4N5EA

42f3 tcr pcpa12/h-2ld complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
174
structure length
174
Chain Sequence
PHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQIAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQWMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural interplay between germline interactions and adaptive recognition determines the bandwidth of TCR-peptide-MHC cross-reactivity.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
molecule keywords 42F3 alpha VmCh
total genus 52
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2013-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4n5eA00
4PRAA 3I6KA 3VFMA 4V3DB 3PQYA 5MENA 2RFXA 1JFMA 3AU1A 5HHNA 2ZSWA 4ONOA 1WBZA 3FRUA 3SPVA 1DUZA 3SKMA 4WDIA 1MWAH 4PJHA 1EEYA 5EFIA 4JFQA 3MREA 4HX1A 4ZUTA 1U58A 3KYNA 4ZUWA 4PJBA 4QRPA 4PJ7A 4PREA 3QQ3A 3C9NA 3ECBA 3VXMA 3DX7A 5EU5A 3X14A 5FKPA 3DX6A 3VXUA 4PJGA 2ZOKA 2V2XA 3WS6A 2FIKA 4QRUA 3TIDA 1DDHA 4D0BA 3RL2A 1S7UA 5GSVA 4X6EA 3D39A 1S9XA 3WL9A 4U1MA 5INCA 3GSNH 5GSRA 1I1FA 3RWDA 2HJKA 3TBYA 3UTQA 1P7QA 5L2KA 3HE6A 1OGAA 1K8DA 4HS3A 2P5WA 3QI9A 3MRPA 4K7FA 3X12A 2CLRA 1GZQA 2GT9A 4PRDA 3O4LA 5E8PA 5C0AA 1X7QA 5DEGA 4MJIA 4JRXA 2A83A 3KPNA 3P77A 3KWWA 1AGBA 1JPFA 4X6CA 4G59A 4QRQA 4QRRA 5C0CA 3I6GA 3PWJA 5IB3A 4WU5A 1PQZA 3RWJA 4MQ7A 1QLFA 5C09A 3SDXA 3E3QA 3C8KA 1QR1A 2XPGA 1KBGH 2C7UA 3MGTA 1T1ZA 3MRFA 3GSRA 2BVPA 3V5DA 1T0MA 4CVXA 1N59A 5EOTA 3VXRA 1JHTA 1I7UA 3MRKA 3GSXA 2X4RA 1RJYA 1KJMA 4QRTA 5IM7A 1VGKA 3DXAA 1FZOA 3P4OA 4NQEA 3BEWA 5C08A 1JUFA 1KJVA 3VCLA 3TJHA 1KJ2H 3QDMA 1A9BA 4PJ8A 1AGDA 4JFEA 5D7IA 1QSFA 4NNYA 1YDPA 2ZOLA 3BEVA 4MJ5A 5HGAA 3UTTA 1EFXA 3AM8A 3CC5A 4GKSA 3D3VA 4JFFA 1LP9A 4GUPA 5C9JA 1FO0H 1HSAA 3GSWA 4G8IA 3P4NA 4G8GA 5HHMA 3LV3A 3O3AA 1CE6A 3VXNA 1HHGA 3KPSA 3LKNA 1S7TA 5D2LA 1ZHLA 5EO1A 3VXOA 5BJTA 2VLKA 4NO3A 4JQVA 3IT8D 2VABA 1HHJA 1INQA 3E6HA 3P73A 3WLBA 4D0CA 5SWQA 3TF7A 1GZPA 1ZAGA 3KPQA 5EU3A 3RWIA 1NEZA 4Y2DA 3MRCA 1KTLA 3VFSA 3FOLA 4O2FA 5FA4A 1M6OA 3TN0A 3GSQA 1T80A 1UXSA 1CD1A 5F7DA 3L9RA 2YPLA 2X4SA 5C0FA 3V5HA 4PRBA 1A6ZA 4Y16A 5E8NA 3O3DA 3FQNA 1ZT7A 1EEZA 4FTVA 3ES6A 4PRHA 2YEZA 5C0EA 1BZ9A 4N0UA 3MV8A 1MHCA 1IM3A 1W72A 4Z78A 3O9WA 3H7BA 4MXQA 1JF1A 1VACA 5BRZA 2V2WA 1KCGC 3MRDA 5HHQA 5IB1A 1AGCA 1ONQA 2H6PA 4UQ2A 1HSBA 3HE7A 3CZFA 5EU4A 4NO0A 4XXCA 4CW1A 2VLLA 4WO4A 4PJ5A 3VFRA 3MGOA 1TVHA 1N3NA 1QEWA 4NO5A 4PJFA 4N5EA 3L3IA 5HGBA 3MRMA 5BS0A 4MX7A 1HHKA 4I4WA 4MNQA 3TZVC 1A1MA 3D2UA 3P4MA 2BNQA 3MRBA 1E27A 4L3CA 4HUUA 3H9HA 4ZUVA 5IB5A 1S9WA 1T1YA 4PGEA 3ARFA 4Z77A 3FQXA 3VFUA 5MEQA 5E8OA 4PRNA 1FFOA 1FZKA 4PGBA 1KPUA 5MEOA 3BGMA 1QVOA 5J6GA 3DBXA 4QOKA 4PJDA 1JGEA 5ISZA 2VLRA 1Z5LA 2Q7YA 1ZSDA 1HHHA 4JRYA 2VE6A 1YPZA 3MYJA 4PJAA 3TO2A 3PWNA 3HUJA 3BWAA 4HUXA 4PG2A 5DEFA 3GMRA 1RJZA 3BZFA 4U1JA 1ED3A 5C0BA 1S7WA 2X4NA 4PRPA 1T1WA 4MJ6A 3UBXA 1IM9A 1MHEA 3T1FA 2GTZA 2FYYA 1T7WA 3RL1A 4G9FA 3TIEA 3PABA 4N8VA 4NT6A 3LKSA 4APQA 2X4UA 3M17A 4U1LA 3PWLA 2AV1A 2BVQA 3O3EA 4PG9A 1P4LA 3LKOA 3QEQA 3CDGA 4U6YA 1TMCA 5HGHA 5D7JC 5HGDA 1NANH 5SWSA 5F1NA 1W0VA 4LHUA 5C07A 4PP8C 3RUGA 5B38A 3FT3A 4WUUA 4ZUUA 1OSZA 1P1ZA 3O3BA 5C0GA 4L29A 1KJ3H 3HG1A 3W0WA 5D9SA 3REWA 3TFKA 4NQVA 3HAEA 2AXFA 3KLAA 3BO8A 4U1IA 1XR8A 2GJ6A 3OV6A 3QDGA 4K71B 3L3HA 4LCCC 1I4FA 2ESVA 3LKQA 4ZAKA 2X70A 4IRSA 5IB2A 1YN6A 4GKNA 1QRNA 3FONA 3MR9A 5C0DA 5EU6A 5IVXA 5SWZA 4PGCA 3QDJA 5EO0A 2VAAA 3O8XA 1AKJA 1T1XA 3ROOA 2VLJA 4U1HA 1N2RA 1QQDA 3KYOA 1S9YA 1YN7A 4G43A 2CLVA 3BH8A 2FZ3A 2E7LE 5ACZA 1MI5A 3TBTA 3VRJA 1LD9A 2CLZA 2X4PA 1T20A 3U0PA 5IEHA 3V5KA 5E9DA 2H26A 3X11A 3DTXA 4PR5A 5D5MA 1OF2A 1BQHA 1S7VA 3OXRA 2BNRA 1AGFA 4MNGA 1S8DA 2CIIA 2MHAA 2GUOA 5HYJA 1T7ZA 3MRQA 3QUYA 4L4VA 1B0GA 1S7RA 5J1AA 3TPUE 4LCYA 3MRNA 1BIIA 3QFJA 3FTGA 3FQUA 3L3DA 5L2JA 3B6SA 1FFNA 3JVGA 3L3KA 1K5NA 2BSTA 2X4QA 1EXUA 3MA7A 4MVBA 1E28A 3S6CA 5FDWA 4L8BA 3IXAA 1I7RA 2WY3A 4JQXA 4PDCE 1S7QA 2P5EA 2CKBH 5DDHA 3TBWA 3VRIA 3MV7A 3P9MA 3BZEA 1N5AA 1ZHKA 3D18A 3JTTA 1LEKA 4F7CA 3D25A 1XR9A 5HHPA 2F54A 5MEPA 1B0RA 3FQWA 4FFEX 4MS8A 3VXSA 2AXGA 2JCCA 4EUPA 2J8UA 3VXPA 4WWKC 3GJFA 3MRLA 2F74A 2PO6A 3ERYA 3ARDA 3WUWA 3FT2A 3GSOA 4NSKA 4UQ3A 2OI9A 3KPMA 1ZS8A 3MROA 4G42A 3RWFA 4L3EA 2F53A 3JTCA 4X6DA 3RZCA 3FQTA 1TVBA 1A1OA 3OX8A 3CVHA 3GMQA 4PJXA 2X4OA 2PYEA 3GSVA 4X6FA 2ZSVA 1ZT4A 4G9DA 1FFPA 1HOCA 5HHOA 5D2NA 4HKJA 3OXSA 3QUXA 3BVNA 1QSEA 1VADA 1I1YA 4E5XA 3I6LD 3BXNA 3KPRA 4L9LC 2YPKA 3BUYA 3VFOA 3CH1A 3TA3A 5C0JA 2GITA 3MRRA 4EI5A 4U1SA 4ZUSA 2AV7A 3VH8A 4ELMA 1S7SA 2OL3H 3GMMA 4L8SC 1KPVA 2CIKA 3ILQC 1R3HA 3M1BA 4NQDA 3WS3A 3MRHA 1JE6A 3H9SA 3QUKA 3P9LA 5AD0A 3FT4A 1JGDA 4HWZA 4F7PA 3GMLA 1BD2A 3BP7A 4I48A 3MV9A 4O2CA 5E6IC 4N0CA 3ARGA 5D7LA 1ZVSA 4WW2C 3RWEA 3BH9A 3VWKA 2HJLA 1RK0A 3AREA 3B3IA 1LK2A 4U6XA 4L8CA 3VFVA 3VJ6A 2AK4A 3KXFA 4IRJA 1FZJA 1OGTA 3X13A 2HN7A 1XH3A 2FO4A 3VFPA 3UPRA 1G6RH 3RTQA 4D0DA 5B39A 1LDPH 1HHIA 3KPLA 1HYRC 5IB4A 2BVOA 4JFOA 1WBXA 3MRIA 4O2EA 3LKPA 4Y4KA 3LN5A 1JPGA 1I1AA 1UQSA 3HCVA 3TO4A 1G7QA 2D31A 2GTWA 3PWUA 4NO2A 3BHBA 1AGEA 4L4TA 3RWGA 3NFNA 4CVZA 3E6FA 5F1IA 4QRSA 3G08A 4HUWA 1M05A 4PJCA 5H94A 5EUOA 3SDDA 1ZT1A 3CCHA 4JFDA 2DYPA 3QZWA 1SYSA 3JTSA 4NHUE 5MERA 3KPPA 4Y4HA 3KPOA 1FG2A 1NAMH 1I7TA 5ENWA 4S0UC 1T22A 4EN3C 4N0FA 4WU7A 1LEGA 1SYVA 1XZ0A 2FWOA 4ZFZA 3LKRA 3HLAA 1S7XA 4PGDA 5IROA 4F7EA 3W39A 3T8XA 1L8JA 5INDA 3VWJA 3E2HA 4HUVA 3GSUA 3GMPA 4IHOA 4HV8A 3L3JA 3SDCA 1B3JA 1A9EA 4E0RA 3PWPA 3LN4A 3SJVA 1T7XA 2X4TA 3GIVA 3L3GA 3FQRA 3TBVA 3BW9A 2AKRA 4PV9A 4PV8A 3SCMA 3DMMA 1T7YA 2NW3A 2XFXA 3UTSA 3TBSA 1T0NA 2BSRA 3GMOA 3HPJA 4WJ5A 2UWEA 3FFCA 3ARBA 1T7VA 5FA3A 2NX5A 3VFWA 4U1NA 1ZHNA 1RK1A 2BCKA 3QUZA 1C16A 4F7MA 1UXWA 5JHDA 1CG9A 1T21A 5C0IA 1KPRA 4LCWA 1WBYA 4PRIA 3MRJA 3RWCA 3QULA 3VFNA 3MRGA 3QFDA 4U1KA 4NQCA 1G7PA 1AO7A 1LQVA 2BSSA 4Y4FA 1Q94A 3RGVC 3TVMA 5J6HA 3VFTA 4V3EB 5IEKA 3SKOA 4JFPA 4Z76A 4F7TA 3PWVA 4L8DA 2HLAA 1DUYA 4IIQC 2GAZA 3QQ4A 5F9JA 5BXFA 3ROLA 4NQXA 1W0WA 3SDAA 1A1NA 3BP4A 3DX8A 1QO3A 1ZHBA 4NNXA 4PJ9A 3ILPA 5E00A 3GMNA 3RWHA 3FOMA 1FZMA 4PJIA 4LNRA 4PJEA 1DE4A 3CPLA
chains in the Genus database with same CATH superfamily
4PRAA 3I6KA 3VFMA 4V3DB 3PQYA 5MENA 2RFXA 1JFMA 3AU1A 5HHNA 2ZSWA 4ONOA 1WBZA 3FRUA 3SPVA 1DUZA 3SKMA 4WDIA 1MWAH 4PJHA 1EEYA 5EFIA 4JFQA 3MREA 4HX1A 4ZUTA 4JO8A 1U58A 3KYNA 4ZUWA 4PJBA 4QRPA 4PJ7A 4PREA 3QQ3A 3C9NA 3ECBA 3VXMA 3DX7A 5EU5A 3X14A 5FKPA 3DX6A 3VXUA 4PJGA 2ZOKA 2V2XA 3WS6A 2FIKA 4QRUA 3TIDA 1DDHA 4D0BA 3RL2A 1S7UA 5GSVA 4X6EA 3D39A 1S9XA 3WL9A 4U1MA 5INCA 3GSNH 5GSRA 1I1FA 3RWDA 2HJKA 3TBYA 3UTQA 1P7QA 5L2KA 3HE6A 1OGAA 1K8DA 4HS3A 2P5WA 3QI9A 3MRPA 4K7FA 3X12A 2CLRA 1GZQA 2GT9A 4PRDA 3O4LA 5E8PA 5C0AA 1X7QA 5DEGA 4MJIA 4JRXA 2A83A 3KPNA 3P77A 3KWWA 1AGBA 1JPFA 4X6CA 4G59A 4QRQA 4QRRA 5C0CA 3I6GA 3PWJA 5IB3A 4WU5A 1PQZA 3RWJA 4MQ7A 1QLFA 5C09A 3SDXA 3E3QA 3C8KA 1QR1A 2XPGA 1KBGH 2C7UA 3MGTA 1T1ZA 3MRFA 3GSRA 2BVPA 3V5DA 1T0MA 4CVXA 1N59A 5EOTA 3VXRA 1JHTA 1I7UA 3MRKA 3GSXA 2X4RA 1RJYA 1KJMA 4QRTA 5IM7A 1VGKA 3DXAA 1FZOA 3P4OA 4NQEA 3BEWA 5C08A 1JUFA 1KJVA 3VCLA 3TJHA 1KJ2H 3QDMA 1A9BA 4PJ8A 1AGDA 4JFEA 5D7IA 1QSFA 4NNYA 1YDPA 2ZOLA 3BEVA 4MJ5A 5HGAA 3UTTA 1EFXA 3AM8A 3CC5A 4GKSA 3D3VA 4JFFA 1LP9A 4GUPA 5C9JA 1FO0H 1HSAA 3GSWA 4G8IA 3P4NA 4G8GA 5HHMA 3LV3A 3O3AA 1CE6A 3VXNA 1HHGA 3KPSA 3LKNA 1S7TA 5D2LA 1ZHLA 5EO1A 3VXOA 5BJTA 2VLKA 4NO3A 4JQVA 3IT8D 2VABA 1HHJA 1INQA 3E6HA 3P73A 3WLBA 4D0CA 5SWQA 3TF7A 1GZPA 1ZAGA 3KPQA 5EU3A 3RWIA 1NEZA 4Y2DA 3MRCA 1KTLA 3VFSA 3FOLA 4O2FA 5FA4A 1M6OA 3TN0A 3GSQA 1T80A 1UXSA 1CD1A 5F7DA 3L9RA 2YPLA 2X4SA 5C0FA 3V5HA 4PRBA 1A6ZA 4Y16A 5E8NA 3O3DA 3FQNA 1ZT7A 1EEZA 4FTVA 3ES6A 4PRHA 2YEZA 5C0EA 1BZ9A 4N0UA 3MV8A 1MHCA 1IM3A 1W72A 4Z78A 3O9WA 3H7BA 4MXQA 1JF1A 1VACA 5BRZA 2V2WA 1KCGC 3MRDA 5HHQA 5IB1A 1AGCA 1ONQA 2H6PA 4UQ2A 1HSBA 3HE7A 3CZFA 5EU4A 4NO0A 4XXCA 4CW1A 2VLLA 4WO4A 4PJ5A 3VFRA 3MGOA 1TVHA 1N3NA 1QEWA 4NO5A 4PJFA 4N5EA 3L3IA 5HGBA 3MRMA 5BS0A 4MX7A 1HHKA 4I4WA 4MNQA 3TZVC 1A1MA 3D2UA 3P4MA 2BNQA 3MRBA 1E27A 4L3CA 4HUUA 3H9HA 4ZUVA 2IA1A 5IB5A 1S9WA 1T1YA 4PGEA 3ARFA 4Z77A 3FQXA 3VFUA 5MEQA 5E8OA 4PRNA 1FFOA 1FZKA 4PGBA 1KPUA 5MEOA 3BGMA 1QVOA 5J6GA 3DBXA 4QOKA 4PJDA 1JGEA 5ISZA 2VLRA 1Z5LA 2Q7YA 1ZSDA 1HHHA 4JRYA 2VE6A 1YPZA 3MYJA 4PJAA 3TO2A 3PWNA 3HUJA 3BWAA 4HUXA 4PG2A 5DEFA 3GMRA 1RJZA 3BZFA 4U1JA 1ED3A 5C0BA 1S7WA 2X4NA 4PRPA 1T1WA 4MJ6A 3UBXA 1IM9A 3I0TA 1MHEA 3T1FA 2GTZA 2FYYA 1T7WA 3RL1A 4G9FA 3TIEA 3PABA 4N8VA 4NT6A 3LKSA 4APQA 2X4UA 3M17A 4U1LA 3PWLA 2AV1A 2BVQA 3O3EA 4PG9A 1P4LA 3LKOA 3QEQA 3CDGA 4U6YA 1TMCA 5HGHA 5D7JC 5HGDA 1NANH 5SWSA 5F1NA 1W0VA 4LHUA 5C07A 4PP8C 3RUGA 5B38A 3FT3A 4WUUA 4ZUUA 1OSZA 1P1ZA 3O3BA 5C0GA 4L29A 1KJ3H 3HG1A 3W0WA 5D9SA 3REWA 3TFKA 4NQVA 3HAEA 2AXFA 3KLAA 3BO8A 4U1IA 1XR8A 2GJ6A 3OV6A 3QDGA 4K71B 3L3HA 4BKWA 4LCCC 1I4FA 2ESVA 3LKQA 4ZAKA 2X70A 4IRSA 5IB2A 1YN6A 4GKNA 1QRNA 3FONA 3MR9A 5C0DA 5EU6A 5IVXA 5SWZA 4PGCA 2O5NA 3QDJA 5EO0A 2VAAA 3O8XA 1AKJA 1T1XA 3ROOA 2VLJA 4U1HA 1N2RA 1QQDA 3KYOA 1S9YA 1YN7A 4G43A 2CLVA 3BH8A 2FZ3A 2E7LE 5ACZA 1MI5A 3TBTA 3VRJA 1LD9A 2CLZA 2X4PA 1T20A 3U0PA 5IEHA 3V5KA 5E9DA 2H26A 3X11A 3DTXA 4PR5A 5D5MA 1OF2A 1BQHA 1S7VA 3OXRA 2BNRA 1AGFA 4MNGA 1S8DA 2CIIA 2MHAA 2GUOA 5HYJA 1T7ZA 3MRQA 3QUYA 4L4VA 1B0GA 1S7RA 5J1AA 3TPUE 4LCYA 3MRNA 1BIIA 3QFJA 3FTGA 3FQUA 3L3DA 5L2JA 4G59C 3B6SA 1FFNA 3JVGA 3L3KA 1K5NA 2BSTA 2X4QA 1EXUA 3MA7A 4MVBA 1E28A 3S6CA 5FDWA 4L8BA 3IXAA 1I7RA 2WY3A 4JQXA 4PDCE 1S7QA 2P5EA 2CKBH 5DDHA 3TBWA 3VRIA 3MV7A 3P9MA 3BZEA 1N5AA 1ZHKA 3D18A 3JTTA 1LEKA 4F7CA 3D25A 1XR9A 5HHPA 2F54A 5MEPA 1B0RA 3FQWA 4FFEX 4MS8A 3VXSA 2AXGA 2JCCA 4EUPA 2J8UA 3VXPA 4WWKC 3GJFA 3MRLA 2F74A 2PO6A 3ERYA 3ARDA 3WUWA 3FT2A 3GSOA 4NSKA 4UQ3A 2OI9A 3KPMA 1ZS8A 3MROA 4G42A 3RWFA 4L3EA 2F53A 3JTCA 4X6DA 3RZCA 3FQTA 1TVBA 1A1OA 3OX8A 3CVHA 3GMQA 4PJXA 2X4OA 2PYEA 3GSVA 4X6FA 2ZSVA 1ZT4A 4G9DA 1FFPA 1HOCA 5HHOA 2NYKA 4HKJA 5D2NA 3OXSA 3QUXA 3BVNA 1QSEA 1VADA 1I1YA 4E5XA 3I6LD 3BXNA 3KPRA 4L9LC 2YPKA 3BUYA 3VFOA 3CH1A 3TA3A 5C0JA 2GITA 3MRRA 4EI5A 4U1SA 4ZUSA 2AV7A 3VH8A 4ELMA 1S7SA 2OL3H 3GMMA 4L8SC 1KPVA 2CIKA 3ILQC 1R3HA 3M1BA 4NQDA 3WS3A 3MRHA 1JE6A 3H9SA 3QUKA 3P9LA 5AD0A 3FT4A 1JGDA 4HWZA 4F7PA 3GMLA 1BD2A 3BP7A 4I48A 3MV9A 4O2CA 5E6IC 4N0CA 3ARGA 5D7LA 1ZVSA 4WW2C 3RWEA 3BH9A 3VWKA 2HJLA 1RK0A 3AREA 3B3IA 1LK2A 4U6XA 4L8CA 3VFVA 3VJ6A 2AK4A 3KXFA 4IRJA 1FZJA 1OGTA 3X13A 2HN7A 1XH3A 2FO4A 3VFPA 3UPRA 1G6RH 3RTQA 4D0DA 5B39A 1LDPH 1HHIA 3KPLA 1HYRC 5IB4A 2BVOA 4JFOA 1WBXA 3MRIA 4O2EA 3LKPA 4Y4KA 3LN5A 1JPGA 1I1AA 1UQSA 3HCVA 3TO4A 1G7QA 2D31A 2GTWA 3PWUA 4NO2A 3BHBA 1AGEA 4L4TA 3RWGA 3NFNA 4CVZA 3E6FA 5F1IA 4QRSA 3G08A 4HUWA 1M05A 4PJCA 5H94A 5EUOA 3SDDA 1ZT1A 3CCHA 4JFDA 2DYPA 3QZWA 1SYSA 3JTSA 4NHUE 5MERA 3KPPA 4Y4HA 3KPOA 1FG2A 1NAMH 1I7TA 5ENWA 4S0UC 1T22A 4EN3C 4N0FA 4WU7A 1LEGA 1SYVA 1XZ0A 2FWOA 4ZFZA 3LKRA 3HLAA 1S7XA 4PGDA 5IROA 4F7EA 3W39A 3T8XA 1L8JA 5INDA 3VWJA 3E2HA 4HUVA 3GSUA 3GMPA 4IHOA 4HV8A 3L3JA 3SDCA 1B3JA 1A9EA 4E0RA 3PWPA 3LN4A 3SJVA 1T7XA 2X4TA 3GIVA 3L3GA 3FQRA 3TBVA 3BW9A 2AKRA 4PV9A 4PV8A 3SCMA 3DMMA 1T7YA 2NW3A 2XFXA 3UTSA 3TBSA 1T0NA 2BSRA 3GMOA 3HPJA 4WJ5A 2UWEA 3FFCA 3ARBA 1T7VA 5FA3A 2NX5A 3VFWA 4U1NA 1ZHNA 1RK1A 2BCKA 3QUZA 1C16A 4F7MA 1UXWA 5JHDA 1CG9A 1T21A 5C0IA 1KPRA 4LCWA 1WBYA 4PRIA 3MRJA 3RWCA 3QULA 3VFNA 3MRGA 3QFDA 4U1KA 4NQCA 1G7PA 1AO7A 1LQVA 2BSSA 4Y4FA 1Q94A 3RGVC 3TVMA 5J6HA 3VFTA 4V3EB 5IEKA 3SKOA 4JFPA 4Z76A 4F7TA 3PWVA 4L8DA 2HLAA 1DUYA 4IIQC 2GAZA 3QQ4A 5F9JA 5BXFA 3ROLA 4NQXA 1W0WA 3SDAA 1A1NA 3BP4A 3DX8A 1QO3A 1ZHBA 4NNXA 4PJ9A 3ILPA 5E00A 3GMNA 3RWHA 3FOMA 1FZMA 4PJIA 4LNRA 4PJEA 1DE4A 3CPLA
chains in the Genus database with same CATH topology
4PRAA 3I6KA 3VFMA 4V3DB 3PQYA 5MENA 2RFXA 1JFMA 3AU1A 5HHNA 2ZSWA 4ONOA 1WBZA 3FRUA 3SPVA 1DUZA 3SKMA 4WDIA 1MWAH 4PJHA 1EEYA 5EFIA 4JFQA 3MREA 4HX1A 4ZUTA 1U58A 3KYNA 4ZUWA 4PJBA 4QRPA 4PJ7A 4PREA 3QQ3A 3C9NA 3ECBA 3VXMA 3DX7A 5EU5A 3X14A 5FKPA 3DX6A 3VXUA 4PJGA 2ZOKA 2V2XA 3WS6A 2FIKA 4QRUA 3TIDA 1DDHA 4D0BA 3RL2A 1S7UA 5GSVA 4X6EA 3D39A 1S9XA 3WL9A 4U1MA 5INCA 3GSNH 5GSRA 1I1FA 3RWDA 2HJKA 3TBYA 3UTQA 1P7QA 5L2KA 3HE6A 1OGAA 1K8DA 4HS3A 2P5WA 3QI9A 3MRPA 4K7FA 3X12A 2CLRA 1GZQA 2GT9A 4PRDA 3O4LA 5E8PA 5C0AA 1X7QA 5DEGA 4MJIA 4JRXA 2A83A 3KPNA 3P77A 3KWWA 1AGBA 1JPFA 4X6CA 4G59A 4QRQA 4QRRA 5C0CA 3I6GA 3PWJA 5IB3A 4WU5A 1PQZA 3RWJA 4MQ7A 1QLFA 5C09A 3SDXA 3E3QA 3C8KA 1QR1A 2XPGA 1KBGH 2C7UA 3MGTA 1T1ZA 3MRFA 3GSRA 2BVPA 3V5DA 1T0MA 4CVXA 1N59A 5EOTA 3VXRA 1JHTA 1I7UA 3MRKA 3GSXA 2X4RA 1RJYA 1KJMA 4QRTA 5IM7A 1VGKA 3DXAA 1FZOA 3P4OA 4NQEA 3BEWA 5C08A 1JUFA 1KJVA 3VCLA 3TJHA 1KJ2H 3QDMA 1A9BA 4PJ8A 1AGDA 4JFEA 5D7IA 1QSFA 4NNYA 1YDPA 2ZOLA 3BEVA 4MJ5A 5HGAA 3UTTA 1EFXA 3AM8A 3CC5A 4GKSA 3D3VA 4JFFA 1LP9A 4GUPA 5C9JA 1FO0H 1HSAA 3GSWA 4G8IA 3P4NA 4G8GA 5HHMA 3LV3A 3O3AA 1CE6A 3VXNA 1HHGA 3KPSA 3LKNA 1S7TA 5D2LA 1ZHLA 5EO1A 3VXOA 5BJTA 2VLKA 4NO3A 4JQVA 3IT8D 2VABA 1HHJA 1INQA 3E6HA 3P73A 3WLBA 4D0CA 5SWQA 3TF7A 1GZPA 1ZAGA 3KPQA 5EU3A 3RWIA 1NEZA 4Y2DA 3MRCA 1KTLA 3VFSA 3FOLA 4O2FA 5FA4A 1M6OA 3TN0A 3GSQA 1T80A 1UXSA 1CD1A 5F7DA 3L9RA 2YPLA 2X4SA 5C0FA 3V5HA 4PRBA 1A6ZA 4Y16A 5E8NA 3O3DA 3FQNA 1ZT7A 1EEZA 4FTVA 3ES6A 4PRHA 2YEZA 5C0EA 1BZ9A 4N0UA 3MV8A 1MHCA 1IM3A 1W72A 4Z78A 3O9WA 3H7BA 4MXQA 1JF1A 1VACA 5BRZA 2V2WA 1KCGC 3MRDA 5HHQA 5IB1A 1AGCA 1ONQA 2H6PA 4UQ2A 1HSBA 3HE7A 3CZFA 5EU4A 4NO0A 4XXCA 4CW1A 2VLLA 4WO4A 4PJ5A 3VFRA 3MGOA 1TVHA 1N3NA 1QEWA 4NO5A 4PJFA 4N5EA 3L3IA 5HGBA 3MRMA 5BS0A 4MX7A 1HHKA 4I4WA 4MNQA 3TZVC 1A1MA 3D2UA 3P4MA 2BNQA 3MRBA 1E27A 4L3CA 4HUUA 3H9HA 4ZUVA 5IB5A 1S9WA 1T1YA 4PGEA 3ARFA 4Z77A 3FQXA 3VFUA 5MEQA 5E8OA 4PRNA 1FFOA 1FZKA 4PGBA 1KPUA 5MEOA 3BGMA 1QVOA 5J6GA 3DBXA 4QOKA 4PJDA 1JGEA 5ISZA 2VLRA 1Z5LA 2Q7YA 1ZSDA 1HHHA 4JRYA 2VE6A 1YPZA 3MYJA 4PJAA 3TO2A 3PWNA 3HUJA 3BWAA 4HUXA 4PG2A 5DEFA 3GMRA 1RJZA 3BZFA 4U1JA 1ED3A 5C0BA 1S7WA 2X4NA 4PRPA 1T1WA 4MJ6A 3UBXA 1IM9A 1MHEA 3T1FA 2GTZA 2FYYA 1T7WA 3RL1A 4G9FA 3TIEA 3PABA 4N8VA 4NT6A 3LKSA 4APQA 2X4UA 3M17A 4U1LA 3PWLA 2AV1A 2BVQA 3O3EA 4PG9A 1P4LA 3LKOA 3QEQA 3CDGA 4U6YA 1TMCA 5HGHA 5D7JC 5HGDA 1NANH 5SWSA 5F1NA 1W0VA 4LHUA 5C07A 4PP8C 3RUGA 5B38A 3FT3A 4WUUA 4ZUUA 1OSZA 1P1ZA 3O3BA 5C0GA 4L29A 1KJ3H 3HG1A 3W0WA 5D9SA 3REWA 3TFKA 4NQVA 3HAEA 2AXFA 3KLAA 3BO8A 4U1IA 1XR8A 2GJ6A 3OV6A 3QDGA 4K71B 3L3HA 4LCCC 1I4FA 2ESVA 3LKQA 4ZAKA 2X70A 4IRSA 5IB2A 1YN6A 4GKNA 1QRNA 3FONA 3MR9A 5C0DA 5EU6A 5IVXA 5SWZA 4PGCA 3QDJA 5EO0A 2VAAA 3O8XA 1AKJA 1T1XA 3ROOA 2VLJA 4U1HA 1N2RA 1QQDA 3KYOA 1S9YA 1YN7A 4G43A 2CLVA 3BH8A 2FZ3A 2E7LE 5ACZA 1MI5A 3TBTA 3VRJA 1LD9A 2CLZA 2X4PA 1T20A 3U0PA 5IEHA 3V5KA 5E9DA 2H26A 3X11A 3DTXA 4PR5A 5D5MA 1OF2A 1BQHA 1S7VA 3OXRA 2BNRA 1AGFA 4MNGA 1S8DA 2CIIA 2MHAA 2GUOA 5HYJA 1T7ZA 3MRQA 3QUYA 4L4VA 1B0GA 1S7RA 5J1AA 3TPUE 4LCYA 3MRNA 1BIIA 3QFJA 3FTGA 3FQUA 3L3DA 5L2JA 3B6SA 1FFNA 3JVGA 3L3KA 1K5NA 2BSTA 2X4QA 1EXUA 3MA7A 4MVBA 1E28A 3S6CA 5FDWA 4L8BA 3IXAA 1I7RA 2WY3A 4JQXA 4PDCE 1S7QA 2P5EA 2CKBH 5DDHA 3TBWA 3VRIA 3MV7A 3P9MA 3BZEA 1N5AA 1ZHKA 3D18A 3JTTA 1LEKA 4F7CA 3D25A 1XR9A 5HHPA 2F54A 5MEPA 1B0RA 3FQWA 4FFEX 4MS8A 3VXSA 2AXGA 2JCCA 4EUPA 2J8UA 3VXPA 4WWKC 3GJFA 3MRLA 2F74A 2PO6A 3ERYA 3ARDA 3WUWA 3FT2A 3GSOA 4NSKA 4UQ3A 2OI9A 3KPMA 1ZS8A 3MROA 4G42A 3RWFA 4L3EA 2F53A 3JTCA 4X6DA 3RZCA 3FQTA 1TVBA 1A1OA 3OX8A 3CVHA 3GMQA 4PJXA 2X4OA 2PYEA 3GSVA 4X6FA 2ZSVA 1ZT4A 4G9DA 1FFPA 1HOCA 5HHOA 5D2NA 4HKJA 3OXSA 3QUXA 3BVNA 1QSEA 1VADA 1I1YA 4E5XA 3I6LD 3BXNA 3KPRA 4L9LC 2YPKA 3BUYA 3VFOA 3CH1A 3TA3A 5C0JA 2GITA 3MRRA 4EI5A 4U1SA 4ZUSA 2AV7A 3VH8A 4ELMA 1S7SA 2OL3H 3GMMA 4L8SC 1KPVA 2CIKA 3ILQC 1R3HA 3M1BA 4NQDA 3WS3A 3MRHA 1JE6A 3H9SA 3QUKA 3P9LA 5AD0A 3FT4A 1JGDA 4HWZA 4F7PA 3GMLA 1BD2A 3BP7A 4I48A 3MV9A 4O2CA 5E6IC 4N0CA 3ARGA 5D7LA 1ZVSA 4WW2C 3RWEA 3BH9A 3VWKA 2HJLA 1RK0A 3AREA 3B3IA 1LK2A 4U6XA 4L8CA 3VFVA 3VJ6A 2AK4A 3KXFA 4IRJA 1FZJA 1OGTA 3X13A 2HN7A 1XH3A 2FO4A 3VFPA 3UPRA 1G6RH 3RTQA 4D0DA 5B39A 1LDPH 1HHIA 3KPLA 1HYRC 5IB4A 2BVOA 4JFOA 1WBXA 3MRIA 4O2EA 3LKPA 4Y4KA 3LN5A 1JPGA 1I1AA 1UQSA 3HCVA 3TO4A 1G7QA 2D31A 2GTWA 3PWUA 4NO2A 3BHBA 1AGEA 4L4TA 3RWGA 3NFNA 4CVZA 3E6FA 5F1IA 4QRSA 3G08A 4HUWA 1M05A 4PJCA 5H94A 5EUOA 3SDDA 1ZT1A 3CCHA 4JFDA 2DYPA 3QZWA 1SYSA 3JTSA 4NHUE 5MERA 3KPPA 4Y4HA 3KPOA 1FG2A 1NAMH 1I7TA 5ENWA 4S0UC 1T22A 4EN3C 4N0FA 4WU7A 1LEGA 1SYVA 1XZ0A 2FWOA 4ZFZA 3LKRA 3HLAA 1S7XA 4PGDA 5IROA 4F7EA 3W39A 3T8XA 1L8JA 5INDA 3VWJA 3E2HA 4HUVA 3GSUA 3GMPA 4IHOA 4HV8A 3L3JA 3SDCA 1B3JA 1A9EA 4E0RA 3PWPA 3LN4A 3SJVA 1T7XA 2X4TA 3GIVA 3L3GA 3FQRA 3TBVA 3BW9A 2AKRA 4PV9A 4PV8A 3SCMA 3DMMA 1T7YA 2NW3A 2XFXA 3UTSA 3TBSA 1T0NA 2BSRA 3GMOA 3HPJA 4WJ5A 2UWEA 3FFCA 3ARBA 1T7VA 5FA3A 2NX5A 3VFWA 4U1NA 1ZHNA 1RK1A 2BCKA 3QUZA 1C16A 4F7MA 1UXWA 5JHDA 1CG9A 1T21A 5C0IA 1KPRA 4LCWA 1WBYA 4PRIA 3MRJA 3RWCA 3QULA 3VFNA 3MRGA 3QFDA 4U1KA 4NQCA 1G7PA 1AO7A 1LQVA 2BSSA 4Y4FA 1Q94A 3RGVC 3TVMA 5J6HA 3VFTA 4V3EB 5IEKA 3SKOA 4JFPA 4Z76A 4F7TA 3PWVA 4L8DA 2HLAA 1DUYA 4IIQC 2GAZA 3QQ4A 5F9JA 5BXFA 3ROLA 4NQXA 1W0WA 3SDAA 1A1NA 3BP4A 3DX8A 1QO3A 1ZHBA 4NNXA 4PJ9A 3ILPA 5E00A 3GMNA 3RWHA 3FOMA 1FZMA 4PJIA 4LNRA 4PJEA 1DE4A 3CPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PRA A;  3I6K A;  3VFM A;  4V3D B;  3PQY A;  5MEN A;  2RFX A;  1JFM A;  3AU1 A;  5HHN A;  2ZSW A;  4ONO A;  1WBZ A;  3FRU A;  3SPV A;  1DUZ A;  3SKM A;  4WDI A;  1MWA H;  4PJH A;  1EEY A;  5EFI A;  4JFQ A;  3MRE A;  4HX1 A;  4ZUT A;  1U58 A;  3KYN A;  4ZUW A;  4PJB A;  4QRP A;  4PJ7 A;  4PRE A;  3QQ3 A;  3C9N A;  3ECB A;  3VXM A;  3DX7 A;  5EU5 A;  3X14 A;  5FKP A;  3DX6 A;  3VXU A;  4PJG A;  2ZOK A;  2V2X A;  3WS6 A;  2FIK A;  4QRU A;  3TID A;  1DDH A;  4D0B A;  3RL2 A;  1S7U A;  5GSV A;  4X6E A;  3D39 A;  1S9X A;  3WL9 A;  4U1M A;  5INC A;  3GSN H;  5GSR A;  1I1F A;  3RWD A;  2HJK A;  3TBY A;  3UTQ A;  1P7Q A;  5L2K A;  3HE6 A;  1OGA A;  1K8D A;  4HS3 A;  2P5W A;  3QI9 A;  3MRP A;  4K7F A;  3X12 A;  2CLR A;  1GZQ A;  2GT9 A;  4PRD A;  3O4L A;  5E8P A;  5C0A A;  1X7Q A;  5DEG A;  4MJI A;  4JRX A;  2A83 A;  3KPN A;  3P77 A;  3KWW A;  1AGB A;  1JPF A;  4X6C A;  4G59 A;  4QRQ A;  4QRR A;  5C0C A;  3I6G A;  3PWJ A;  5IB3 A;  4WU5 A;  1PQZ A;  3RWJ A;  4MQ7 A;  1QLF A;  5C09 A;  3SDX A;  3E3Q A;  3C8K A;  1QR1 A;  2XPG A;  1KBG H;  2C7U A;  3MGT A;  1T1Z A;  3MRF A;  3GSR A;  2BVP A;  3V5D A;  1T0M A;  4CVX A;  1N59 A;  5EOT A;  3VXR A;  1JHT A;  1I7U A;  3MRK A;  3GSX A;  2X4R A;  1RJY A;  1KJM A;  4QRT A;  5IM7 A;  1VGK A;  3DXA A;  1FZO A;  3P4O A;  4NQE A;  3BEW A;  5C08 A;  1JUF A;  1KJV A;  3VCL A;  3TJH A;  1KJ2 H;  3QDM A;  1A9B A;  4PJ8 A;  1AGD A;  4JFE A;  5D7I A;  1QSF A;  4NNY A;  1YDP A;  2ZOL A;  3BEV A;  4MJ5 A;  5HGA A;  3UTT A;  1EFX A;  3AM8 A;  3CC5 A;  4GKS A;  3D3V A;  4JFF A;  1LP9 A;  4GUP A;  5C9J A;  1FO0 H;  1HSA A;  3GSW A;  4G8I A;  3P4N A;  4G8G A;  5HHM A;  3LV3 A;  3O3A A;  1CE6 A;  3VXN A;  1HHG A;  3KPS A;  3LKN A;  1S7T A;  5D2L A;  1ZHL A;  5EO1 A;  3VXO A;  5BJT A;  2VLK A;  4NO3 A;  4JQV A;  3IT8 D;  2VAB A;  1HHJ A;  1INQ A;  3E6H A;  3P73 A;  3WLB A;  4D0C A;  5SWQ A;  3TF7 A;  1GZP A;  1ZAG A;  3KPQ A;  5EU3 A;  3RWI A;  1NEZ A;  4Y2D A;  3MRC A;  1KTL A;  3VFS A;  3FOL A;  4O2F A;  5FA4 A;  1M6O A;  3TN0 A;  3GSQ A;  1T80 A;  1UXS A;  1CD1 A;  5F7D A;  3L9R A;  2YPL A;  2X4S A;  5C0F A;  3V5H A;  4PRB A;  1A6Z A;  4Y16 A;  5E8N A;  3O3D A;  3FQN A;  1ZT7 A;  1EEZ A;  4FTV A;  3ES6 A;  4PRH A;  2YEZ A;  5C0E A;  1BZ9 A;  4N0U A;  3MV8 A;  1MHC A;  1IM3 A;  1W72 A;  4Z78 A;  3O9W A;  3H7B A;  4MXQ A;  1JF1 A;  1VAC A;  5BRZ A;  2V2W A;  1KCG C;  3MRD A;  5HHQ A;  5IB1 A;  1AGC A;  1ONQ A;  2H6P A;  4UQ2 A;  1HSB A;  3HE7 A;  3CZF A;  5EU4 A;  4NO0 A;  4XXC A;  4CW1 A;  2VLL A;  4WO4 A;  4PJ5 A;  3VFR A;  3MGO A;  1TVH A;  1N3N A;  1QEW A;  4NO5 A;  4PJF A;  4N5E A;  3L3I A;  5HGB A;  3MRM A;  5BS0 A;  4MX7 A;  1HHK A;  4I4W A;  4MNQ A;  3TZV C;  1A1M A;  3D2U A;  3P4M A;  2BNQ A;  3MRB A;  1E27 A;  4L3C A;  4HUU A;  3H9H A;  4ZUV A;  5IB5 A;  1S9W A;  1T1Y A;  4PGE A;  3ARF A;  4Z77 A;  3FQX A;  3VFU A;  5MEQ A;  5E8O A;  4PRN A;  1FFO A;  1FZK A;  4PGB A;  1KPU A;  5MEO A;  3BGM A;  1QVO A;  5J6G A;  3DBX A;  4QOK A;  4PJD A;  1JGE A;  5ISZ A;  2VLR A;  1Z5L A;  2Q7Y A;  1ZSD A;  1HHH A;  4JRY A;  2VE6 A;  1YPZ A;  3MYJ A;  4PJA A;  3TO2 A;  3PWN A;  3HUJ A;  3BWA A;  4HUX A;  4PG2 A;  5DEF A;  3GMR A;  1RJZ A;  3BZF A;  4U1J A;  1ED3 A;  5C0B A;  1S7W A;  2X4N A;  4PRP A;  1T1W A;  4MJ6 A;  3UBX A;  1IM9 A;  1MHE A;  3T1F A;  2GTZ A;  2FYY A;  1T7W A;  3RL1 A;  4G9F A;  3TIE A;  3PAB A;  4N8V A;  4NT6 A;  3LKS A;  4APQ A;  2X4U A;  3M17 A;  4U1L A;  3PWL A;  2AV1 A;  2BVQ A;  3O3E A;  4PG9 A;  1P4L A;  3LKO A;  3QEQ A;  3CDG A;  4U6Y A;  1TMC A;  5HGH A;  5D7J C;  5HGD A;  1NAN H;  5SWS A;  5F1N A;  1W0V A;  4LHU A;  5C07 A;  4PP8 C;  3RUG A;  5B38 A;  3FT3 A;  4WUU A;  4ZUU A;  1OSZ A;  1P1Z A;  3O3B A;  5C0G A;  4L29 A;  1KJ3 H;  3HG1 A;  3W0W A;  5D9S A;  3REW A;  3TFK A;  4NQV A;  3HAE A;  2AXF A;  3KLA A;  3BO8 A;  4U1I A;  1XR8 A;  2GJ6 A;  3OV6 A;  3QDG A;  4K71 B;  3L3H A;  4LCC C;  1I4F A;  2ESV A;  3LKQ A;  4ZAK A;  2X70 A;  4IRS A;  5IB2 A;  1YN6 A;  4GKN A;  1QRN A;  3FON A;  3MR9 A;  5C0D A;  5EU6 A;  5IVX A;  5SWZ A;  4PGC A;  3QDJ A;  5EO0 A;  2VAA A;  3O8X A;  1AKJ A;  1T1X A;  3ROO A;  2VLJ A;  4U1H A;  1N2R A;  1QQD A;  3KYO A;  1S9Y A;  1YN7 A;  4G43 A;  2CLV A;  3BH8 A;  2FZ3 A;  2E7L E;  5ACZ A;  1MI5 A;  3TBT A;  3VRJ A;  1LD9 A;  2CLZ A;  2X4P A;  1T20 A;  3U0P A;  5IEH A;  3V5K A;  5E9D A;  2H26 A;  3X11 A;  3DTX A;  4PR5 A;  5D5M A;  1OF2 A;  1BQH A;  1S7V A;  3OXR A;  2BNR A;  1AGF A;  4MNG A;  1S8D A;  2CII A;  2MHA A;  2GUO A;  5HYJ A;  1T7Z A;  3MRQ A;  3QUY A;  4L4V A;  1B0G A;  1S7R A;  5J1A A;  3TPU E;  4LCY A;  3MRN A;  1BII A;  3QFJ A;  3FTG A;  3FQU A;  3L3D A;  5L2J A;  3B6S A;  1FFN A;  3JVG A;  3L3K A;  1K5N A;  2BST A;  2X4Q A;  1EXU A;  3MA7 A;  4MVB A;  1E28 A;  3S6C A;  5FDW A;  4L8B A;  3IXA A;  1I7R A;  2WY3 A;  4JQX A;  4PDC E;  1S7Q A;  2P5E A;  2CKB H;  5DDH A;  3TBW A;  3VRI A;  3MV7 A;  3P9M A;  3BZE A;  1N5A A;  1ZHK A;  3D18 A;  3JTT A;  1LEK A;  4F7C A;  3D25 A;  1XR9 A;  5HHP A;  2F54 A;  5MEP A;  1B0R A;  3FQW A;  4FFE X;  4MS8 A;  3VXS A;  2AXG A;  2JCC A;  4EUP A;  2J8U A;  3VXP A;  4WWK C;  3GJF A;  3MRL A;  2F74 A;  2PO6 A;  3ERY A;  3ARD A;  3WUW A;  3FT2 A;  3GSO A;  4NSK A;  4UQ3 A;  2OI9 A;  3KPM A;  1ZS8 A;  3MRO A;  4G42 A;  3RWF A;  4L3E A;  2F53 A;  3JTC A;  4X6D A;  3RZC A;  3FQT A;  1TVB A;  1A1O A;  3OX8 A;  3CVH A;  3GMQ A;  4PJX A;  2X4O A;  2PYE A;  3GSV A;  4X6F A;  2ZSV A;  1ZT4 A;  4G9D A;  1FFP A;  1HOC A;  5HHO A;  5D2N A;  4HKJ A;  3OXS A;  3QUX A;  3BVN A;  1QSE A;  1VAD A;  1I1Y A;  4E5X A;  3I6L D;  3BXN A;  3KPR A;  4L9L C;  2YPK A;  3BUY A;  3VFO A;  3CH1 A;  3TA3 A;  5C0J A;  2GIT A;  3MRR A;  4EI5 A;  4U1S A;  4ZUS A;  2AV7 A;  3VH8 A;  4ELM A;  1S7S A;  2OL3 H;  3GMM A;  4L8S C;  1KPV A;  2CIK A;  3ILQ C;  1R3H A;  3M1B A;  4NQD A;  3WS3 A;  3MRH A;  1JE6 A;  3H9S A;  3QUK A;  3P9L A;  5AD0 A;  3FT4 A;  1JGD A;  4HWZ A;  4F7P A;  3GML A;  1BD2 A;  3BP7 A;  4I48 A;  3MV9 A;  4O2C A;  5E6I C;  4N0C A;  3ARG A;  5D7L A;  1ZVS A;  4WW2 C;  3RWE A;  3BH9 A;  3VWK A;  2HJL A;  1RK0 A;  3ARE A;  3B3I A;  1LK2 A;  4U6X A;  4L8C A;  3VFV A;  3VJ6 A;  2AK4 A;  3KXF A;  4IRJ A;  1FZJ A;  1OGT A;  3X13 A;  2HN7 A;  1XH3 A;  2FO4 A;  3VFP A;  3UPR A;  1G6R H;  3RTQ A;  4D0D A;  5B39 A;  1LDP H;  1HHI A;  3KPL A;  1HYR C;  5IB4 A;  2BVO A;  4JFO A;  1WBX A;  3MRI A;  4O2E A;  3LKP A;  4Y4K A;  3LN5 A;  1JPG A;  1I1A A;  1UQS A;  3HCV A;  3TO4 A;  1G7Q A;  2D31 A;  2GTW A;  3PWU A;  4NO2 A;  3BHB A;  1AGE A;  4L4T A;  3RWG A;  3NFN A;  4CVZ A;  3E6F A;  5F1I A;  4QRS A;  3G08 A;  4HUW A;  1M05 A;  4PJC A;  5H94 A;  5EUO A;  3SDD A;  1ZT1 A;  3CCH A;  4JFD A;  2DYP A;  3QZW A;  1SYS A;  3JTS A;  4NHU E;  5MER A;  3KPP A;  4Y4H A;  3KPO A;  1FG2 A;  1NAM H;  1I7T A;  5ENW A;  4S0U C;  1T22 A;  4EN3 C;  4N0F A;  4WU7 A;  1LEG A;  1SYV A;  1XZ0 A;  2FWO A;  4ZFZ A;  3LKR A;  3HLA A;  1S7X A;  4PGD A;  5IRO A;  4F7E A;  3W39 A;  3T8X A;  1L8J A;  5IND A;  3VWJ A;  3E2H A;  4HUV A;  3GSU A;  3GMP A;  4IHO A;  4HV8 A;  3L3J A;  3SDC A;  1B3J A;  1A9E A;  4E0R A;  3PWP A;  3LN4 A;  3SJV A;  1T7X A;  2X4T A;  3GIV A;  3L3G A;  3FQR A;  3TBV A;  3BW9 A;  2AKR A;  4PV9 A;  4PV8 A;  3SCM A;  3DMM A;  1T7Y A;  2NW3 A;  2XFX A;  3UTS A;  3TBS A;  1T0N A;  2BSR A;  3GMO A;  3HPJ A;  4WJ5 A;  2UWE A;  3FFC A;  3ARB A;  1T7V A;  5FA3 A;  2NX5 A;  3VFW A;  4U1N A;  1ZHN A;  1RK1 A;  2BCK A;  3QUZ A;  1C16 A;  4F7M A;  1UXW A;  5JHD A;  1CG9 A;  1T21 A;  5C0I A;  1KPR A;  4LCW A;  1WBY A;  4PRI A;  3MRJ A;  3RWC A;  3QUL A;  3VFN A;  3MRG A;  3QFD A;  4U1K A;  4NQC A;  1G7P A;  1AO7 A;  1LQV A;  2BSS A;  4Y4F A;  1Q94 A;  3RGV C;  3TVM A;  5J6H A;  3VFT A;  4V3E B;  5IEK A;  3SKO A;  4JFP A;  4Z76 A;  4F7T A;  3PWV A;  4L8D A;  2HLA A;  1DUY A;  4IIQ C;  2GAZ A;  3QQ4 A;  5F9J A;  5BXF A;  3ROL A;  4NQX A;  1W0W A;  3SDA A;  1A1N A;  3BP4 A;  3DX8 A;  1QO3 A;  1ZHB A;  4NNX A;  4PJ9 A;  3ILP A;  5E00 A;  3GMN A;  3RWH A;  3FOM A;  1FZM A;  4PJI A;  4LNR A;  4PJE A;  1DE4 A;  3CPL A; 
#chains in the Genus database with same CATH topology
 4PRA A;  3I6K A;  3VFM A;  4V3D B;  3PQY A;  5MEN A;  2RFX A;  1JFM A;  3AU1 A;  5HHN A;  2ZSW A;  4ONO A;  1WBZ A;  3FRU A;  3SPV A;  1DUZ A;  3SKM A;  4WDI A;  1MWA H;  4PJH A;  1EEY A;  5EFI A;  4JFQ A;  3MRE A;  4HX1 A;  4ZUT A;  4JO8 A;  1U58 A;  3KYN A;  4ZUW A;  4PJB A;  4QRP A;  4PJ7 A;  4PRE A;  3QQ3 A;  3C9N A;  3ECB A;  3VXM A;  3DX7 A;  5EU5 A;  3X14 A;  5FKP A;  3DX6 A;  3VXU A;  4PJG A;  2ZOK A;  2V2X A;  3WS6 A;  2FIK A;  4QRU A;  3TID A;  1DDH A;  4D0B A;  3RL2 A;  1S7U A;  5GSV A;  4X6E A;  3D39 A;  1S9X A;  3WL9 A;  4U1M A;  5INC A;  3GSN H;  5GSR A;  1I1F A;  3RWD A;  2HJK A;  3TBY A;  3UTQ A;  1P7Q A;  5L2K A;  3HE6 A;  1OGA A;  1K8D A;  4HS3 A;  2P5W A;  3QI9 A;  3MRP A;  4K7F A;  3X12 A;  2CLR A;  1GZQ A;  2GT9 A;  4PRD A;  3O4L A;  5E8P A;  5C0A A;  1X7Q A;  5DEG A;  4MJI A;  4JRX A;  2A83 A;  3KPN A;  3P77 A;  3KWW A;  1AGB A;  1JPF A;  4X6C A;  4G59 A;  4QRQ A;  4QRR A;  5C0C A;  3I6G A;  3PWJ A;  5IB3 A;  4WU5 A;  1PQZ A;  3RWJ A;  4MQ7 A;  1QLF A;  5C09 A;  3SDX A;  3E3Q A;  3C8K A;  1QR1 A;  2XPG A;  1KBG H;  2C7U A;  3MGT A;  1T1Z A;  3MRF A;  3GSR A;  2BVP A;  3V5D A;  1T0M A;  4CVX A;  1N59 A;  5EOT A;  3VXR A;  1JHT A;  1I7U A;  3MRK A;  3GSX A;  2X4R A;  1RJY A;  1KJM A;  4QRT A;  5IM7 A;  1VGK A;  3DXA A;  1FZO A;  3P4O A;  4NQE A;  3BEW A;  5C08 A;  1JUF A;  1KJV A;  3VCL A;  3TJH A;  1KJ2 H;  3QDM A;  1A9B A;  4PJ8 A;  1AGD A;  4JFE A;  5D7I A;  1QSF A;  4NNY A;  1YDP A;  2ZOL A;  3BEV A;  4MJ5 A;  5HGA A;  3UTT A;  1EFX A;  3AM8 A;  3CC5 A;  4GKS A;  3D3V A;  4JFF A;  1LP9 A;  4GUP A;  5C9J A;  1FO0 H;  1HSA A;  3GSW A;  4G8I A;  3P4N A;  4G8G A;  5HHM A;  3LV3 A;  3O3A A;  1CE6 A;  3VXN A;  1HHG A;  3KPS A;  3LKN A;  1S7T A;  5D2L A;  1ZHL A;  5EO1 A;  3VXO A;  5BJT A;  2VLK A;  4NO3 A;  4JQV A;  3IT8 D;  2VAB A;  1HHJ A;  1INQ A;  3E6H A;  3P73 A;  3WLB A;  4D0C A;  5SWQ A;  3TF7 A;  1GZP A;  1ZAG A;  3KPQ A;  5EU3 A;  3RWI A;  1NEZ A;  4Y2D A;  3MRC A;  1KTL A;  3VFS A;  3FOL A;  4O2F A;  5FA4 A;  1M6O A;  3TN0 A;  3GSQ A;  1T80 A;  1UXS A;  1CD1 A;  5F7D A;  3L9R A;  2YPL A;  2X4S A;  5C0F A;  3V5H A;  4PRB A;  1A6Z A;  4Y16 A;  5E8N A;  3O3D A;  3FQN A;  1ZT7 A;  1EEZ A;  4FTV A;  3ES6 A;  4PRH A;  2YEZ A;  5C0E A;  1BZ9 A;  4N0U A;  3MV8 A;  1MHC A;  1IM3 A;  1W72 A;  4Z78 A;  3O9W A;  3H7B A;  4MXQ A;  1JF1 A;  1VAC A;  5BRZ A;  2V2W A;  1KCG C;  3MRD A;  5HHQ A;  5IB1 A;  1AGC A;  1ONQ A;  2H6P A;  4UQ2 A;  1HSB A;  3HE7 A;  3CZF A;  5EU4 A;  4NO0 A;  4XXC A;  4CW1 A;  2VLL A;  4WO4 A;  4PJ5 A;  3VFR A;  3MGO A;  1TVH A;  1N3N A;  1QEW A;  4NO5 A;  4PJF A;  4N5E A;  3L3I A;  5HGB A;  3MRM A;  5BS0 A;  4MX7 A;  1HHK A;  4I4W A;  4MNQ A;  3TZV C;  1A1M A;  3D2U A;  3P4M A;  2BNQ A;  3MRB A;  1E27 A;  4L3C A;  4HUU A;  3H9H A;  4ZUV A;  2IA1 A;  5IB5 A;  1S9W A;  1T1Y A;  4PGE A;  3ARF A;  4Z77 A;  3FQX A;  3VFU A;  5MEQ A;  5E8O A;  4PRN A;  1FFO A;  1FZK A;  4PGB A;  1KPU A;  5MEO A;  3BGM A;  1QVO A;  5J6G A;  3DBX A;  4QOK A;  4PJD A;  1JGE A;  5ISZ A;  2VLR A;  1Z5L A;  2Q7Y A;  1ZSD A;  1HHH A;  4JRY A;  2VE6 A;  1YPZ A;  3MYJ A;  4PJA A;  3TO2 A;  3PWN A;  3HUJ A;  3BWA A;  4HUX A;  4PG2 A;  5DEF A;  3GMR A;  1RJZ A;  3BZF A;  4U1J A;  1ED3 A;  5C0B A;  1S7W A;  2X4N A;  4PRP A;  1T1W A;  4MJ6 A;  3UBX A;  1IM9 A;  3I0T A;  1MHE A;  3T1F A;  2GTZ A;  2FYY A;  1T7W A;  3RL1 A;  4G9F A;  3TIE A;  3PAB A;  4N8V A;  4NT6 A;  3LKS A;  4APQ A;  2X4U A;  3M17 A;  4U1L A;  3PWL A;  2AV1 A;  2BVQ A;  3O3E A;  4PG9 A;  1P4L A;  3LKO A;  3QEQ A;  3CDG A;  4U6Y A;  1TMC A;  5HGH A;  5D7J C;  5HGD A;  1NAN H;  5SWS A;  5F1N A;  1W0V A;  4LHU A;  5C07 A;  4PP8 C;  3RUG A;  5B38 A;  3FT3 A;  4WUU A;  4ZUU A;  1OSZ A;  1P1Z A;  3O3B A;  5C0G A;  4L29 A;  1KJ3 H;  3HG1 A;  3W0W A;  5D9S A;  3REW A;  3TFK A;  4NQV A;  3HAE A;  2AXF A;  3KLA A;  3BO8 A;  4U1I A;  1XR8 A;  2GJ6 A;  3OV6 A;  3QDG A;  4K71 B;  3L3H A;  4BKW A;  4LCC C;  1I4F A;  2ESV A;  3LKQ A;  4ZAK A;  2X70 A;  4IRS A;  5IB2 A;  1YN6 A;  4GKN A;  1QRN A;  3FON A;  3MR9 A;  5C0D A;  5EU6 A;  5IVX A;  5SWZ A;  4PGC A;  2O5N A;  3QDJ A;  5EO0 A;  2VAA A;  3O8X A;  1AKJ A;  1T1X A;  3ROO A;  2VLJ A;  4U1H A;  1N2R A;  1QQD A;  3KYO A;  1S9Y A;  1YN7 A;  4G43 A;  2CLV A;  3BH8 A;  2FZ3 A;  2E7L E;  5ACZ A;  1MI5 A;  3TBT A;  3VRJ A;  1LD9 A;  2CLZ A;  2X4P A;  1T20 A;  3U0P A;  5IEH A;  3V5K A;  5E9D A;  2H26 A;  3X11 A;  3DTX A;  4PR5 A;  5D5M A;  1OF2 A;  1BQH A;  1S7V A;  3OXR A;  2BNR A;  1AGF A;  4MNG A;  1S8D A;  2CII A;  2MHA A;  2GUO A;  5HYJ A;  1T7Z A;  3MRQ A;  3QUY A;  4L4V A;  1B0G A;  1S7R A;  5J1A A;  3TPU E;  4LCY A;  3MRN A;  1BII A;  3QFJ A;  3FTG A;  3FQU A;  3L3D A;  5L2J A;  4G59 C;  3B6S A;  1FFN A;  3JVG A;  3L3K A;  1K5N A;  2BST A;  2X4Q A;  1EXU A;  3MA7 A;  4MVB A;  1E28 A;  3S6C A;  5FDW A;  4L8B A;  3IXA A;  1I7R A;  2WY3 A;  4JQX A;  4PDC E;  1S7Q A;  2P5E A;  2CKB H;  5DDH A;  3TBW A;  3VRI A;  3MV7 A;  3P9M A;  3BZE A;  1N5A A;  1ZHK A;  3D18 A;  3JTT A;  1LEK A;  4F7C A;  3D25 A;  1XR9 A;  5HHP A;  2F54 A;  5MEP A;  1B0R A;  3FQW A;  4FFE X;  4MS8 A;  3VXS A;  2AXG A;  2JCC A;  4EUP A;  2J8U A;  3VXP A;  4WWK C;  3GJF A;  3MRL A;  2F74 A;  2PO6 A;  3ERY A;  3ARD A;  3WUW A;  3FT2 A;  3GSO A;  4NSK A;  4UQ3 A;  2OI9 A;  3KPM A;  1ZS8 A;  3MRO A;  4G42 A;  3RWF A;  4L3E A;  2F53 A;  3JTC A;  4X6D A;  3RZC A;  3FQT A;  1TVB A;  1A1O A;  3OX8 A;  3CVH A;  3GMQ A;  4PJX A;  2X4O A;  2PYE A;  3GSV A;  4X6F A;  2ZSV A;  1ZT4 A;  4G9D A;  1FFP A;  1HOC A;  5HHO A;  2NYK A;  4HKJ A;  5D2N A;  3OXS A;  3QUX A;  3BVN A;  1QSE A;  1VAD A;  1I1Y A;  4E5X A;  3I6L D;  3BXN A;  3KPR A;  4L9L C;  2YPK A;  3BUY A;  3VFO A;  3CH1 A;  3TA3 A;  5C0J A;  2GIT A;  3MRR A;  4EI5 A;  4U1S A;  4ZUS A;  2AV7 A;  3VH8 A;  4ELM A;  1S7S A;  2OL3 H;  3GMM A;  4L8S C;  1KPV A;  2CIK A;  3ILQ C;  1R3H A;  3M1B A;  4NQD A;  3WS3 A;  3MRH A;  1JE6 A;  3H9S A;  3QUK A;  3P9L A;  5AD0 A;  3FT4 A;  1JGD A;  4HWZ A;  4F7P A;  3GML A;  1BD2 A;  3BP7 A;  4I48 A;  3MV9 A;  4O2C A;  5E6I C;  4N0C A;  3ARG A;  5D7L A;  1ZVS A;  4WW2 C;  3RWE A;  3BH9 A;  3VWK A;  2HJL A;  1RK0 A;  3ARE A;  3B3I A;  1LK2 A;  4U6X A;  4L8C A;  3VFV A;  3VJ6 A;  2AK4 A;  3KXF A;  4IRJ A;  1FZJ A;  1OGT A;  3X13 A;  2HN7 A;  1XH3 A;  2FO4 A;  3VFP A;  3UPR A;  1G6R H;  3RTQ A;  4D0D A;  5B39 A;  1LDP H;  1HHI A;  3KPL A;  1HYR C;  5IB4 A;  2BVO A;  4JFO A;  1WBX A;  3MRI A;  4O2E A;  3LKP A;  4Y4K A;  3LN5 A;  1JPG A;  1I1A A;  1UQS A;  3HCV A;  3TO4 A;  1G7Q A;  2D31 A;  2GTW A;  3PWU A;  4NO2 A;  3BHB A;  1AGE A;  4L4T A;  3RWG A;  3NFN A;  4CVZ A;  3E6F A;  5F1I A;  4QRS A;  3G08 A;  4HUW A;  1M05 A;  4PJC A;  5H94 A;  5EUO A;  3SDD A;  1ZT1 A;  3CCH A;  4JFD A;  2DYP A;  3QZW A;  1SYS A;  3JTS A;  4NHU E;  5MER A;  3KPP A;  4Y4H A;  3KPO A;  1FG2 A;  1NAM H;  1I7T A;  5ENW A;  4S0U C;  1T22 A;  4EN3 C;  4N0F A;  4WU7 A;  1LEG A;  1SYV A;  1XZ0 A;  2FWO A;  4ZFZ A;  3LKR A;  3HLA A;  1S7X A;  4PGD A;  5IRO A;  4F7E A;  3W39 A;  3T8X A;  1L8J A;  5IND A;  3VWJ A;  3E2H A;  4HUV A;  3GSU A;  3GMP A;  4IHO A;  4HV8 A;  3L3J A;  3SDC A;  1B3J A;  1A9E A;  4E0R A;  3PWP A;  3LN4 A;  3SJV A;  1T7X A;  2X4T A;  3GIV A;  3L3G A;  3FQR A;  3TBV A;  3BW9 A;  2AKR A;  4PV9 A;  4PV8 A;  3SCM A;  3DMM A;  1T7Y A;  2NW3 A;  2XFX A;  3UTS A;  3TBS A;  1T0N A;  2BSR A;  3GMO A;  3HPJ A;  4WJ5 A;  2UWE A;  3FFC A;  3ARB A;  1T7V A;  5FA3 A;  2NX5 A;  3VFW A;  4U1N A;  1ZHN A;  1RK1 A;  2BCK A;  3QUZ A;  1C16 A;  4F7M A;  1UXW A;  5JHD A;  1CG9 A;  1T21 A;  5C0I A;  1KPR A;  4LCW A;  1WBY A;  4PRI A;  3MRJ A;  3RWC A;  3QUL A;  3VFN A;  3MRG A;  3QFD A;  4U1K A;  4NQC A;  1G7P A;  1AO7 A;  1LQV A;  2BSS A;  4Y4F A;  1Q94 A;  3RGV C;  3TVM A;  5J6H A;  3VFT A;  4V3E B;  5IEK A;  3SKO A;  4JFP A;  4Z76 A;  4F7T A;  3PWV A;  4L8D A;  2HLA A;  1DUY A;  4IIQ C;  2GAZ A;  3QQ4 A;  5F9J A;  5BXF A;  3ROL A;  4NQX A;  1W0W A;  3SDA A;  1A1N A;  3BP4 A;  3DX8 A;  1QO3 A;  1ZHB A;  4NNX A;  4PJ9 A;  3ILP A;  5E00 A;  3GMN A;  3RWH A;  3FOM A;  1FZM A;  4PJI A;  4LNR A;  4PJE A;  1DE4 A;  3CPL A; 
#chains in the Genus database with same CATH homology
 4PRA A;  3I6K A;  3VFM A;  4V3D B;  3PQY A;  5MEN A;  2RFX A;  1JFM A;  3AU1 A;  5HHN A;  2ZSW A;  4ONO A;  1WBZ A;  3FRU A;  3SPV A;  1DUZ A;  3SKM A;  4WDI A;  1MWA H;  4PJH A;  1EEY A;  5EFI A;  4JFQ A;  3MRE A;  4HX1 A;  4ZUT A;  1U58 A;  3KYN A;  4ZUW A;  4PJB A;  4QRP A;  4PJ7 A;  4PRE A;  3QQ3 A;  3C9N A;  3ECB A;  3VXM A;  3DX7 A;  5EU5 A;  3X14 A;  5FKP A;  3DX6 A;  3VXU A;  4PJG A;  2ZOK A;  2V2X A;  3WS6 A;  2FIK A;  4QRU A;  3TID A;  1DDH A;  4D0B A;  3RL2 A;  1S7U A;  5GSV A;  4X6E A;  3D39 A;  1S9X A;  3WL9 A;  4U1M A;  5INC A;  3GSN H;  5GSR A;  1I1F A;  3RWD A;  2HJK A;  3TBY A;  3UTQ A;  1P7Q A;  5L2K A;  3HE6 A;  1OGA A;  1K8D A;  4HS3 A;  2P5W A;  3QI9 A;  3MRP A;  4K7F A;  3X12 A;  2CLR A;  1GZQ A;  2GT9 A;  4PRD A;  3O4L A;  5E8P A;  5C0A A;  1X7Q A;  5DEG A;  4MJI A;  4JRX A;  2A83 A;  3KPN A;  3P77 A;  3KWW A;  1AGB A;  1JPF A;  4X6C A;  4G59 A;  4QRQ A;  4QRR A;  5C0C A;  3I6G A;  3PWJ A;  5IB3 A;  4WU5 A;  1PQZ A;  3RWJ A;  4MQ7 A;  1QLF A;  5C09 A;  3SDX A;  3E3Q A;  3C8K A;  1QR1 A;  2XPG A;  1KBG H;  2C7U A;  3MGT A;  1T1Z A;  3MRF A;  3GSR A;  2BVP A;  3V5D A;  1T0M A;  4CVX A;  1N59 A;  5EOT A;  3VXR A;  1JHT A;  1I7U A;  3MRK A;  3GSX A;  2X4R A;  1RJY A;  1KJM A;  4QRT A;  5IM7 A;  1VGK A;  3DXA A;  1FZO A;  3P4O A;  4NQE A;  3BEW A;  5C08 A;  1JUF A;  1KJV A;  3VCL A;  3TJH A;  1KJ2 H;  3QDM A;  1A9B A;  4PJ8 A;  1AGD A;  4JFE A;  5D7I A;  1QSF A;  4NNY A;  1YDP A;  2ZOL A;  3BEV A;  4MJ5 A;  5HGA A;  3UTT A;  1EFX A;  3AM8 A;  3CC5 A;  4GKS A;  3D3V A;  4JFF A;  1LP9 A;  4GUP A;  5C9J A;  1FO0 H;  1HSA A;  3GSW A;  4G8I A;  3P4N A;  4G8G A;  5HHM A;  3LV3 A;  3O3A A;  1CE6 A;  3VXN A;  1HHG A;  3KPS A;  3LKN A;  1S7T A;  5D2L A;  1ZHL A;  5EO1 A;  3VXO A;  5BJT A;  2VLK A;  4NO3 A;  4JQV A;  3IT8 D;  2VAB A;  1HHJ A;  1INQ A;  3E6H A;  3P73 A;  3WLB A;  4D0C A;  5SWQ A;  3TF7 A;  1GZP A;  1ZAG A;  3KPQ A;  5EU3 A;  3RWI A;  1NEZ A;  4Y2D A;  3MRC A;  1KTL A;  3VFS A;  3FOL A;  4O2F A;  5FA4 A;  1M6O A;  3TN0 A;  3GSQ A;  1T80 A;  1UXS A;  1CD1 A;  5F7D A;  3L9R A;  2YPL A;  2X4S A;  5C0F A;  3V5H A;  4PRB A;  1A6Z A;  4Y16 A;  5E8N A;  3O3D A;  3FQN A;  1ZT7 A;  1EEZ A;  4FTV A;  3ES6 A;  4PRH A;  2YEZ A;  5C0E A;  1BZ9 A;  4N0U A;  3MV8 A;  1MHC A;  1IM3 A;  1W72 A;  4Z78 A;  3O9W A;  3H7B A;  4MXQ A;  1JF1 A;  1VAC A;  5BRZ A;  2V2W A;  1KCG C;  3MRD A;  5HHQ A;  5IB1 A;  1AGC A;  1ONQ A;  2H6P A;  4UQ2 A;  1HSB A;  3HE7 A;  3CZF A;  5EU4 A;  4NO0 A;  4XXC A;  4CW1 A;  2VLL A;  4WO4 A;  4PJ5 A;  3VFR A;  3MGO A;  1TVH A;  1N3N A;  1QEW A;  4NO5 A;  4PJF A;  4N5E A;  3L3I A;  5HGB A;  3MRM A;  5BS0 A;  4MX7 A;  1HHK A;  4I4W A;  4MNQ A;  3TZV C;  1A1M A;  3D2U A;  3P4M A;  2BNQ A;  3MRB A;  1E27 A;  4L3C A;  4HUU A;  3H9H A;  4ZUV A;  5IB5 A;  1S9W A;  1T1Y A;  4PGE A;  3ARF A;  4Z77 A;  3FQX A;  3VFU A;  5MEQ A;  5E8O A;  4PRN A;  1FFO A;  1FZK A;  4PGB A;  1KPU A;  5MEO A;  3BGM A;  1QVO A;  5J6G A;  3DBX A;  4QOK A;  4PJD A;  1JGE A;  5ISZ A;  2VLR A;  1Z5L A;  2Q7Y A;  1ZSD A;  1HHH A;  4JRY A;  2VE6 A;  1YPZ A;  3MYJ A;  4PJA A;  3TO2 A;  3PWN A;  3HUJ A;  3BWA A;  4HUX A;  4PG2 A;  5DEF A;  3GMR A;  1RJZ A;  3BZF A;  4U1J A;  1ED3 A;  5C0B A;  1S7W A;  2X4N A;  4PRP A;  1T1W A;  4MJ6 A;  3UBX A;  1IM9 A;  1MHE A;  3T1F A;  2GTZ A;  2FYY A;  1T7W A;  3RL1 A;  4G9F A;  3TIE A;  3PAB A;  4N8V A;  4NT6 A;  3LKS A;  4APQ A;  2X4U A;  3M17 A;  4U1L A;  3PWL A;  2AV1 A;  2BVQ A;  3O3E A;  4PG9 A;  1P4L A;  3LKO A;  3QEQ A;  3CDG A;  4U6Y A;  1TMC A;  5HGH A;  5D7J C;  5HGD A;  1NAN H;  5SWS A;  5F1N A;  1W0V A;  4LHU A;  5C07 A;  4PP8 C;  3RUG A;  5B38 A;  3FT3 A;  4WUU A;  4ZUU A;  1OSZ A;  1P1Z A;  3O3B A;  5C0G A;  4L29 A;  1KJ3 H;  3HG1 A;  3W0W A;  5D9S A;  3REW A;  3TFK A;  4NQV A;  3HAE A;  2AXF A;  3KLA A;  3BO8 A;  4U1I A;  1XR8 A;  2GJ6 A;  3OV6 A;  3QDG A;  4K71 B;  3L3H A;  4LCC C;  1I4F A;  2ESV A;  3LKQ A;  4ZAK A;  2X70 A;  4IRS A;  5IB2 A;  1YN6 A;  4GKN A;  1QRN A;  3FON A;  3MR9 A;  5C0D A;  5EU6 A;  5IVX A;  5SWZ A;  4PGC A;  3QDJ A;  5EO0 A;  2VAA A;  3O8X A;  1AKJ A;  1T1X A;  3ROO A;  2VLJ A;  4U1H A;  1N2R A;  1QQD A;  3KYO A;  1S9Y A;  1YN7 A;  4G43 A;  2CLV A;  3BH8 A;  2FZ3 A;  2E7L E;  5ACZ A;  1MI5 A;  3TBT A;  3VRJ A;  1LD9 A;  2CLZ A;  2X4P A;  1T20 A;  3U0P A;  5IEH A;  3V5K A;  5E9D A;  2H26 A;  3X11 A;  3DTX A;  4PR5 A;  5D5M A;  1OF2 A;  1BQH A;  1S7V A;  3OXR A;  2BNR A;  1AGF A;  4MNG A;  1S8D A;  2CII A;  2MHA A;  2GUO A;  5HYJ A;  1T7Z A;  3MRQ A;  3QUY A;  4L4V A;  1B0G A;  1S7R A;  5J1A A;  3TPU E;  4LCY A;  3MRN A;  1BII A;  3QFJ A;  3FTG A;  3FQU A;  3L3D A;  5L2J A;  3B6S A;  1FFN A;  3JVG A;  3L3K A;  1K5N A;  2BST A;  2X4Q A;  1EXU A;  3MA7 A;  4MVB A;  1E28 A;  3S6C A;  5FDW A;  4L8B A;  3IXA A;  1I7R A;  2WY3 A;  4JQX A;  4PDC E;  1S7Q A;  2P5E A;  2CKB H;  5DDH A;  3TBW A;  3VRI A;  3MV7 A;  3P9M A;  3BZE A;  1N5A A;  1ZHK A;  3D18 A;  3JTT A;  1LEK A;  4F7C A;  3D25 A;  1XR9 A;  5HHP A;  2F54 A;  5MEP A;  1B0R A;  3FQW A;  4FFE X;  4MS8 A;  3VXS A;  2AXG A;  2JCC A;  4EUP A;  2J8U A;  3VXP A;  4WWK C;  3GJF A;  3MRL A;  2F74 A;  2PO6 A;  3ERY A;  3ARD A;  3WUW A;  3FT2 A;  3GSO A;  4NSK A;  4UQ3 A;  2OI9 A;  3KPM A;  1ZS8 A;  3MRO A;  4G42 A;  3RWF A;  4L3E A;  2F53 A;  3JTC A;  4X6D A;  3RZC A;  3FQT A;  1TVB A;  1A1O A;  3OX8 A;  3CVH A;  3GMQ A;  4PJX A;  2X4O A;  2PYE A;  3GSV A;  4X6F A;  2ZSV A;  1ZT4 A;  4G9D A;  1FFP A;  1HOC A;  5HHO A;  5D2N A;  4HKJ A;  3OXS A;  3QUX A;  3BVN A;  1QSE A;  1VAD A;  1I1Y A;  4E5X A;  3I6L D;  3BXN A;  3KPR A;  4L9L C;  2YPK A;  3BUY A;  3VFO A;  3CH1 A;  3TA3 A;  5C0J A;  2GIT A;  3MRR A;  4EI5 A;  4U1S A;  4ZUS A;  2AV7 A;  3VH8 A;  4ELM A;  1S7S A;  2OL3 H;  3GMM A;  4L8S C;  1KPV A;  2CIK A;  3ILQ C;  1R3H A;  3M1B A;  4NQD A;  3WS3 A;  3MRH A;  1JE6 A;  3H9S A;  3QUK A;  3P9L A;  5AD0 A;  3FT4 A;  1JGD A;  4HWZ A;  4F7P A;  3GML A;  1BD2 A;  3BP7 A;  4I48 A;  3MV9 A;  4O2C A;  5E6I C;  4N0C A;  3ARG A;  5D7L A;  1ZVS A;  4WW2 C;  3RWE A;  3BH9 A;  3VWK A;  2HJL A;  1RK0 A;  3ARE A;  3B3I A;  1LK2 A;  4U6X A;  4L8C A;  3VFV A;  3VJ6 A;  2AK4 A;  3KXF A;  4IRJ A;  1FZJ A;  1OGT A;  3X13 A;  2HN7 A;  1XH3 A;  2FO4 A;  3VFP A;  3UPR A;  1G6R H;  3RTQ A;  4D0D A;  5B39 A;  1LDP H;  1HHI A;  3KPL A;  1HYR C;  5IB4 A;  2BVO A;  4JFO A;  1WBX A;  3MRI A;  4O2E A;  3LKP A;  4Y4K A;  3LN5 A;  1JPG A;  1I1A A;  1UQS A;  3HCV A;  3TO4 A;  1G7Q A;  2D31 A;  2GTW A;  3PWU A;  4NO2 A;  3BHB A;  1AGE A;  4L4T A;  3RWG A;  3NFN A;  4CVZ A;  3E6F A;  5F1I A;  4QRS A;  3G08 A;  4HUW A;  1M05 A;  4PJC A;  5H94 A;  5EUO A;  3SDD A;  1ZT1 A;  3CCH A;  4JFD A;  2DYP A;  3QZW A;  1SYS A;  3JTS A;  4NHU E;  5MER A;  3KPP A;  4Y4H A;  3KPO A;  1FG2 A;  1NAM H;  1I7T A;  5ENW A;  4S0U C;  1T22 A;  4EN3 C;  4N0F A;  4WU7 A;  1LEG A;  1SYV A;  1XZ0 A;  2FWO A;  4ZFZ A;  3LKR A;  3HLA A;  1S7X A;  4PGD A;  5IRO A;  4F7E A;  3W39 A;  3T8X A;  1L8J A;  5IND A;  3VWJ A;  3E2H A;  4HUV A;  3GSU A;  3GMP A;  4IHO A;  4HV8 A;  3L3J A;  3SDC A;  1B3J A;  1A9E A;  4E0R A;  3PWP A;  3LN4 A;  3SJV A;  1T7X A;  2X4T A;  3GIV A;  3L3G A;  3FQR A;  3TBV A;  3BW9 A;  2AKR A;  4PV9 A;  4PV8 A;  3SCM A;  3DMM A;  1T7Y A;  2NW3 A;  2XFX A;  3UTS A;  3TBS A;  1T0N A;  2BSR A;  3GMO A;  3HPJ A;  4WJ5 A;  2UWE A;  3FFC A;  3ARB A;  1T7V A;  5FA3 A;  2NX5 A;  3VFW A;  4U1N A;  1ZHN A;  1RK1 A;  2BCK A;  3QUZ A;  1C16 A;  4F7M A;  1UXW A;  5JHD A;  1CG9 A;  1T21 A;  5C0I A;  1KPR A;  4LCW A;  1WBY A;  4PRI A;  3MRJ A;  3RWC A;  3QUL A;  3VFN A;  3MRG A;  3QFD A;  4U1K A;  4NQC A;  1G7P A;  1AO7 A;  1LQV A;  2BSS A;  4Y4F A;  1Q94 A;  3RGV C;  3TVM A;  5J6H A;  3VFT A;  4V3E B;  5IEK A;  3SKO A;  4JFP A;  4Z76 A;  4F7T A;  3PWV A;  4L8D A;  2HLA A;  1DUY A;  4IIQ C;  2GAZ A;  3QQ4 A;  5F9J A;  5BXF A;  3ROL A;  4NQX A;  1W0W A;  3SDA A;  1A1N A;  3BP4 A;  3DX8 A;  1QO3 A;  1ZHB A;  4NNX A;  4PJ9 A;  3ILP A;  5E00 A;  3GMN A;  3RWH A;  3FOM A;  1FZM A;  4PJI A;  4LNR A;  4PJE A;  1DE4 A;  3CPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...