4IC7 B;  1V81 A;  3AU5 A;  1VZ6 A;  2KX3 A;  2ZW1 A;  3TEX A;  4G76 A;  2JQR B;  3A2S X;  2LD9 A;  3ECI A;  1WXV A;  3VRA B;  3T20 A;  3EGR A;  2GE4 A;  2KAJ A;  1GC6 A;  4JWU C;  3QA8 A;  1T5X D;  3KYD D;  1TY0 A;  1MHH E;  2D2Q A;  1V80 A;  3SR6 A;  4BZA A;  3QX1 A;  1N5W A;  5CHW A;  1ET9 A;  4KIK A;  1S3S G;  2G1E A;  4FA6 A;  3VZU X;  1YMH E;  2HJ1 A;  3KZI O;  1ZUD 2;  1F2R C;  2O6V A;  2LHD A;  4M8N A;  5DPT A;  3AEB B;  3W2D A;  2G9H D;  2XNA C;  3ZNH B;  3JSV A;  3WI5 A;  4BKG A;  2IY1 B;  4UB6 O;  4FMS A;  3AEE B;  3T3N A;  5E6N A;  1KF6 B;  1YQB A;  1ZKH A;  3ENE A;  3ZKJ C;  3LK2 A;  4C69 X;  5AUK A;  2GBN A;  2L83 A;  4KDI C;  4HXD A;  2PJH A;  4ANU A;  2I2Y A;  3V6C B;  2KXJ A;  3KUC B;  2NBU A;  1JW9 D;  1N5X A;  2IDY A;  2C9W B;  3NRZ A;  1IGD A;  2HTM E;  5AZG A;  4IDI A;  2JXT A;  3AAE B;  3PQS A;  4ZRK A;  3V6E B;  2KMA A;  4D5U A;  3W1S A;  2QCZ A;  4C00 A;  1VLB A;  4WJN A;  1KH0 A;  1DOY A;  3SHQ A;  3HUI A;  2HD5 B;  3EA6 A;  1KLG D;  2RR9 A;  4FHK A;  1EU4 A;  2YVC A;  5IOI A;  2OED A;  2MP2 A;  2MBH A;  4B0M A;  2XG6 A;  2NPT B;  1XCT L;  3FAH A;  2GBM A;  1F1H A;  4FSO A;  1QJP A;  4WQM A;  1QLB B;  4O4X A;  2KT7 A;  5DCN A;  3L0W B;  3WA0 A;  4G50 A;  3ZO5 B;  4MGZ E;  3VFK A;  2N9K A;  2ZZP B;  4XNK A;  2J53 A;  1Q10 A;  2YPV A;  3WAN A;  4OZC A;  2IO1 B;  2BKR B;  4B9K A;  4IG7 B;  4A3O A;  1RFK A;  2KOX A;  1PHO A;  3Q69 A;  1ZOY B;  4H2A A;  1VDV A;  2D5G A;  4W9F A;  2WS3 B;  4LSI A;  5E79 O;  1SJH D;  2KDE B;  1XO3 A;  2V4L A;  3ZYY X;  3RNB C;  2MJE A;  3PGE A;  4WAF A;  3R3M A;  1B1Z A;  3ABV B;  2L76 A;  4DHJ D;  2BBC A;  4FZM A;  2PPH A;  3KLS X;  2PE6 B;  3H7P A;  2Y0K A;  1ZHT A;  3BS0 A;  4FXC A;  1E8W A;  1CQV A;  1P98 A;  1UNS A;  1QZE A;  3S2A A;  3V3X A;  5E6J A;  1FRR A;  1TKG A;  2JZ3 B;  4HJG E;  4I6N B;  5DPS A;  2Z59 B;  1MHX A;  4C56 C;  2HJ8 A;  4DK5 A;  3R7Q A;  4HPP A;  3JSV B;  3CST A;  1NYQ A;  3H1U A;  1QIL A;  5D5D A;  4A9A A;  1F52 A;  3VHT C;  4F7Z A;  1WR1 A;  1YN5 A;  1J19 A;  4WWP A;  1V97 A;  3N1Z C;  2BS3 B;  1A5R A;  2A4Z A;  2MNH A;  1NI3 A;  2FBW B;  1OQQ A;  1ZXI A;  2KMC A;  1WGG A;  2FGQ X;  4RGT A;  2DBY A;  2AWT A;  3LK3 A;  4K3B A;  1WRD B;  1WX9 A;  4URK A;  4AYD C;  1WGK A;  1P3Q U;  4XX5 A;  3TZG A;  1C78 A;  1P7E A;  1F2R I;  4O3Y A;  2R4O A;  4JPS A;  3P2B A;  4EKU A;  2ODJ A;  2LZ6 A;  3PSE B;  2J42 A;  1GFQ A;  2FAZ A;  4JE3 B;  1E5W A;  4ZHP A;  5J18 A;  5GV0 A;  3BII D;  3W5U B;  1BT0 A;  2LXC A;  4JIO U;  1FNW A;  1Q5W B;  2N4F A;  5KAF O;  3T9L A;  5PRN A;  4MM3 A;  1J7C A;  2DEN B;  1D3Z A;  1E9M A;  1LQB A;  3ZRF A;  2KHW B;  2JRH A;  3U30 A;  3A0H O;  5I4D A;  4FUL A;  3I9V 1;  1TTN A;  4II3 B;  3DHI C;  3RD2 A;  1DGJ A;  4XGA B;  4C80 A;  1I4P A;  1YJI A;  5EE3 A;  4AP4 C;  2KJ6 A;  2O6V D;  4LDT D;  2MHJ A;  2WVP A;  4JWS C;  5IN7 A;  2DWQ A;  3AE3 B;  2QSD A;  3QAR A;  1FFV A;  4GMV A;  2R2O A;  4F8C B;  1UBI A;  3Q3O C;  4MEL A;  1HXU A;  2PRN A;  1EU3 A;  4GDL A;  4GSW A;  4E1S A;  4JGH B;  3APF A;  1QJ8 A;  2BKF A;  3R2I A;  3WAM A;  2I1J A;  4GHB A;  2V1Y A;  1MPE A;  4PS8 A;  3B08 A;  3JVZ X;  3PPA A;  2XTR A;  1SBB B;  3GP7 A;  1ZPS A;  4DHZ B;  1ZW7 A;  2O4V A;  3SYS A;  2Y0L A;  2WXN A;  2XBB C;  1L5P A;  3KH0 A;  1H4R A;  3ZNZ B;  3H7S A;  2X27 X;  3VY9 X;  3PZ8 A;  2Y5C A;  2EMS A;  1UGJ A;  1WYG A;  1L4D B;  2WDV B;  3VY8 X;  4JL9 A;  3AA0 B;  1HZ5 A;  4WJO A;  3RNA C;  3P4R B;  1EO6 A;  4KX6 B;  3RN9 C;  1RWS A;  3HIZ A;  1E6E B;  1KFY B;  1GPX A;  5BMI A;  2GLS A;  1UF0 A;  4QAY A;  2ON8 A;  2WGS A;  1RAX A;  3VRB B;  2ZEQ A;  2N2L A;  5LXI B;  1ENF A;  3RUL A;  3P1M A;  2JF5 A;  2KN4 A;  4GB9 A;  3RFZ B;  2Y7S A;  3O13 A;  5G55 A;  2W3S A;  1WGH A;  2DZM A;  3K9O B;  4US9 A;  2LRU A;  3PV1 A;  4GU2 A;  1WXS A;  3DBS A;  1LM8 B;  1BML C;  5C23 A;  2GBK A;  4IWQ A;  1D4B A;  1XXG A;  1JWS D;  2KX0 A;  4O3W A;  2NPT A;  1VR9 A;  3KQ4 A;  2DAF A;  3AEF B;  4OVV A;  4MM3 B;  2DYB A;  5BO4 B;  3O65 B;  4NY0 A;  4A90 A;  2K3U A;  2N0S B;  3ZNG C;  2WXH A;  3P63 A;  1GNU A;  3ZDM C;  3MTN B;  1OGW A;  2IO3 B;  4B95 A;  2MBQ A;  3Q2A C;  2D3G A;  2Z0E B;  2NTT A;  2JWZ A;  1FNV A;  1AN8 A;  2LAS A;  1I4H A;  2MA9 B;  1GJZ A;  5E6P A;  3Q3M C;  3HRD D;  1P1A A;  2WP9 B;  5D3D A;  4AYM C;  2RDH A;  1XLN A;  3NVV A;  3VDZ A;  4GN1 A;  1SJE D;  3DVG X;  3NVW A;  2DLB A;  1E7U A;  4BOS C;  2WDR B;  3B2G A;  1AWD A;  3H7P B;  3SYB A;  5AFU L;  2LHF A;  2KD0 A;  3POX A;  3SFE B;  4MSM B;  1H8C A;  4MGY E;  3VTU A;  1QOB A;  4KDL B;  4ACF A;  2XN9 C;  1UZX B;  4LTU A;  3AAA A;  4AKR B;  4D64 A;  1VJK A;  2KMM A;  4LJP B;  1YJ1 A;  3L16 A;  2KXP B;  2GOW A;  1TBE A;  3G7G A;  2INC C;  1V8C A;  3NSG A;  4JFB A;  1RLF A;  1TZO A;  3UQA A;  1WRI A;  1D5Z C;  2LUM A;  1E7V A;  2NMQ A;  5FR6 A;  2R4N A;  4W9J A;  3L4P A;  2RGF A;  2WXM A;  3BIN A;  4RFB A;  5FK9 C;  3PRN A;  3NG0 A;  3V61 A;  1PDX A;  1E8Y A;  2FID A;  2JYT A;  4FBJ B;  5G2N A;  4E3C A;  3Q14 C;  3ZIM A;  2ACZ B;  2QMT A;  4AJY B;  3C5O A;  2AX5 A;  1EWC A;  2BQQ A;  2JY6 A;  2V3N A;  3EC8 A;  2FE8 A;  2MWS B;  2MJD A;  5C3J B;  3LK2 B;  2WYQ A;  4NJ6 A;  1L6V A;  4GGQ A;  3QAQ A;  3BK2 A;  4M01 A;  4A55 A;  3ML9 A;  1XEE A;  4HKZ E;  5G5H A;  4W9I A;  3JCU O;  1Z5S B;  2PLP A;  3A4S C;  4MEM A;  1TJE A;  4IM3 A;  4W9H A;  5AZF A;  3AU4 A;  4BAX A;  3AM9 A;  4GIV A;  2KYW A;  1UBQ A;  2MSE D;  3MJW A;  3AEC B;  4M00 A;  3RNG C;  4AKM A;  4MJS A;  1WY8 A;  3VTW A;  4PS7 A;  3PRM B;  1NBF C;  2LGI A;  2KN5 A;  4TUU A;  2C5L C;  3PZ7 A;  1L4Z B;  3POQ A;  3ZJV A;  2WQY B;  1S5L O;  2EKE C;  3FIL B;  1YIW A;  2JPH A;  3LXF A;  3BYY B;  4OZB A;  3NZU A;  3LJ3 A;  5GMV A;  1MG8 A;  4DWF A;  4D65 A;  3RT3 B;  4L23 A;  5JHB A;  5AZH A;  3ZLZ A;  1A70 A;  2N9L A;  4PK1 A;  1E10 A;  3ZTD A;  2RPV A;  2M4N A;  4YL8 A;  3ZDT A;  4F4B A;  1YN4 A;  5G39 A;  1NVI D;  2IGG A;  5HI1 A;  3FYX A;  3HVD A;  4S0R A;  1YN3 A;  3UF8 A;  2WU5 B;  5D7G A;  4DBG A;  2F1V A;  3VR8 B;  4KSL C;  5G5G A;  1NYR A;  3OJ3 A;  3C0R B;  2XK5 A;  3KW5 B;  1N63 A;  3AAA B;  3LDZ E;  4ARI A;  1XCQ L;  1L0X B;  2KXP A;  2N7D A;  1C1Y B;  3VUX A;  1K50 A;  1SE9 A;  3A9J B;  3VVW B;  2F1T A;  1T0R C;  4C7Z A;  6PRN A;  1WZ0 A;  2ZVN A;  3N32 A;  4AOF A;  2ZNV B;  2N9P C;  3HHM A;  1ZE3 D;  3NHE B;  5ADX L;  3DBL B;  4GDL B;  2DYM A;  2X9K A;  2LJ5 A;  2JYE A;  5L95 C;  2H88 B;  1FD6 A;  3DVN U;  4KKI A;  4AJW A;  3AA1 A;  1JWB D;  2O6V B;  2ZVO A;  2TSS A;  1E8Z A;  3N1X C;  2WXO A;  5H2F O;  1LGR A;  2D3C A;  3AB5 A;  1NI2 A;  2X38 A;  4E74 A;  4MGK E;  1FXI A;  3ZUN A;  4E71 A;  1GFM A;  4FUV A;  2R4L A;  3PQU A;  3DA3 A;  3AH7 A;  4OZA A;  2MBO A;  2MBB B;  1R7S A;  3UI3 A;  2KVZ A;  2I38 A;  2DX5 B;  1WM3 A;  4P6V F;  4S17 A;  5DPR A;  2LFI A;  3SY7 A;  1QKZ A;  1MG4 A;  1UWM A;  5C1Z A;  1NEK B;  3DPD A;  1V5T A;  4O3X B;  3V8U A;  3D32 A;  1TKY A;  1MM5 A;  1RYJ A;  1WXQ A;  3ZQ4 A;  4MGI E;  3T0S A;  3RPF C;  4ITK A;  1WJ6 A;  3SZD A;  2M1M A;  1QOA A;  2KDF B;  2LGD A;  1IUE A;  1C4A A;  1Q9G A;  1GUA B;  2JMM A;  1OEY A;  4KGR A;  1WGR A;  1WXA A;  3DWM A;  3K9P B;  2IWV A;  2QIE B;  1G90 A;  4HDQ A;  1ZXH A;  4LNN A;  4MH8 A;  4WWN A;  3CMM B;  3OLM D;  2K6D B;  2K8H A;  3Q8C A;  5IAA C;  2WDQ B;  4C7Y A;  1PUT A;  1RFA A;  4ZOH C;  1THQ A;  1BUI C;  2M06 A;  3ALB A;  1WE7 A;  3KVD D;  3Q8A A;  3KVF B;  2K6Q A;  4AKR A;  2K39 A;  1QF6 A;  4B6W A;  3M3J A;  3DQV A;  3W1S C;  4AYI D;  2O2V B;  4FZN A;  1ZDX A;  3RMK C;  1IP9 A;  1T6B X;  2OJR A;  3LK4 1;  3N3K B;  3IFW B;  2KDY A;  3QWZ B;  1C79 A;  1VZ8 A;  3IT4 B;  3B0A A;  2EMT A;  3PGU A;  2LMC A;  3AA7 A;  1ZHX A;  3AE4 B;  4JCH A;  4BBN C;  2KTF A;  2MJ3 A;  2WXR A;  3PZD A;  4HWI B;  2FNJ B;  4XWT A;  2L0F A;  5JXV A;  2GB1 A;  4HKQ A;  1HQR D;  4ZRJ A;  3KWL A;  1MPF A;  2DHZ A;  4M8M A;  1QOF A;  4A8X C;  2RDB C;  2K25 A;  2BW2 A;  2M0A A;  2V3S A;  4U9C A;  4D2K A;  1IYF A;  5D94 A;  1WMH A;  2KAN A;  2K8C A;  1ZHY A;  4A3P A;  3AXC A;  2QC8 A;  2RPQ A;  3ZXR A;  3T8M A;  2WXJ A;  1BH3 A;  1F77 A;  1FFU A;  2DZJ A;  2QEJ C;  3MFG A;  1LXD A;  5LLI A;  3GZN B;  1MFW A;  3RUI B;  3PVL A;  5HHD G;  1VD2 A;  3AMZ A;  4NNJ B;  1UEL A;  1HZ6 A;  3EUB 2;  3X0W A;  1ISN A;  1N60 A;  4IWO A;  4LNI A;  1FEH A;  3POU A;  4WJQ A;  3W5V B;  3ZVV A;  5AFU K;  3PF1 A;  4OVU A;  3DOW A;  3N1Y C;  1M4V A;  2LVP A;  2L52 A;  3WAP A;  2XE5 A;  4WQO B;  2NTS A;  4LNO A;  2KNB A;  3M63 B;  4MDK E;  2IZV B;  2B3A A;  4USA A;  3HK0 A;  2SEB D;  4XC2 A;  3A1Q A;  3ZJT A;  1GC7 A;  2CHX A;  5EE9 A;  1KLV A;  1OEY J;  1T0Q C;  2WXP A;  1IBX B;  3AE1 B;  5IKC M;  1HTO A;  1TY2 A;  2C60 A;  3EMN X;  2KTR A;  4ICU A;  3RNE C;  1OQR A;  4RNA A;  2MRP A;  2KDI A;  4HEA 1;  1IPG A;  3R7R A;  3GZN I;  3FC4 A;  3AE8 B;  1I4Q A;  3PHW B;  2ICI A;  1OQY A;  2KZ7 A;  5TIS O;  4W9K A;  3POR A;  3BRZ A;  2BYV E;  3R8B A;  2AYO B;  2BB6 A;  3MJ5 A;  2J7Q B;  2JSV X;  4ANV A;  4GDK A;  1C4C A;  1WSP A;  4RMA A;  1WR6 E;  2MCN B;  3GOE A;  2FCS A;  4RJX A;  2D07 B;  4KZC A;  2J0M A;  4JQW C;  3UAQ A;  3DA4 A;  4LSH A;  4NQL B;  4ARC A;  2MH7 A;  1YOV B;  1H6S 1;  5GTH O;  5EE2 A;  3AA1 B;  4EZL A;  2ZFG A;  3H8H A;  2V3P A;  1Q9F A;  4GLS C;  3ZTC A;  2UU7 A;  1I4X A;  3TCA A;  3VH4 B;  4A20 A;  2PVG C;  1B9R A;  2W55 A;  3AE5 B;  3AE7 B;  3IXS A;  2BYT A;  4P1B C;  2L0T A;  3B2F A;  4AUI A;  3VQI A;  3NJT A;  4CO7 A;  1BT9 A;  2UYZ B;  3VUY A;  1WIA A;  3RZF A;  2X8X X;  2KC2 A;  5BMH A;  4YXD B;  1JRU A;  4HLE A;  2L1A A;  4YWG G;  2PKO A;  4ICV A;  2C7N B;  4GCS A;  4WWO A;  1WE6 A;  2KQ4 X;  1WJU A;  2D10 A;  4Q2J A;  2H89 B;  1G6J A;  3QRA A;  3ML8 A;  4KVG B;  2BWE S;  2KC1 A;  1AAR A;  4IKG A;  3NVZ A;  5GTI O;  5G38 A;  3CSF A;  3PHX B;  3MP9 A;  1R4N B;  2RD0 A;  2K22 A;  1GB4 A;  4TV3 A;  2KFJ A;  4EFO A;  5DL6 A;  2QJL A;  3W9C B;  2W3R A;  3DHG C;  4K7S A;  1SGH A;  3DDC B;  1PFD A;  2G4D B;  4NJC A;  2JX5 A;  3P4S B;  2CU1 A;  4FOZ A;  5J2R A;  2M19 A;  2L8J A;  3FIL A;  3HOE A;  2MLB A;  1I4G A;  3ZRC A;  4AYE C;  1RRB A;  1FXT B;  4DXG A;  4EUT A;  4BVU C;  1DYQ A;  2K1F A;  3N30 A;  2XK5 B;  2KDM A;  1YQ3 B;  3M62 B;  1UWX A;  4YSX B;  3L10 B;  4EZK A;  4XDD A;  1WWT A;  3TEY A;  3I57 A;  4AQ7 A;  1DOX A;  3AA6 A;  2BYF A;  2PMV A;  1FCC C;  1D5M C;  2NVU I;  2Y5B B;  2FUH B;  1C76 A;  1F9J A;  2M56 B;  3UGB B;  2LJI A;  3L17 A;  4KRA A;  1YS5 A;  3R66 C;  4WJP A;  2AXT O;  3DBL I;  4RF0 A;  3V62 A;  4KR8 A;  4HDO A;  4IOI E;  2HDE A;  4BKS A;  1GOZ A;  3NOB A;  1XQQ A;  1K53 A;  2BGF A;  4JLC A;  4K7W A;  1L7Y A;  5T8I A;  4I6L B;  2ZLD A;  2FCQ A;  2N9X A;  2OOB B;  2JZZ A;  4IW0 A;  2QTK A;  4WUR A;  5BYS A;  5EE1 A;  3APC A;  1L0Y B;  4DDG D;  4DDI D;  5E6O A;  5G26 A;  2KQS A;  2GI9 A;  2JVC A;  4LNF A;  1HXX A;  2C7M B;  1SIF A;  5CTR C;  1V1P A;  2WXG A;  2J1N A;  1JML A;  2RSU A;  2JT4 B;  3PO0 A;  4AWJ A;  1SF0 A;  3W1Y A;  4FZL A;  4NQK E;  2GMI C;  1J7A A;  3VH3 B;  1OTR B;  1TYG B;  3A1Q B;  2PEA A;  2LRW A;  5D2M B;  3HVZ A;  4FHJ A;  2GBR A;  2BPS A;  3UU2 A;  2L00 B;  1FO4 A;  3QIJ A;  4K7U A;  3BWU D;  2MHL A;  1PQS A;  4LK0 M;  4FRX A;  4NPN A;  1IZN B;  2XE2 A;  4MT5 A;  4FSP A;  4YTM B;  2AQ2 B;  3J9C A;  3APD A;  1ZHZ A;  1ZDV A;  1EF1 A;  3AI5 A;  2ZJD A;  4OW0 A;  2K4T A;  1E8X A;  4IM2 A;  1OPF A;  1CK1 A;  4YTN B;  2KLG A;  3TMP B;  2N1W A;  4XWW A;  5TSS A;  2V4I B;  2QIL A;  4RJW A;  3H6N A;  3WAL A;  1L2N A;  1P4T A;  5MPO A;  3LYY A;  3HWB A;  2KK8 A;  5EE0 A;  4ZRI A;  2HE7 A;  3HW9 A;  2WU2 B;  4G0N B;  4N75 A;  2BVC A;  3RNF C;  2LEK A;  2G3Q B;  1WX7 A;  2WWZ A;  3KWV A;  2ASQ A;  4ZRP A;  3U8Z A;  3ZJU A;  5D6J B;  1EM7 A;  2WXL A;  3SU8 X;  3JW0 X;  2R89 A;  3AEG B;  2KZ7 B;  3P42 A;  3BY4 B;  3L08 A;  4TQ1 A;  2W82 A;  4E1T A;  1WJ4 A;  4PS3 A;  2JQY A;  4WIP A;  3PLU A;  5DL5 A;  5H8Y E;  3Q6B A;  3AA7 B;  1WZ3 A;  3V05 A;  4US8 A;  2VH1 A;  1XLO A;  3NS1 A;  2LUE A;  5LXH A;  3IT6 B;  3UIO B;  4CTD A;  3QQ8 B;  3Q8F A;  2AQ3 B;  3AE2 B;  2WX0 A;  1P0R A;  2JRI B;  5LNK 1;  3Q8E A;  2IJ0 A;  2MEK A;  1FRD A;  1HEZ E;  1XLQ A;  2YEP F;  3BK1 A;  3AUL A;  4KGS A;  3NUH B;  4HCN B;  3NVY A;  2KQ7 A;  3VUW A;  2HTH A;  2W54 A;  1Q1O A;  4P1C C;  4WWM A;  1JWM D;  3DWO X;  5FVN A;  4TQ0 A;  5BMG A;  5JZE B;  4KKJ A;  4IL6 O;  5AUI A;  4LSF A;  3QK0 A;  1K52 A;  1JCK B;  4KZ0 A;  4M02 A;  2YEP B;  2K9X A;  4N59 A;  3KUZ A;  3NS8 A;  3VE2 A;  4UB8 O;  3I5J C;  4B61 A;  2ZCC A;  2INN E;  1WX8 A;  3L54 A;  3OWE B;  2L3Z A;  3DBR B;  5CHF A;  2CS4 A;  2XTQ A;  2DNF A;  4P7I A;  5JDP A;  1VRA B;  3VZW X;  3IAM 1;  2MX2 A;  4II2 B;  3DVG Y;  4BFR A;  1ZP0 B;  3JTY A;  2CHW A;  2Y0H A;  2LHE A;  1D5X C;  4EEW A;  1R4M I;  4RGN A;  4NAW B;  3QRC A;  1P7F A;  2LVQ A;  2K8B A;  4WAA A;  1SE4 A;  2W9N A;  4N58 A;  2JUO A;  2KZR A;  3TEZ A;  4RM8 A;  1N61 A;  2Y2X A;  5KHQ A;  2GBJ A;  2LWP A;  4A6Q A;  2KWD A;  4DXF A;  2M0X A;  1LO5 D;  1JRO A;  1C77 A;  4PR7 A;  2GRI A;  3AN1 A;  4N9F 4;  2CJO A;  1KOT A;  1WFY A;  1E90 A;  3SZV A;  2RMM A;  1UUP A;  3ZGZ A;  1HA5 A;  3A33 B;  3SY9 A;  4W9L A;  5AEK B;  3U7Z A;  1FXA A;  4N6E B;  1TZ1 A;  2KLC A;  3EFU A;  2WLB A;  4DHZ E;  2N7J A;  2IGD A;  2KDB A;  4PJ0 O;  2YNK A;  5T5F A;  2KO3 A;  3RZW C;  3VR9 B;  3DCG A; 
#chains in the Genus database with same CATH homology
 2KZ7 A;  1BML C;  1D4B A;  3POR A;  1STE A;  2PIA A;  4R3D A;  2Y5P A;  3WCQ A;  3R8B A;  1XXG A;  5IYU A;  1JWS D;  2ZW0 A;  2FGR A;  2VZK D;  1KRH A;  5C2T B;  1C9F A;  4O3W A;  4FRT A;  2BB6 A;  4B0E A;  3MJ5 A;  2JSV X;  1GFN A;  4ZRQ A;  3UPG A;  4FES A;  1VR9 A;  2J4U P;  3KQ4 A;  1I4R A;  1C4C A;  3AEF B;  1WSP A;  3GB1 A;  4MM3 B;  2SAK A;  1FMA D;  4RJX A;  2LFU A;  4A90 A;  1AYF A;  2K3U A;  2N0S B;  1GFP A;  3LK4 2;  2Z8L A;  3AED B;  2WXH A;  3P63 A;  3SEB A;  3U52 E;  2J4X A;  4QQ1 A;  3TUO A;  3Q8B A;  3UAQ A;  3DA4 A;  4LSH A;  1K51 A;  1E7P B;  1GAQ B;  4ARC A;  1SE2 A;  2NTT A;  2MH7 A;  4AFK A;  4GCP A;  4XDC A;  1FNV A;  1JRP A;  1AN8 A;  2INP E;  1H6S 1;  1FIQ A;  1ROE A;  2RDG A;  1I4H A;  1ESF A;  5EE2 A;  1EWY C;  3AA1 B;  5ADX K;  2ZFG A;  3H8H A;  3HRD D;  2V3P A;  1Q9F A;  1ORM A;  2WP9 B;  1MM4 A;  4GLS C;  3MC0 B;  1L0V B;  5D3D A;  4AYM C;  1I4X A;  2PVG C;  1XLN A;  2RDH A;  3B9J A;  1SIJ A;  4ZHO A;  1B9R A;  2W55 A;  3AE5 B;  3AE7 B;  4PT5 A;  5HFY A;  3NVV A;  2BB5 A;  3IXS A;  2BYT A;  1SJE D;  3NVW A;  2K5P A;  3B2F A;  1YNT E;  2DLB A;  1L6U A;  1FM0 D;  2K0L A;  2WDR B;  3B2G A;  1AWD A;  3SFD B;  3TSS A;  4AUI A;  3SYB A;  3VQI A;  5AFU L;  2LHF A;  3POX A;  4HRO A;  4J3O D;  3SFE B;  1C4P A;  1BT9 A;  2ONQ A;  1QOB A;  4HRS A;  4M0W A;  2XN9 C;  2BT6 A;  3VE1 A;  2M07 A;  1RM6 C;  4WH4 A;  4CQN A;  5BMH A;  4LTU A;  4YXD B;  3AAA A;  4AKR B;  4D64 A;  1ACC A;  1VJK A;  2KMM A;  2L1A A;  2PKO A;  4YWG G;  2KXP B;  4GCS A;  2KQ4 X;  3G7G A;  4NAM A;  1V8C A;  3NSG A;  4JFB A;  3P4P B;  4RF1 A;  1TZO A;  2BS2 B;  4Q2J A;  1TS4 A;  1WRI A;  5FKA C;  2H89 B;  4YT0 B;  1D5Z C;  4KGT A;  2LUM A;  3U2S C;  1TKE A;  2K0P A;  2JZP A;  3BVM A;  3IAS 1;  3QRA A;  2NMQ A;  4YTP B;  3L4P A;  2WXM A;  1VZ6 A;  5DL8 A;  2ZW1 A;  3TEX A;  4RFB A;  5FK9 C;  4G76 A;  2JQR B;  3URY A;  3GP6 A;  5FR3 A;  3A2S X;  2IGH A;  3PRN A;  4RLC A;  3VRA B;  3T20 A;  3BYT B;  3EGR A;  2GE4 A;  1SSN A;  2KAJ A;  1N62 A;  4JWU C;  1XLP A;  1PDX A;  1T5X D;  4IKG A;  3NVZ A;  2JYT A;  4FT6 A;  4BUM X;  3MP9 A;  1TY0 A;  2K22 A;  2E3T A;  2W80 C;  1MHH E;  1GB4 A;  2ACZ B;  2QMT A;  3SR6 A;  5DL6 A;  3C5O A;  2AX5 A;  1EWC A;  2QJL A;  2V3N A;  2W3R A;  3W9C B;  2FE8 A;  1PFD A;  4YSY B;  5D3I B;  4NJC A;  2J52 A;  1N5W A;  2JX5 A;  2MJD A;  3P4S B;  5C3J B;  5BYR A;  1ET9 A;  5BYQ A;  4FOZ A;  3LK2 B;  4RGM A;  4TMA B;  1L6V A;  2G1E A;  2M19 A;  3AE9 B;  3VZU X;  1YMH E;  3BK2 A;  3DWG C;  3FIL A;  4O1N A;  4A55 A;  3HOE A;  1F2R C;  1XEE A;  1I4G A;  1ZUD 2;  2LHD A;  4HKZ E;  5G5H A;  4AYE C;  2PLP A;  4LLG M;  1TJE A;  4Z3T A;  4XE0 A;  3AEB B;  3T3O A;  3W2D A;  4DXG A;  4O49 A;  2G9H D;  4L2Y A;  2XNA C;  3AM9 A;  1DYQ A;  4MAC A;  3AEC B;  4AKM A;  1JWA D;  3WI5 A;  4FMS A;  3AEE B;  1YQ4 B;  3T3N A;  3C8Y A;  2KDM A;  4RGO S;  1YQ3 B;  2LGI A;  1KF6 B;  1UWX A;  4YSX B;  3PZ7 A;  3LK2 A;  4C69 X;  3AEA B;  1HXY D;  1L4Z B;  1FNU A;  3POQ A;  4XDD A;  5AUK A;  3ZJV A;  2L83 A;  2WQY B;  1WWT A;  3TEY A;  3FIL B;  3I57 A;  4JE3 B;  4AQ7 A;  1DOX A;  2I2Y A;  3AA6 A;  2PMV A;  1FCC C;  1JW9 D;  3LXF A;  1TS2 A;  1D5M C;  3BYY B;  1SB3 C;  4OZB A;  1C76 A;  1N5X A;  2M56 B;  2AQ1 B;  2IDY A;  1V1P B;  2LJI A;  1IGD A;  3NRZ A;  4KRA A;  4RL9 A;  2HTM E;  1YS5 A;  4D65 A;  2VZK B;  4DQO C;  4IDI A;  4L23 A;  3NZ3 A;  4UDU C;  2JXT A;  4RF0 A;  4KR8 A;  2CU3 A;  4IOI E;  1DOI A;  4G75 A;  3AAE B;  2ERV A;  3PQS A;  2HDE A;  1A70 A;  2N9L A;  2WXQ A;  1E10 A;  1GOZ A;  3AA0 A;  4D5U A;  3N9Y C;  3W1S A;  2RPV A;  1K53 A;  1VLB A;  4F4B A;  4LSE A;  2POR A;  1KH0 A;  1NVI D;  1YN4 A;  3RBH A;  1DOY A;  2IGG A;  3HUI A;  5HI1 A;  3FYX A;  3HVD A;  4AZL A;  1YN3 A;  1PGX A;  5T8I A;  2WU5 B;  2ZLD A;  4O4U A;  1JAL A;  4JX1 C;  5D7G A;  2F1V A;  3EA6 A;  3VR8 B;  5G5G A;  1NYR A;  3E9S A;  1KLG D;  2QTK A;  1N63 A;  4WUR A;  5BYS A;  1EU4 A;  1HXT A;  5EE1 A;  3AAA B;  2OED A;  4ARI A;  1XCQ L;  1L0X B;  1L0Y B;  4B0M A;  2XG6 A;  1GB1 A;  1XCT L;  3FAH A;  2KXP A;  4FSO A;  1QJP A;  4WQM A;  4NZL B;  1QLB B;  4O4X A;  5G26 A;  1K50 A;  2GI9 A;  3CWI A;  2F1T A;  4C7Z A;  1HXX A;  1JQ4 A;  6PRN A;  1J7B A;  2BS4 B;  1JWU D;  2N9K A;  4XNK A;  1V1P A;  2WXG A;  2J1N A;  1JML A;  3PO0 A;  2J53 A;  2V0G A;  1Q10 A;  2W81 C;  4PUX A;  2YPV A;  1SF0 A;  4FZL A;  2JWU A;  1ET6 A;  4OZC A;  1J7A A;  1ZE3 D;  1GFO A;  1TYG B;  5ADX L;  1XF5 L;  1SXT A;  4OHJ A;  4GDL B;  1RFK A;  2DYM A;  1BXW A;  4TSS A;  1PHO A;  3HVZ A;  3Q69 A;  2JYE A;  3BVG A;  2H88 B;  1ZOY B;  1FD6 A;  3UU2 A;  1Y56 A;  4KKI A;  4RLB A;  2PW9 A;  4H2A A;  1FO4 A;  3AA1 A;  1JWB D;  1VDV A;  2D5G A;  3R2T A;  1KLU D;  2WS3 B;  3BWU D;  4LSI A;  2MHL A;  4YSZ B;  2TSS A;  1SJH D;  4LK0 M;  1XO3 A;  4FRX A;  3ZYY X;  2WXO A;  1IZN B;  2XE2 A;  2MJE A;  3AB5 A;  4FSP A;  4MT5 A;  4YTM B;  2AQ2 B;  1V1O A;  4WAF A;  1E0Z A;  3J9C A;  2X38 A;  1B1Z A;  3ABV B;  1E54 A;  1FXI A;  1ZHZ A;  1ZDV A;  2BBC A;  1GFM A;  4L1B A;  3U4E G;  4FZM A;  1PGB A;  4OW0 A;  3KLS X;  4FXC A;  2K4T A;  1ZHT A;  2Y0K A;  4FUV A;  1CQV A;  4REZ A;  1OPF A;  1UNS A;  3PQU A;  3DA3 A;  1CK1 A;  3AH7 A;  5E6J A;  3V3X A;  4OZA A;  4YTN B;  1QQR A;  1R7S A;  3UI3 A;  1FRR A;  1TKG A;  2FUG 1;  2I38 A;  3BZD B;  3ETR A;  4HJG E;  4P6V F;  1MHX A;  4C56 C;  2LFI A;  1OFF A;  4XWW A;  5TSS A;  4GF4 A;  3AA6 B;  3SY7 A;  1QKZ A;  2QIL A;  4RJW A;  2V4I B;  1TS3 A;  1UWM A;  3VR9 B;  1NEK B;  1P4T A;  5MPO A;  3LYY A;  3HWB A;  1CZP A;  4O3X B;  3V8U A;  1TS5 A;  1TKY A;  1NYQ A;  1MM5 A;  1RYJ A;  1WXQ A;  3VZT X;  3ZQ4 A;  4RNA A;  1FCL A;  1QIL A;  3T0S A;  5EE0 A;  5D5D A;  2Y3A A;  4A9A A;  1F0Z A;  2OMF A;  3HW9 A;  2WU2 B;  3RPF C;  4ITK A;  3P4Q B;  1OSM A;  2Q5W D;  2LEK A;  3SZD A;  2WXF A;  1QOA A;  1YN5 A;  1IUE A;  1C4A A;  3KWV A;  1Q9G A;  1SE3 A;  1V97 A;  4ZRP A;  2JMM A;  4KGR A;  3ZJU A;  1EM7 A;  3DWM A;  2N2M A;  2WXL A;  2OHF A;  2QIE B;  1KTK A;  3AEG B;  2KZ7 B;  3O0E A;  1G90 A;  2BS3 B;  3P42 A;  2CJN A;  5GXG B;  1ZXH A;  4MH8 A;  2MNH A;  1NI3 A;  2FBW B;  4TQ1 A;  1OQQ A;  1ZXI A;  2W82 A;  4E1T A;  4RGT A;  2FGQ X;  2DBY A;  2EKI A;  3MHZ A;  4P16 A;  3Q8C A;  4WIP A;  3LK3 A;  2WDQ B;  1PUT A;  3AE6 B;  4C7Y A;  4ZOH C;  5DL5 A;  1THQ A;  1BUI C;  5H8Y E;  3AA7 B;  3V05 A;  2M06 A;  1QT9 A;  4US8 A;  4AYD C;  1WGK A;  3TZG A;  1C78 A;  3KVD D;  1P7E A;  1F2R I;  4O3Y A;  1XLO A;  1I7H A;  3NS1 A;  3Q8A A;  4AKR A;  4O3Z A;  3IT6 B;  4JPS A;  3AAE A;  1QF6 A;  3WI4 A;  2ODJ A;  2KAC A;  4KR4 A;  3T24 A;  3Q8F A;  2J42 A;  4AS1 A;  1GFQ A;  4FZN A;  5DL7 A;  4AYI D;  1ZDX A;  1PRN A;  2AQ3 B;  2WXK A;  5GV0 A;  3AE2 B;  1ZHW A;  1T6B X;  3BII D;  3W5U B;  4GCQ A;  5LNK 1;  3LK4 1;  1FNW A;  3Q8E A;  2KDY A;  2PTL A;  1C79 A;  5PRN A;  1VZ8 A;  2IJ0 A;  1J7C A;  1FRD A;  1HEZ E;  2MEK A;  4EE2 A;  1XLQ A;  2YEP F;  3IT4 B;  1E9M A;  2R61 A;  3BK1 A;  4KGS A;  3LK3 B;  1SEB D;  3BVZ A;  2JU6 X;  3NUH B;  7PRN A;  5HG2 A;  3NVY A;  2IPK D;  5I4D A;  1T3Q A;  1QJ9 A;  2LMC A;  3AA7 A;  3I9V 1;  1ZHX A;  1AW7 A;  1D6E C;  1DGJ A;  2L32 A;  2W54 A;  2DYO A;  3AE4 B;  4JCH A;  1I4P A;  4C80 A;  3GS2 A;  2MJ3 A;  1YJI A;  2WXR A;  4WWM A;  1JWM D;  4XWT A;  5EE3 A;  3TEW A;  5JXV A;  5FVN A;  4TQ0 A;  2GB1 A;  5BMG A;  4HKQ A;  1HQR D;  4JWS C;  1IZN A;  1BXT A;  3CIR B;  3KWL A;  4KKJ A;  1MPF A;  2DWQ A;  3AE3 B;  1QOF A;  2QSD A;  5AUI A;  4LSF A;  1FFV A;  1PGA A;  4A8X C;  4RCO A;  1PYW D;  2BW2 A;  1K52 A;  1JCK B;  2M0A A;  2YEP B;  1VZ7 A;  4N59 A;  2K9X A;  4U9C A;  3FC4 A;  8PRN A;  2XE3 A;  4D2K A;  3VE2 A;  4OVZ A;  1HXU A;  4B61 A;  4RH6 A;  2INN E;  2PRN A;  2WNM A;  1EU3 A;  4E1S A;  2XMX A;  1ZHY A;  3OWE B;  2PVO D;  1QJ8 A;  3R2I A;  4GHB A;  2XTQ A;  1MPE A;  1IBX A;  1QOG A;  2WXJ A;  5JDP A;  1VRA B;  1BH3 A;  3VZW X;  1F77 A;  1FFU A;  2QEJ C;  3IAM 1;  2XTR A;  1SBB B;  3MFG A;  3GP7 A;  1ZP0 B;  3JTY A;  2Y0H A;  2LHE A;  1D5X C;  1ZPS A;  5HHD G;  4XNL A;  3AMZ A;  2O4V A;  3SYS A;  4RGN A;  2Y0L A;  2WXN A;  2XE1 A;  1L5P A;  4NAW B;  2BTE A;  1HZ6 A;  3QRC A;  3EUB 2;  1N60 A;  1P7F A;  2KC0 A;  2X27 X;  1FEH A;  3POU A;  1SE4 A;  3VY9 X;  3LB8 C;  3E56 A;  3PZ8 A;  4N58 A;  3W5V B;  3TEZ A;  5AFU K;  1N61 A;  2Y2X A;  2Y5C A;  1UGJ A;  1M4V A;  4A6Q A;  1WYG A;  1L4D B;  2L52 A;  2KWD A;  1IGC A;  4DXF A;  2WDV B;  3VY8 X;  3AA0 B;  1HZ5 A;  4GDK B;  1LO5 D;  2XE5 A;  1JRO A;  3P4R B;  1C77 A;  2NTS A;  4KX6 B;  1YJJ A;  2GRI A;  3AN1 A;  1RWS A;  1E6E B;  2B76 B;  1KFY B;  1GPX A;  2CJO A;  3SZV A;  2RMM A;  1UUP A;  4USA A;  5BMI A;  2SEB D;  3K19 A;  2ON8 A;  3ZGZ A;  1HA5 A;  3VRB B;  3ZJT A;  5EE9 A;  3SY9 A;  4ZYS A;  2N2L A;  3AV8 A;  2WXP A;  1FXA A;  4N6E B;  1ENF A;  3U7Z A;  3AE1 B;  1IBX B;  5H92 C;  3P1M A;  2WLB A;  2EEL A;  3HOL A;  1TY2 A;  2KN4 A;  4ZHP A;  3EMN X;  3RFZ B;  1OQR A;  1MVK A;  2E6X A;  2N7J A;  2Y7S A;  1CJE A;  1NEN B;  2IGD A;  2W3S A;  2WXI A;  3O13 A;  4HEA 1;  2YNK A;  5T5F A;  4AYN A;  1MI0 A;  4US9 A;  3AE8 B;  1I4Q A;  2ICI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...