4N5EA

42f3 tcr pcpa12/h-2ld complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
174
structure length
174
Chain Sequence
PHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQIAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQWMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural interplay between germline interactions and adaptive recognition determines the bandwidth of TCR-peptide-MHC cross-reactivity.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
molecule keywords 42F3 alpha VmCh
total genus 52
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2013-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4n5eA00
1N5AA 4HWZA 4IIQC 4JFPA 1KTLA 2X4OA 2CIIA 5HGAA 3MRGA 4U6XA 2HN7A 4WU7A 5B39A 3UPRA 1DUYA 5E00A 3X12A 5HHNA 4HX1A 4LCWA 5F7DA 5E8OA 3UBXA 4WU5A 3MRQA 3ERYA 3HPJA 3L3KA 1UXWA 1ZT4A 4NO3A 3KPNA 4NQDA 3BP7A 3MV8A 3RGVC 4E0RA 5EU5A 2VLLA 5AD0A 4ZUUA 3VXOA 3HE7A 5F9JA 5D7JC 2X4QA 3C9NA 3ES6A 2AK4A 3MRLA 3BXNA 4PRHA 3AU1A 3O4LA 3TN0A 4ZAKA 1T20A 2P5EA 4UQ2A 5EU3A 1AO7A 5J1AA 1JGDA 1LQVA 4G8GA 1ED3A 1KPVA 1T7XA 4PRBA 3RWDA 5MENA 2V2XA 5SWSA 4QRRA 1T22A 4HKJA 3VWKA 3PQYA 4V3EB 4PGEA 5C0IA 2GAZA 3I6GA 2NX5A 4G8IA 1OGTA 3SKMA 5INDA 3SDDA 1FZOA 1S7RA 4F7TA 4PV9A 1AGFA 1SYVA 3GSNH 2PO6A 2BCKA 3GMRA 3MRCA 1I4FA 1T1WA 1S9WA 2GJ6A 4NO5A 2NW3A 4D0BA 1T7YA 3H7BA 4G59A 1LEKA 3H9HA 3T8XA 3VCLA 3GJFA 3TIEA 1E27A 1ZHLA 4L8SC 3GSXA 4PRDA 4U1KA 3GMLA 4U1LA 1XR8A 3MYJA 3QZWA 1FFOA 3I6KA 4WJ5A 1BIIA 1P7QA 3E6HA 3ARBA 1WBXA 1P1ZA 3TO2A 2X4TA 3D18A 3FONA 3QUXA 4NSKA 2CKBH 2GT9A 2X4UA 3T1FA 4QRQA 4O2EA 5E8PA 3IT8D 4XXCA 4LCCC 4JFDA 4Z77A 3GMQA 4X6EA 4PREA 1TVBA 3QUKA 4NNYA 1KJVA 3TFKA 3OXSA 2OI9A 3FT4A 1CE6A 1QSEA 4U1JA 2CLVA 3OV6A 3FQWA 5EO0A 1X7QA 3X13A 2GUOA 1BD2A 3MRPA 1T1ZA 4G9DA 1TMCA 1T7WA 1EEZA 1ZT1A 5IROA 3HCVA 4PDCE 4V3DB 1FG2A 5E9DA 1B0GA 3FOLA 1KJ2H 2AV7A 1VACA 2YEZA 2BSTA 3LKPA 5C0CA 2C7UA 1C16A 3LKSA 3QUYA 3MV9A 2H6PA 3ROOA 4MNGA 3FQXA 3SJVA 3WUWA 3AREA 1KPRA 3GSUA 4L9LC 2OL3H 3VXSA 3MRDA 3MRMA 4Y4HA 3MREA 4PJ9A 1B0RA 1LEGA 3FQTA 2CLRA 3TZVC 1M6OA 5HYJA 1A9BA 1HHKA 1QQDA 4QRPA 4WW2C 4L8CA 3VWJA 2RFXA 1E28A 4ZUSA 1FO0H 4EI5A 4MVBA 3SDXA 5SWQA 5ACZA 5C0JA 3VFOA 4PJFA 3M17A 3PABA 1S9XA 3WS3A 4K71B 5HHMA 2AXGA 3V5DA 2VLKA 1Q94A 5C09A 2VLJA 1JGEA 3GSOA 3VJ6A 1HOCA 4HV8A 1FZMA 3L9RA 1YPZA 3FT2A 1QRNA 1ZVSA 5HHOA 3VXRA 4PJCA 4PGCA 5B38A 2FZ3A 3ARFA 4PRIA 1G7PA 2AV1A 1GZQA 2VAAA 1RJYA 3RWGA 2BVPA 4S0UC 1K5NA 1A1NA 2GTZA 2VE6A 1HHGA 3P4OA 1N2RA 5IB2A 3CCHA 5D7LA 3ARDA 3MRJA 1NAMH 2JCCA 3P4NA 5E8NA 4JRXA 2VLRA 4X6FA 4I4WA 4Y4KA 3QDMA 3UTTA 1S7QA 4HUVA 1RK0A 3JTTA 3JVGA 3GMOA 4PGDA 1BQHA 4ZUWA 3JTCA 1S7SA 4NT6A 2ZSWA 3RZCA 2VABA 3WS6A 3FQRA 1FZKA 1AGDA 3BZFA 2DYPA 1LP9A 3KPOA 3MRNA 1T80A 5IB5A 4F7MA 1VGKA 4L8BA 3DX7A 1EXUA 5C9JA 1WBYA 3KYOA 4O2CA 4EN3C 3IXAA 4WDIA 3D39A 3VFNA 1QR1A 5D7IA 3TPUE 4PRNA 5IM7A 1S7TA 4U1NA 3U0PA 3ARGA 3OXRA 1QLFA 3LKRA 3KPMA 3VFTA 4CVXA 4MJ6A 4NQVA 4NHUE 1S7UA 3VFSA 4PJBA 5HGBA 4NNXA 3GSQA 5D9SA 4PJ5A 1A1OA 3GSWA 4JFFA 3E6FA 3VRJA 3RWCA 4WWKC 2BSSA 3QDGA 3QEQA 2P5WA 3P73A 1AGBA 4MX7A 4N8VA 2FIKA 1HSAA 1QVOA 2BNQA 1YDPA 2J8UA 1CD1A 4LNRA 1CG9A 1N3NA 2FWOA 3MRBA 5J6GA 3O3BA 3CC5A 3GMMA 3LKOA 3VFMA 5MEQA 4WO4A 3AM8A 4PG9A 1KPUA 4HS3A 4JRYA 1QSFA 2X4PA 3QULA 1QO3A 1SYSA 3TO4A 1I1AA 5C0FA 5FA3A 4PGBA 3VFRA 5HHQA 3TA3A 3JTSA 4ONOA 1T7VA 1ZT7A 4PJXA 4NO2A 4X6CA 4QRUA 1A1MA 3PWPA 3RWJA 1OF2A 3TIDA 3FQNA 4U1HA 2AKRA 3D25A 4LCYA 3KYNA 3BVNA 1RK1A 3HUJA 4G9FA 1XZ0A 4MS8A 3D3VA 1S7WA 1W0VA 4N5EA 3TBYA 3UTSA 3BGMA 1WBZA 3TBWA 5FA4A 3RWFA 3QQ4A 1MWAH 5F1NA 3W0WA 3HE6A 3DX6A 3C8KA 3MRRA 3DTXA 3MROA 4L29A 4PJ8A 4F7PA 4Z76A 1DDHA 3LN5A 3O9WA 3VH8A 1S7XA 2Q7YA 3PWUA 1K8DA 1XR9A 4NO0A 3REWA 4Z78A 1FFPA 1JPGA 5H94A 3X11A 4CVZA 5D5MA 1ONQA 4L4VA 1VADA 4NQEA 3BH9A 3FT3A 4O2FA 3FTGA 5DEGA 3UTQA 3VFWA 3VRIA 1UXSA 1INQA 1Z5LA 3FQUA 5IB3A 1MHEA 5EU4A 1TVHA 3VXNA 1HHIA 1KJ3H 4F7CA 4LHUA 3ILPA 3LN4A 4PRPA 1U58A 3BO8A 4PJIA 3RL2A 3V5HA 3SCMA 3L3IA 2BVOA 3TBVA 3B6SA 2D31A 1P4LA 3P9MA 5C0AA 4G43A 5EO1A 5MEPA 4U1MA 5ISZA 4IHOA 2A83A 4L3EA 5HGDA 4FTVA 1FFNA 4PR5A 1LD9A 1S7VA 1ZSDA 1T0NA 1HSBA 3FRUA 3P4MA 3RWIA 3MRIA 1YN6A 1I7RA 1A6ZA 1KCGC 3BEWA 1EFXA 3O3EA 4QRSA 1PQZA 1IM3A 4IRSA 4L4TA 4PJAA 1ZHBA 5IEKA 2X70A 3I6LD 5DDHA 3RUGA 1OGAA 3HAEA 1I1YA 3FOMA 3S6CA 3L3HA 2X4NA 2XPGA 2XFXA 2HLAA 5E6IC 5J6HA 5EUOA 1HYRC 3GMNA 4PP8C 5BRZA 1LDPH 5L2KA 3SKOA 3MGOA 5BS0A 5ENWA 3KPLA 1B3JA 4PJHA 3KPSA 1AKJA 2F74A 2BNRA 4ELMA 1M05A 1R3HA 1RJZA 5BJTA 1I1FA 2ZOKA 4HUXA 3BUYA 3LKQA 1AGCA 3KPRA 3PWJA 1HHJA 3MRFA 4G42A 2F54A 5L2JA 5HHPA 4Y4FA 1T7ZA 4Y2DA 3HG1A 2PYEA 3GMPA 4JQXA 1S8DA 2HJKA 1I7UA 3BP4A 4WUUA 5C0GA 1IM9A 3QQ3A 5D2NA 4U1SA 5GSRA 5IB4A 2CIKA 4MXQA 4N0UA 2GTWA 3L3JA 5INCA 4PG2A 3BWAA 3CPLA 3OX8A 4ZUVA 4PV8A 4ZFZA 3D2UA 2WY3A 2MHAA 1NANH 1T21A 5C0BA 4L8DA 1ZHNA 5MERA 3O3AA 3DMMA 4FFEX 3KPQA 4K7FA 3PWNA 3ROLA 3VXMA 4GKNA 4D0DA 1BZ9A 5BXFA 1N59A 2YPKA 1I7TA 4F7EA 4QRTA 4UQ3A 1ZS8A 3L3GA 3CH1A 1AGEA 3L3DA 3TJHA 3MGTA 4QOKA 3G08A 4PJDA 3ILQC 4MQ7A 1ZHKA 2HJLA 3KLAA 5EOTA 4Y16A 2FO4A 4NQXA 3BHBA 4PJEA 5HGHA 4D0CA 3BW9A 3NFNA 3QDJA 3RWHA 3H9SA 3MRKA 4ZUTA 1MHCA 5D2LA 3RL1A 3BZEA 1S9YA 4GKSA 3KPPA 3CZFA 1HHHA 3WLBA 1MI5A 4MNQA 4PJGA 5MEOA 3DBXA 1KBGH 3FFCA 1W72A 1ZAGA 3KXFA 3PWLA 4JFQA 2ZOLA 4MJ5A 2ZSVA 5FKPA 3TVMA 3X14A 2YPLA 4U6YA 1JUFA 3VFUA 3GSRA 2UWEA 3MV7A 2V2WA 3DX8A 3VXUA 1JF1A 2BVQA 5C0EA 3MRHA 3SDCA 4CW1A 3DXAA 2E7LE 2ESVA 3QFDA 3RTQA 3LKNA 1T1YA 3QFJA 3RWEA 1DE4A 2GITA 1JHTA 3CDGA 4PRAA 3VFVA 3TBSA 3PWVA 4IRJA 3B3IA 1T0MA 1XH3A 4PJ7A 4E5XA 1A9EA 2BSRA 1JPFA 4N0CA 4NQCA 3BEVA 5C08A 5FDWA 3TF7A 2H26A 3GIVA 4JFOA 2F53A 3ECBA 4N0FA 5IB1A 1NEZA 3MR9A 1GZPA 4APQA 4JFEA 2CLZA 3E2HA 3SDAA 5JHDA 3VFPA 3P77A 3O3DA 5DEFA 5IVXA 4X6DA 5EFIA 3HLAA 5EU6A 2FYYA 3SPVA 1W0WA 1UQSA 1KJMA 1JE6A 1G7QA 1LK2A 5F1IA 3QUZA 4U1IA 1YN7A 3KWWA 3TBTA 1OSZA 3GSVA 3BH8A 2X4SA 4JQVA 5SWZA 5C0DA 3M1BA 4I48A 3VXPA 5GSVA 3QI9A 4L3CA 3O8XA 4MJIA 1L8JA 1DUZA 1EEYA 1QEWA 3MA7A 4GUPA 5IEHA 3P9LA 4HUUA 3WL9A 3CVHA 3V5KA 2AXFA 3W39A 3E3QA 1G6RH 4HUWA 1FZJA 2X4RA 4EUPA 1JFMA 1T1XA 5C07A 3LV3A
chains in the Genus database with same CATH superfamily
1N5AA 4HWZA 4IIQC 4JFPA 1KTLA 2X4OA 2CIIA 5HGAA 3MRGA 4U6XA 2HN7A 4WU7A 5B39A 3UPRA 1DUYA 5E00A 3X12A 5HHNA 4HX1A 4LCWA 5F7DA 5E8OA 3UBXA 4WU5A 3MRQA 3ERYA 3HPJA 3L3KA 1UXWA 1ZT4A 4NO3A 3KPNA 4NQDA 3BP7A 3MV8A 3RGVC 4G59C 5EU5A 4E0RA 2VLLA 5AD0A 4ZUUA 3VXOA 3HE7A 5F9JA 5D7JC 2X4QA 3C9NA 3ES6A 2AK4A 3MRLA 3BXNA 4PRHA 3AU1A 3O4LA 3TN0A 4ZAKA 1T20A 2P5EA 4UQ2A 5EU3A 1AO7A 4JO8A 5J1AA 1JGDA 1LQVA 4G8GA 1ED3A 1KPVA 1T7XA 4PRBA 3RWDA 5MENA 2V2XA 5SWSA 4QRRA 1T22A 4HKJA 3VWKA 3PQYA 4V3EB 4PGEA 5C0IA 2GAZA 3I6GA 2NX5A 4G8IA 1OGTA 3SKMA 5INDA 3SDDA 1FZOA 1S7RA 4F7TA 4PV9A 1AGFA 1SYVA 3GSNH 2PO6A 2BCKA 3GMRA 3MRCA 1I4FA 1T1WA 1S9WA 2GJ6A 4NO5A 2NW3A 4D0BA 1T7YA 3H7BA 4G59A 1LEKA 3H9HA 3T8XA 3VCLA 3GJFA 3TIEA 1E27A 1ZHLA 4L8SC 3GSXA 4PRDA 4U1KA 3GMLA 4U1LA 1XR8A 3MYJA 3QZWA 1FFOA 3I6KA 4WJ5A 1BIIA 1P7QA 3E6HA 3ARBA 1WBXA 1P1ZA 3TO2A 2X4TA 3D18A 3FONA 3QUXA 4NSKA 2CKBH 2GT9A 2X4UA 3T1FA 4QRQA 4O2EA 5E8PA 3IT8D 4XXCA 4LCCC 4JFDA 4Z77A 3GMQA 4X6EA 4PREA 1TVBA 3QUKA 4NNYA 1KJVA 3TFKA 3OXSA 2O5NA 2OI9A 3FT4A 1CE6A 1QSEA 4U1JA 2CLVA 3OV6A 3FQWA 5EO0A 1X7QA 3X13A 2GUOA 1BD2A 3MRPA 1T1ZA 4G9DA 1TMCA 1T7WA 1EEZA 1ZT1A 5IROA 3HCVA 4PDCE 4V3DB 1FG2A 5E9DA 1B0GA 3FOLA 1KJ2H 2AV7A 1VACA 2YEZA 3I0TA 2BSTA 3LKPA 5C0CA 2C7UA 1C16A 3LKSA 3QUYA 3MV9A 2H6PA 3ROOA 4MNGA 3FQXA 3SJVA 3WUWA 3AREA 1KPRA 3GSUA 4L9LC 2OL3H 3VXSA 3MRDA 3MRMA 4Y4HA 3MREA 4PJ9A 1B0RA 1LEGA 3FQTA 2CLRA 3TZVC 1M6OA 5HYJA 1A9BA 1HHKA 1QQDA 4QRPA 4WW2C 4L8CA 3VWJA 2RFXA 1E28A 4ZUSA 1FO0H 4EI5A 4MVBA 3SDXA 5SWQA 5ACZA 5C0JA 3VFOA 4PJFA 3M17A 3PABA 1S9XA 3WS3A 4K71B 5HHMA 2AXGA 3V5DA 2VLKA 1Q94A 5C09A 2VLJA 1JGEA 3GSOA 3VJ6A 1HOCA 4HV8A 1FZMA 3L9RA 1YPZA 3FT2A 1QRNA 1ZVSA 5HHOA 3VXRA 4PJCA 4PGCA 5B38A 2FZ3A 3ARFA 4PRIA 1G7PA 2AV1A 1GZQA 2VAAA 1RJYA 3RWGA 2BVPA 4S0UC 1K5NA 1A1NA 2GTZA 2VE6A 1HHGA 3P4OA 1N2RA 5IB2A 3CCHA 5D7LA 3ARDA 3MRJA 1NAMH 2IA1A 2JCCA 3P4NA 5E8NA 4JRXA 2VLRA 4X6FA 4I4WA 4Y4KA 3QDMA 3UTTA 1S7QA 4HUVA 1RK0A 3JTTA 3JVGA 3GMOA 4PGDA 1BQHA 4ZUWA 3JTCA 1S7SA 4NT6A 2ZSWA 3RZCA 2VABA 3WS6A 3FQRA 1FZKA 1AGDA 3BZFA 2DYPA 1LP9A 3KPOA 3MRNA 1T80A 5IB5A 4F7MA 1VGKA 4L8BA 3DX7A 1EXUA 5C9JA 1WBYA 3KYOA 4O2CA 4EN3C 3IXAA 4WDIA 3D39A 3VFNA 1QR1A 5D7IA 3TPUE 4PRNA 5IM7A 1S7TA 4U1NA 3U0PA 3ARGA 3OXRA 1QLFA 3LKRA 3KPMA 3VFTA 4CVXA 4MJ6A 4NQVA 4NHUE 1S7UA 3VFSA 4PJBA 5HGBA 4NNXA 3GSQA 5D9SA 4PJ5A 1A1OA 3GSWA 4JFFA 3E6FA 3VRJA 3RWCA 4WWKC 2BSSA 3QDGA 3QEQA 2P5WA 3P73A 1AGBA 4MX7A 4N8VA 2FIKA 1HSAA 1QVOA 2BNQA 1YDPA 2J8UA 1CD1A 4LNRA 1CG9A 1N3NA 2FWOA 3MRBA 5J6GA 3O3BA 3CC5A 3GMMA 3LKOA 3VFMA 5MEQA 4WO4A 3AM8A 4PG9A 1KPUA 4HS3A 4JRYA 1QSFA 2X4PA 3QULA 1QO3A 1SYSA 3TO4A 1I1AA 5C0FA 5FA3A 4PGBA 3VFRA 5HHQA 3TA3A 3JTSA 4ONOA 1T7VA 1ZT7A 4PJXA 4NO2A 4X6CA 4QRUA 1A1MA 3PWPA 3RWJA 1OF2A 3TIDA 3FQNA 4U1HA 2AKRA 3D25A 4LCYA 3KYNA 3BVNA 1RK1A 3HUJA 4G9FA 1XZ0A 4MS8A 3D3VA 1S7WA 1W0VA 4N5EA 3TBYA 3UTSA 3BGMA 1WBZA 3TBWA 5FA4A 3RWFA 3QQ4A 1MWAH 5F1NA 3W0WA 3HE6A 3DX6A 3C8KA 3MRRA 3DTXA 3MROA 4L29A 4PJ8A 4F7PA 4Z76A 1DDHA 3LN5A 3O9WA 3VH8A 1S7XA 2Q7YA 3PWUA 1K8DA 1XR9A 4NO0A 3REWA 4Z78A 1FFPA 1JPGA 5H94A 3X11A 4CVZA 5D5MA 1ONQA 4L4VA 1VADA 4NQEA 3BH9A 3FT3A 4O2FA 3FTGA 5DEGA 3UTQA 3VFWA 3VRIA 1UXSA 1INQA 1Z5LA 3FQUA 5IB3A 1MHEA 5EU4A 1TVHA 3VXNA 1HHIA 1KJ3H 4F7CA 4LHUA 3ILPA 3LN4A 4PRPA 1U58A 3BO8A 4PJIA 3RL2A 3V5HA 3SCMA 3L3IA 2BVOA 3TBVA 3B6SA 2D31A 1P4LA 3P9MA 5C0AA 4G43A 5EO1A 5MEPA 4U1MA 5ISZA 4IHOA 2A83A 4L3EA 5HGDA 4BKWA 4FTVA 1FFNA 4PR5A 1LD9A 1S7VA 1ZSDA 1T0NA 1HSBA 3FRUA 3P4MA 3RWIA 3MRIA 1YN6A 1I7RA 1A6ZA 1KCGC 3BEWA 1EFXA 3O3EA 4QRSA 1PQZA 1IM3A 4IRSA 4L4TA 4PJAA 1ZHBA 5IEKA 2X70A 3I6LD 5DDHA 3RUGA 1OGAA 3HAEA 1I1YA 3FOMA 3S6CA 3L3HA 2X4NA 2XPGA 2XFXA 2HLAA 5E6IC 5J6HA 5EUOA 1HYRC 3GMNA 4PP8C 5BRZA 1LDPH 5L2KA 3SKOA 3MGOA 5BS0A 5ENWA 3KPLA 1B3JA 4PJHA 3KPSA 1AKJA 2F74A 2BNRA 4ELMA 1M05A 1R3HA 1RJZA 5BJTA 1I1FA 2ZOKA 4HUXA 3BUYA 3LKQA 1AGCA 3KPRA 3PWJA 1HHJA 3MRFA 4G42A 2F54A 5L2JA 5HHPA 4Y4FA 1T7ZA 4Y2DA 3HG1A 2PYEA 3GMPA 4JQXA 1S8DA 2HJKA 1I7UA 3BP4A 4WUUA 5C0GA 1IM9A 3QQ3A 5D2NA 4U1SA 5GSRA 5IB4A 2CIKA 4MXQA 4N0UA 2GTWA 3L3JA 5INCA 4PG2A 3BWAA 3CPLA 3OX8A 4ZUVA 4PV8A 4ZFZA 3D2UA 2WY3A 2MHAA 1NANH 1T21A 5C0BA 4L8DA 1ZHNA 5MERA 3O3AA 3DMMA 4FFEX 3KPQA 4K7FA 3PWNA 3ROLA 3VXMA 4GKNA 4D0DA 1BZ9A 5BXFA 1N59A 2YPKA 1I7TA 4F7EA 4QRTA 4UQ3A 1ZS8A 3L3GA 3CH1A 1AGEA 3L3DA 3TJHA 3MGTA 4QOKA 3G08A 4PJDA 3ILQC 4MQ7A 1ZHKA 2HJLA 3KLAA 5EOTA 4Y16A 2FO4A 4NQXA 3BHBA 4PJEA 5HGHA 4D0CA 3BW9A 3NFNA 3QDJA 3RWHA 3H9SA 3MRKA 4ZUTA 1MHCA 5D2LA 3RL1A 3BZEA 1S9YA 4GKSA 3KPPA 3CZFA 1HHHA 3WLBA 1MI5A 4MNQA 4PJGA 5MEOA 3DBXA 1KBGH 3FFCA 1W72A 1ZAGA 3KXFA 3PWLA 4JFQA 2ZOLA 4MJ5A 2ZSVA 5FKPA 3TVMA 3X14A 2YPLA 4U6YA 1JUFA 3VFUA 3GSRA 2UWEA 3MV7A 2V2WA 2NYKA 3DX8A 3VXUA 1JF1A 2BVQA 5C0EA 3MRHA 3SDCA 4CW1A 3DXAA 2E7LE 2ESVA 3QFDA 3RTQA 3LKNA 1T1YA 3QFJA 3RWEA 1DE4A 2GITA 1JHTA 3CDGA 4PRAA 3VFVA 3TBSA 3PWVA 4IRJA 3B3IA 1T0MA 1XH3A 4PJ7A 4E5XA 1A9EA 2BSRA 1JPFA 4N0CA 4NQCA 3BEVA 5C08A 5FDWA 3TF7A 2H26A 3GIVA 4JFOA 2F53A 3ECBA 4N0FA 5IB1A 1NEZA 3MR9A 1GZPA 4APQA 4JFEA 2CLZA 3E2HA 3SDAA 5JHDA 3VFPA 3P77A 3O3DA 5DEFA 5IVXA 4X6DA 5EFIA 3HLAA 5EU6A 2FYYA 3SPVA 1W0WA 1UQSA 1KJMA 1JE6A 1G7QA 1LK2A 5F1IA 3QUZA 4U1IA 1YN7A 3KWWA 3TBTA 1OSZA 3GSVA 3BH8A 2X4SA 4JQVA 5SWZA 5C0DA 3M1BA 4I48A 3VXPA 5GSVA 3QI9A 4L3CA 3O8XA 4MJIA 1L8JA 1DUZA 1EEYA 1QEWA 3MA7A 4GUPA 5IEHA 3P9LA 4HUUA 3WL9A 3CVHA 3V5KA 2AXFA 3W39A 3E3QA 1G6RH 4HUWA 1FZJA 2X4RA 4EUPA 1JFMA 1T1XA 5C07A 3LV3A
chains in the Genus database with same CATH topology
1N5AA 4HWZA 4IIQC 4JFPA 1KTLA 2X4OA 2CIIA 5HGAA 3MRGA 4U6XA 2HN7A 4WU7A 5B39A 3UPRA 1DUYA 5E00A 3X12A 5HHNA 4HX1A 4LCWA 5F7DA 5E8OA 3UBXA 4WU5A 3MRQA 3ERYA 3HPJA 3L3KA 1UXWA 1ZT4A 4NO3A 3KPNA 4NQDA 3BP7A 3MV8A 3RGVC 4E0RA 5EU5A 2VLLA 5AD0A 4ZUUA 3VXOA 3HE7A 5F9JA 5D7JC 2X4QA 3C9NA 3ES6A 2AK4A 3MRLA 3BXNA 4PRHA 3AU1A 3O4LA 3TN0A 4ZAKA 1T20A 2P5EA 4UQ2A 5EU3A 1AO7A 5J1AA 1JGDA 1LQVA 4G8GA 1ED3A 1KPVA 1T7XA 4PRBA 3RWDA 5MENA 2V2XA 5SWSA 4QRRA 1T22A 4HKJA 3VWKA 3PQYA 4V3EB 4PGEA 5C0IA 2GAZA 3I6GA 2NX5A 4G8IA 1OGTA 3SKMA 5INDA 3SDDA 1FZOA 1S7RA 4F7TA 4PV9A 1AGFA 1SYVA 3GSNH 2PO6A 2BCKA 3GMRA 3MRCA 1I4FA 1T1WA 1S9WA 2GJ6A 4NO5A 2NW3A 4D0BA 1T7YA 3H7BA 4G59A 1LEKA 3H9HA 3T8XA 3VCLA 3GJFA 3TIEA 1E27A 1ZHLA 4L8SC 3GSXA 4PRDA 4U1KA 3GMLA 4U1LA 1XR8A 3MYJA 3QZWA 1FFOA 3I6KA 4WJ5A 1BIIA 1P7QA 3E6HA 3ARBA 1WBXA 1P1ZA 3TO2A 2X4TA 3D18A 3FONA 3QUXA 4NSKA 2CKBH 2GT9A 2X4UA 3T1FA 4QRQA 4O2EA 5E8PA 3IT8D 4XXCA 4LCCC 4JFDA 4Z77A 3GMQA 4X6EA 4PREA 1TVBA 3QUKA 4NNYA 1KJVA 3TFKA 3OXSA 2OI9A 3FT4A 1CE6A 1QSEA 4U1JA 2CLVA 3OV6A 3FQWA 5EO0A 1X7QA 3X13A 2GUOA 1BD2A 3MRPA 1T1ZA 4G9DA 1TMCA 1T7WA 1EEZA 1ZT1A 5IROA 3HCVA 4PDCE 4V3DB 1FG2A 5E9DA 1B0GA 3FOLA 1KJ2H 2AV7A 1VACA 2YEZA 2BSTA 3LKPA 5C0CA 2C7UA 1C16A 3LKSA 3QUYA 3MV9A 2H6PA 3ROOA 4MNGA 3FQXA 3SJVA 3WUWA 3AREA 1KPRA 3GSUA 4L9LC 2OL3H 3VXSA 3MRDA 3MRMA 4Y4HA 3MREA 4PJ9A 1B0RA 1LEGA 3FQTA 2CLRA 3TZVC 1M6OA 5HYJA 1A9BA 1HHKA 1QQDA 4QRPA 4WW2C 4L8CA 3VWJA 2RFXA 1E28A 4ZUSA 1FO0H 4EI5A 4MVBA 3SDXA 5SWQA 5ACZA 5C0JA 3VFOA 4PJFA 3M17A 3PABA 1S9XA 3WS3A 4K71B 5HHMA 2AXGA 3V5DA 2VLKA 1Q94A 5C09A 2VLJA 1JGEA 3GSOA 3VJ6A 1HOCA 4HV8A 1FZMA 3L9RA 1YPZA 3FT2A 1QRNA 1ZVSA 5HHOA 3VXRA 4PJCA 4PGCA 5B38A 2FZ3A 3ARFA 4PRIA 1G7PA 2AV1A 1GZQA 2VAAA 1RJYA 3RWGA 2BVPA 4S0UC 1K5NA 1A1NA 2GTZA 2VE6A 1HHGA 3P4OA 1N2RA 5IB2A 3CCHA 5D7LA 3ARDA 3MRJA 1NAMH 2JCCA 3P4NA 5E8NA 4JRXA 2VLRA 4X6FA 4I4WA 4Y4KA 3QDMA 3UTTA 1S7QA 4HUVA 1RK0A 3JTTA 3JVGA 3GMOA 4PGDA 1BQHA 4ZUWA 3JTCA 1S7SA 4NT6A 2ZSWA 3RZCA 2VABA 3WS6A 3FQRA 1FZKA 1AGDA 3BZFA 2DYPA 1LP9A 3KPOA 3MRNA 1T80A 5IB5A 4F7MA 1VGKA 4L8BA 3DX7A 1EXUA 5C9JA 1WBYA 3KYOA 4O2CA 4EN3C 3IXAA 4WDIA 3D39A 3VFNA 1QR1A 5D7IA 3TPUE 4PRNA 5IM7A 1S7TA 4U1NA 3U0PA 3ARGA 3OXRA 1QLFA 3LKRA 3KPMA 3VFTA 4CVXA 4MJ6A 4NQVA 4NHUE 1S7UA 3VFSA 4PJBA 5HGBA 4NNXA 3GSQA 5D9SA 4PJ5A 1A1OA 3GSWA 4JFFA 3E6FA 3VRJA 3RWCA 4WWKC 2BSSA 3QDGA 3QEQA 2P5WA 3P73A 1AGBA 4MX7A 4N8VA 2FIKA 1HSAA 1QVOA 2BNQA 1YDPA 2J8UA 1CD1A 4LNRA 1CG9A 1N3NA 2FWOA 3MRBA 5J6GA 3O3BA 3CC5A 3GMMA 3LKOA 3VFMA 5MEQA 4WO4A 3AM8A 4PG9A 1KPUA 4HS3A 4JRYA 1QSFA 2X4PA 3QULA 1QO3A 1SYSA 3TO4A 1I1AA 5C0FA 5FA3A 4PGBA 3VFRA 5HHQA 3TA3A 3JTSA 4ONOA 1T7VA 1ZT7A 4PJXA 4NO2A 4X6CA 4QRUA 1A1MA 3PWPA 3RWJA 1OF2A 3TIDA 3FQNA 4U1HA 2AKRA 3D25A 4LCYA 3KYNA 3BVNA 1RK1A 3HUJA 4G9FA 1XZ0A 4MS8A 3D3VA 1S7WA 1W0VA 4N5EA 3TBYA 3UTSA 3BGMA 1WBZA 3TBWA 5FA4A 3RWFA 3QQ4A 1MWAH 5F1NA 3W0WA 3HE6A 3DX6A 3C8KA 3MRRA 3DTXA 3MROA 4L29A 4PJ8A 4F7PA 4Z76A 1DDHA 3LN5A 3O9WA 3VH8A 1S7XA 2Q7YA 3PWUA 1K8DA 1XR9A 4NO0A 3REWA 4Z78A 1FFPA 1JPGA 5H94A 3X11A 4CVZA 5D5MA 1ONQA 4L4VA 1VADA 4NQEA 3BH9A 3FT3A 4O2FA 3FTGA 5DEGA 3UTQA 3VFWA 3VRIA 1UXSA 1INQA 1Z5LA 3FQUA 5IB3A 1MHEA 5EU4A 1TVHA 3VXNA 1HHIA 1KJ3H 4F7CA 4LHUA 3ILPA 3LN4A 4PRPA 1U58A 3BO8A 4PJIA 3RL2A 3V5HA 3SCMA 3L3IA 2BVOA 3TBVA 3B6SA 2D31A 1P4LA 3P9MA 5C0AA 4G43A 5EO1A 5MEPA 4U1MA 5ISZA 4IHOA 2A83A 4L3EA 5HGDA 4FTVA 1FFNA 4PR5A 1LD9A 1S7VA 1ZSDA 1T0NA 1HSBA 3FRUA 3P4MA 3RWIA 3MRIA 1YN6A 1I7RA 1A6ZA 1KCGC 3BEWA 1EFXA 3O3EA 4QRSA 1PQZA 1IM3A 4IRSA 4L4TA 4PJAA 1ZHBA 5IEKA 2X70A 3I6LD 5DDHA 3RUGA 1OGAA 3HAEA 1I1YA 3FOMA 3S6CA 3L3HA 2X4NA 2XPGA 2XFXA 2HLAA 5E6IC 5J6HA 5EUOA 1HYRC 3GMNA 4PP8C 5BRZA 1LDPH 5L2KA 3SKOA 3MGOA 5BS0A 5ENWA 3KPLA 1B3JA 4PJHA 3KPSA 1AKJA 2F74A 2BNRA 4ELMA 1M05A 1R3HA 1RJZA 5BJTA 1I1FA 2ZOKA 4HUXA 3BUYA 3LKQA 1AGCA 3KPRA 3PWJA 1HHJA 3MRFA 4G42A 2F54A 5L2JA 5HHPA 4Y4FA 1T7ZA 4Y2DA 3HG1A 2PYEA 3GMPA 4JQXA 1S8DA 2HJKA 1I7UA 3BP4A 4WUUA 5C0GA 1IM9A 3QQ3A 5D2NA 4U1SA 5GSRA 5IB4A 2CIKA 4MXQA 4N0UA 2GTWA 3L3JA 5INCA 4PG2A 3BWAA 3CPLA 3OX8A 4ZUVA 4PV8A 4ZFZA 3D2UA 2WY3A 2MHAA 1NANH 1T21A 5C0BA 4L8DA 1ZHNA 5MERA 3O3AA 3DMMA 4FFEX 3KPQA 4K7FA 3PWNA 3ROLA 3VXMA 4GKNA 4D0DA 1BZ9A 5BXFA 1N59A 2YPKA 1I7TA 4F7EA 4QRTA 4UQ3A 1ZS8A 3L3GA 3CH1A 1AGEA 3L3DA 3TJHA 3MGTA 4QOKA 3G08A 4PJDA 3ILQC 4MQ7A 1ZHKA 2HJLA 3KLAA 5EOTA 4Y16A 2FO4A 4NQXA 3BHBA 4PJEA 5HGHA 4D0CA 3BW9A 3NFNA 3QDJA 3RWHA 3H9SA 3MRKA 4ZUTA 1MHCA 5D2LA 3RL1A 3BZEA 1S9YA 4GKSA 3KPPA 3CZFA 1HHHA 3WLBA 1MI5A 4MNQA 4PJGA 5MEOA 3DBXA 1KBGH 3FFCA 1W72A 1ZAGA 3KXFA 3PWLA 4JFQA 2ZOLA 4MJ5A 2ZSVA 5FKPA 3TVMA 3X14A 2YPLA 4U6YA 1JUFA 3VFUA 3GSRA 2UWEA 3MV7A 2V2WA 3DX8A 3VXUA 1JF1A 2BVQA 5C0EA 3MRHA 3SDCA 4CW1A 3DXAA 2E7LE 2ESVA 3QFDA 3RTQA 3LKNA 1T1YA 3QFJA 3RWEA 1DE4A 2GITA 1JHTA 3CDGA 4PRAA 3VFVA 3TBSA 3PWVA 4IRJA 3B3IA 1T0MA 1XH3A 4PJ7A 4E5XA 1A9EA 2BSRA 1JPFA 4N0CA 4NQCA 3BEVA 5C08A 5FDWA 3TF7A 2H26A 3GIVA 4JFOA 2F53A 3ECBA 4N0FA 5IB1A 1NEZA 3MR9A 1GZPA 4APQA 4JFEA 2CLZA 3E2HA 3SDAA 5JHDA 3VFPA 3P77A 3O3DA 5DEFA 5IVXA 4X6DA 5EFIA 3HLAA 5EU6A 2FYYA 3SPVA 1W0WA 1UQSA 1KJMA 1JE6A 1G7QA 1LK2A 5F1IA 3QUZA 4U1IA 1YN7A 3KWWA 3TBTA 1OSZA 3GSVA 3BH8A 2X4SA 4JQVA 5SWZA 5C0DA 3M1BA 4I48A 3VXPA 5GSVA 3QI9A 4L3CA 3O8XA 4MJIA 1L8JA 1DUZA 1EEYA 1QEWA 3MA7A 4GUPA 5IEHA 3P9LA 4HUUA 3WL9A 3CVHA 3V5KA 2AXFA 3W39A 3E3QA 1G6RH 4HUWA 1FZJA 2X4RA 4EUPA 1JFMA 1T1XA 5C07A 3LV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N5A A;  4HWZ A;  4IIQ C;  4JFP A;  1KTL A;  2X4O A;  2CII A;  5HGA A;  3MRG A;  4U6X A;  2HN7 A;  4WU7 A;  5B39 A;  3UPR A;  1DUY A;  5E00 A;  3X12 A;  5HHN A;  4HX1 A;  4LCW A;  5F7D A;  5E8O A;  3UBX A;  4WU5 A;  3MRQ A;  3ERY A;  3HPJ A;  3L3K A;  1UXW A;  1ZT4 A;  4NO3 A;  3KPN A;  4NQD A;  3BP7 A;  3MV8 A;  3RGV C;  4E0R A;  5EU5 A;  2VLL A;  5AD0 A;  4ZUU A;  3VXO A;  3HE7 A;  5F9J A;  5D7J C;  2X4Q A;  3C9N A;  3ES6 A;  2AK4 A;  3MRL A;  3BXN A;  4PRH A;  3AU1 A;  3O4L A;  3TN0 A;  4ZAK A;  1T20 A;  2P5E A;  4UQ2 A;  5EU3 A;  1AO7 A;  5J1A A;  1JGD A;  1LQV A;  4G8G A;  1ED3 A;  1KPV A;  1T7X A;  4PRB A;  3RWD A;  5MEN A;  2V2X A;  5SWS A;  4QRR A;  1T22 A;  4HKJ A;  3VWK A;  3PQY A;  4V3E B;  4PGE A;  5C0I A;  2GAZ A;  3I6G A;  2NX5 A;  4G8I A;  1OGT A;  3SKM A;  5IND A;  3SDD A;  1FZO A;  1S7R A;  4F7T A;  4PV9 A;  1AGF A;  1SYV A;  3GSN H;  2PO6 A;  2BCK A;  3GMR A;  3MRC A;  1I4F A;  1T1W A;  1S9W A;  2GJ6 A;  4NO5 A;  2NW3 A;  4D0B A;  1T7Y A;  3H7B A;  4G59 A;  1LEK A;  3H9H A;  3T8X A;  3VCL A;  3GJF A;  3TIE A;  1E27 A;  1ZHL A;  4L8S C;  3GSX A;  4PRD A;  4U1K A;  3GML A;  4U1L A;  1XR8 A;  3MYJ A;  3QZW A;  1FFO A;  3I6K A;  4WJ5 A;  1BII A;  1P7Q A;  3E6H A;  3ARB A;  1WBX A;  1P1Z A;  3TO2 A;  2X4T A;  3D18 A;  3FON A;  3QUX A;  4NSK A;  2CKB H;  2GT9 A;  2X4U A;  3T1F A;  4QRQ A;  4O2E A;  5E8P A;  3IT8 D;  4XXC A;  4LCC C;  4JFD A;  4Z77 A;  3GMQ A;  4X6E A;  4PRE A;  1TVB A;  3QUK A;  4NNY A;  1KJV A;  3TFK A;  3OXS A;  2OI9 A;  3FT4 A;  1CE6 A;  1QSE A;  4U1J A;  2CLV A;  3OV6 A;  3FQW A;  5EO0 A;  1X7Q A;  3X13 A;  2GUO A;  1BD2 A;  3MRP A;  1T1Z A;  4G9D A;  1TMC A;  1T7W A;  1EEZ A;  1ZT1 A;  5IRO A;  3HCV A;  4PDC E;  4V3D B;  1FG2 A;  5E9D A;  1B0G A;  3FOL A;  1KJ2 H;  2AV7 A;  1VAC A;  2YEZ A;  2BST A;  3LKP A;  5C0C A;  2C7U A;  1C16 A;  3LKS A;  3QUY A;  3MV9 A;  2H6P A;  3ROO A;  4MNG A;  3FQX A;  3SJV A;  3WUW A;  3ARE A;  1KPR A;  3GSU A;  4L9L C;  2OL3 H;  3VXS A;  3MRD A;  3MRM A;  4Y4H A;  3MRE A;  4PJ9 A;  1B0R A;  1LEG A;  3FQT A;  2CLR A;  3TZV C;  1M6O A;  5HYJ A;  1A9B A;  1HHK A;  1QQD A;  4QRP A;  4WW2 C;  4L8C A;  3VWJ A;  2RFX A;  1E28 A;  4ZUS A;  1FO0 H;  4EI5 A;  4MVB A;  3SDX A;  5SWQ A;  5ACZ A;  5C0J A;  3VFO A;  4PJF A;  3M17 A;  3PAB A;  1S9X A;  3WS3 A;  4K71 B;  5HHM A;  2AXG A;  3V5D A;  2VLK A;  1Q94 A;  5C09 A;  2VLJ A;  1JGE A;  3GSO A;  3VJ6 A;  1HOC A;  4HV8 A;  1FZM A;  3L9R A;  1YPZ A;  3FT2 A;  1QRN A;  1ZVS A;  5HHO A;  3VXR A;  4PJC A;  4PGC A;  5B38 A;  2FZ3 A;  3ARF A;  4PRI A;  1G7P A;  2AV1 A;  1GZQ A;  2VAA A;  1RJY A;  3RWG A;  2BVP A;  4S0U C;  1K5N A;  1A1N A;  2GTZ A;  2VE6 A;  1HHG A;  3P4O A;  1N2R A;  5IB2 A;  3CCH A;  5D7L A;  3ARD A;  3MRJ A;  1NAM H;  2JCC A;  3P4N A;  5E8N A;  4JRX A;  2VLR A;  4X6F A;  4I4W A;  4Y4K A;  3QDM A;  3UTT A;  1S7Q A;  4HUV A;  1RK0 A;  3JTT A;  3JVG A;  3GMO A;  4PGD A;  1BQH A;  4ZUW A;  3JTC A;  1S7S A;  4NT6 A;  2ZSW A;  3RZC A;  2VAB A;  3WS6 A;  3FQR A;  1FZK A;  1AGD A;  3BZF A;  2DYP A;  1LP9 A;  3KPO A;  3MRN A;  1T80 A;  5IB5 A;  4F7M A;  1VGK A;  4L8B A;  3DX7 A;  1EXU A;  5C9J A;  1WBY A;  3KYO A;  4O2C A;  4EN3 C;  3IXA A;  4WDI A;  3D39 A;  3VFN A;  1QR1 A;  5D7I A;  3TPU E;  4PRN A;  5IM7 A;  1S7T A;  4U1N A;  3U0P A;  3ARG A;  3OXR A;  1QLF A;  3LKR A;  3KPM A;  3VFT A;  4CVX A;  4MJ6 A;  4NQV A;  4NHU E;  1S7U A;  3VFS A;  4PJB A;  5HGB A;  4NNX A;  3GSQ A;  5D9S A;  4PJ5 A;  1A1O A;  3GSW A;  4JFF A;  3E6F A;  3VRJ A;  3RWC A;  4WWK C;  2BSS A;  3QDG A;  3QEQ A;  2P5W A;  3P73 A;  1AGB A;  4MX7 A;  4N8V A;  2FIK A;  1HSA A;  1QVO A;  2BNQ A;  1YDP A;  2J8U A;  1CD1 A;  4LNR A;  1CG9 A;  1N3N A;  2FWO A;  3MRB A;  5J6G A;  3O3B A;  3CC5 A;  3GMM A;  3LKO A;  3VFM A;  5MEQ A;  4WO4 A;  3AM8 A;  4PG9 A;  1KPU A;  4HS3 A;  4JRY A;  1QSF A;  2X4P A;  3QUL A;  1QO3 A;  1SYS A;  3TO4 A;  1I1A A;  5C0F A;  5FA3 A;  4PGB A;  3VFR A;  5HHQ A;  3TA3 A;  3JTS A;  4ONO A;  1T7V A;  1ZT7 A;  4PJX A;  4NO2 A;  4X6C A;  4QRU A;  1A1M A;  3PWP A;  3RWJ A;  1OF2 A;  3TID A;  3FQN A;  4U1H A;  2AKR A;  3D25 A;  4LCY A;  3KYN A;  3BVN A;  1RK1 A;  3HUJ A;  4G9F A;  1XZ0 A;  4MS8 A;  3D3V A;  1S7W A;  1W0V A;  4N5E A;  3TBY A;  3UTS A;  3BGM A;  1WBZ A;  3TBW A;  5FA4 A;  3RWF A;  3QQ4 A;  1MWA H;  5F1N A;  3W0W A;  3HE6 A;  3DX6 A;  3C8K A;  3MRR A;  3DTX A;  3MRO A;  4L29 A;  4PJ8 A;  4F7P A;  4Z76 A;  1DDH A;  3LN5 A;  3O9W A;  3VH8 A;  1S7X A;  2Q7Y A;  3PWU A;  1K8D A;  1XR9 A;  4NO0 A;  3REW A;  4Z78 A;  1FFP A;  1JPG A;  5H94 A;  3X11 A;  4CVZ A;  5D5M A;  1ONQ A;  4L4V A;  1VAD A;  4NQE A;  3BH9 A;  3FT3 A;  4O2F A;  3FTG A;  5DEG A;  3UTQ A;  3VFW A;  3VRI A;  1UXS A;  1INQ A;  1Z5L A;  3FQU A;  5IB3 A;  1MHE A;  5EU4 A;  1TVH A;  3VXN A;  1HHI A;  1KJ3 H;  4F7C A;  4LHU A;  3ILP A;  3LN4 A;  4PRP A;  1U58 A;  3BO8 A;  4PJI A;  3RL2 A;  3V5H A;  3SCM A;  3L3I A;  2BVO A;  3TBV A;  3B6S A;  2D31 A;  1P4L A;  3P9M A;  5C0A A;  4G43 A;  5EO1 A;  5MEP A;  4U1M A;  5ISZ A;  4IHO A;  2A83 A;  4L3E A;  5HGD A;  4FTV A;  1FFN A;  4PR5 A;  1LD9 A;  1S7V A;  1ZSD A;  1T0N A;  1HSB A;  3FRU A;  3P4M A;  3RWI A;  3MRI A;  1YN6 A;  1I7R A;  1A6Z A;  1KCG C;  3BEW A;  1EFX A;  3O3E A;  4QRS A;  1PQZ A;  1IM3 A;  4IRS A;  4L4T A;  4PJA A;  1ZHB A;  5IEK A;  2X70 A;  3I6L D;  5DDH A;  3RUG A;  1OGA A;  3HAE A;  1I1Y A;  3FOM A;  3S6C A;  3L3H A;  2X4N A;  2XPG A;  2XFX A;  2HLA A;  5E6I C;  5J6H A;  5EUO A;  1HYR C;  3GMN A;  4PP8 C;  5BRZ A;  1LDP H;  5L2K A;  3SKO A;  3MGO A;  5BS0 A;  5ENW A;  3KPL A;  1B3J A;  4PJH A;  3KPS A;  1AKJ A;  2F74 A;  2BNR A;  4ELM A;  1M05 A;  1R3H A;  1RJZ A;  5BJT A;  1I1F A;  2ZOK A;  4HUX A;  3BUY A;  3LKQ A;  1AGC A;  3KPR A;  3PWJ A;  1HHJ A;  3MRF A;  4G42 A;  2F54 A;  5L2J A;  5HHP A;  4Y4F A;  1T7Z A;  4Y2D A;  3HG1 A;  2PYE A;  3GMP A;  4JQX A;  1S8D A;  2HJK A;  1I7U A;  3BP4 A;  4WUU A;  5C0G A;  1IM9 A;  3QQ3 A;  5D2N A;  4U1S A;  5GSR A;  5IB4 A;  2CIK A;  4MXQ A;  4N0U A;  2GTW A;  3L3J A;  5INC A;  4PG2 A;  3BWA A;  3CPL A;  3OX8 A;  4ZUV A;  4PV8 A;  4ZFZ A;  3D2U A;  2WY3 A;  2MHA A;  1NAN H;  1T21 A;  5C0B A;  4L8D A;  1ZHN A;  5MER A;  3O3A A;  3DMM A;  4FFE X;  3KPQ A;  4K7F A;  3PWN A;  3ROL A;  3VXM A;  4GKN A;  4D0D A;  1BZ9 A;  5BXF A;  1N59 A;  2YPK A;  1I7T A;  4F7E A;  4QRT A;  4UQ3 A;  1ZS8 A;  3L3G A;  3CH1 A;  1AGE A;  3L3D A;  3TJH A;  3MGT A;  4QOK A;  3G08 A;  4PJD A;  3ILQ C;  4MQ7 A;  1ZHK A;  2HJL A;  3KLA A;  5EOT A;  4Y16 A;  2FO4 A;  4NQX A;  3BHB A;  4PJE A;  5HGH A;  4D0C A;  3BW9 A;  3NFN A;  3QDJ A;  3RWH A;  3H9S A;  3MRK A;  4ZUT A;  1MHC A;  5D2L A;  3RL1 A;  3BZE A;  1S9Y A;  4GKS A;  3KPP A;  3CZF A;  1HHH A;  3WLB A;  1MI5 A;  4MNQ A;  4PJG A;  5MEO A;  3DBX A;  1KBG H;  3FFC A;  1W72 A;  1ZAG A;  3KXF A;  3PWL A;  4JFQ A;  2ZOL A;  4MJ5 A;  2ZSV A;  5FKP A;  3TVM A;  3X14 A;  2YPL A;  4U6Y A;  1JUF A;  3VFU A;  3GSR A;  2UWE A;  3MV7 A;  2V2W A;  3DX8 A;  3VXU A;  1JF1 A;  2BVQ A;  5C0E A;  3MRH A;  3SDC A;  4CW1 A;  3DXA A;  2E7L E;  2ESV A;  3QFD A;  3RTQ A;  3LKN A;  1T1Y A;  3QFJ A;  3RWE A;  1DE4 A;  2GIT A;  1JHT A;  3CDG A;  4PRA A;  3VFV A;  3TBS A;  3PWV A;  4IRJ A;  3B3I A;  1T0M A;  1XH3 A;  4PJ7 A;  4E5X A;  1A9E A;  2BSR A;  1JPF A;  4N0C A;  4NQC A;  3BEV A;  5C08 A;  5FDW A;  3TF7 A;  2H26 A;  3GIV A;  4JFO A;  2F53 A;  3ECB A;  4N0F A;  5IB1 A;  1NEZ A;  3MR9 A;  1GZP A;  4APQ A;  4JFE A;  2CLZ A;  3E2H A;  3SDA A;  5JHD A;  3VFP A;  3P77 A;  3O3D A;  5DEF A;  5IVX A;  4X6D A;  5EFI A;  3HLA A;  5EU6 A;  2FYY A;  3SPV A;  1W0W A;  1UQS A;  1KJM A;  1JE6 A;  1G7Q A;  1LK2 A;  5F1I A;  3QUZ A;  4U1I A;  1YN7 A;  3KWW A;  3TBT A;  1OSZ A;  3GSV A;  3BH8 A;  2X4S A;  4JQV A;  5SWZ A;  5C0D A;  3M1B A;  4I48 A;  3VXP A;  5GSV A;  3QI9 A;  4L3C A;  3O8X A;  4MJI A;  1L8J A;  1DUZ A;  1EEY A;  1QEW A;  3MA7 A;  4GUP A;  5IEH A;  3P9L A;  4HUU A;  3WL9 A;  3CVH A;  3V5K A;  2AXF A;  3W39 A;  3E3Q A;  1G6R H;  4HUW A;  1FZJ A;  2X4R A;  4EUP A;  1JFM A;  1T1X A;  5C07 A;  3LV3 A; 
#chains in the Genus database with same CATH topology
 1N5A A;  4HWZ A;  4IIQ C;  4JFP A;  1KTL A;  2X4O A;  2CII A;  5HGA A;  3MRG A;  4U6X A;  2HN7 A;  4WU7 A;  5B39 A;  3UPR A;  1DUY A;  5E00 A;  3X12 A;  5HHN A;  4HX1 A;  4LCW A;  5F7D A;  5E8O A;  3UBX A;  4WU5 A;  3MRQ A;  3ERY A;  3HPJ A;  3L3K A;  1UXW A;  1ZT4 A;  4NO3 A;  3KPN A;  4NQD A;  3BP7 A;  3MV8 A;  3RGV C;  4G59 C;  5EU5 A;  4E0R A;  2VLL A;  5AD0 A;  4ZUU A;  3VXO A;  3HE7 A;  5F9J A;  5D7J C;  2X4Q A;  3C9N A;  3ES6 A;  2AK4 A;  3MRL A;  3BXN A;  4PRH A;  3AU1 A;  3O4L A;  3TN0 A;  4ZAK A;  1T20 A;  2P5E A;  4UQ2 A;  5EU3 A;  1AO7 A;  4JO8 A;  5J1A A;  1JGD A;  1LQV A;  4G8G A;  1ED3 A;  1KPV A;  1T7X A;  4PRB A;  3RWD A;  5MEN A;  2V2X A;  5SWS A;  4QRR A;  1T22 A;  4HKJ A;  3VWK A;  3PQY A;  4V3E B;  4PGE A;  5C0I A;  2GAZ A;  3I6G A;  2NX5 A;  4G8I A;  1OGT A;  3SKM A;  5IND A;  3SDD A;  1FZO A;  1S7R A;  4F7T A;  4PV9 A;  1AGF A;  1SYV A;  3GSN H;  2PO6 A;  2BCK A;  3GMR A;  3MRC A;  1I4F A;  1T1W A;  1S9W A;  2GJ6 A;  4NO5 A;  2NW3 A;  4D0B A;  1T7Y A;  3H7B A;  4G59 A;  1LEK A;  3H9H A;  3T8X A;  3VCL A;  3GJF A;  3TIE A;  1E27 A;  1ZHL A;  4L8S C;  3GSX A;  4PRD A;  4U1K A;  3GML A;  4U1L A;  1XR8 A;  3MYJ A;  3QZW A;  1FFO A;  3I6K A;  4WJ5 A;  1BII A;  1P7Q A;  3E6H A;  3ARB A;  1WBX A;  1P1Z A;  3TO2 A;  2X4T A;  3D18 A;  3FON A;  3QUX A;  4NSK A;  2CKB H;  2GT9 A;  2X4U A;  3T1F A;  4QRQ A;  4O2E A;  5E8P A;  3IT8 D;  4XXC A;  4LCC C;  4JFD A;  4Z77 A;  3GMQ A;  4X6E A;  4PRE A;  1TVB A;  3QUK A;  4NNY A;  1KJV A;  3TFK A;  3OXS A;  2O5N A;  2OI9 A;  3FT4 A;  1CE6 A;  1QSE A;  4U1J A;  2CLV A;  3OV6 A;  3FQW A;  5EO0 A;  1X7Q A;  3X13 A;  2GUO A;  1BD2 A;  3MRP A;  1T1Z A;  4G9D A;  1TMC A;  1T7W A;  1EEZ A;  1ZT1 A;  5IRO A;  3HCV A;  4PDC E;  4V3D B;  1FG2 A;  5E9D A;  1B0G A;  3FOL A;  1KJ2 H;  2AV7 A;  1VAC A;  2YEZ A;  3I0T A;  2BST A;  3LKP A;  5C0C A;  2C7U A;  1C16 A;  3LKS A;  3QUY A;  3MV9 A;  2H6P A;  3ROO A;  4MNG A;  3FQX A;  3SJV A;  3WUW A;  3ARE A;  1KPR A;  3GSU A;  4L9L C;  2OL3 H;  3VXS A;  3MRD A;  3MRM A;  4Y4H A;  3MRE A;  4PJ9 A;  1B0R A;  1LEG A;  3FQT A;  2CLR A;  3TZV C;  1M6O A;  5HYJ A;  1A9B A;  1HHK A;  1QQD A;  4QRP A;  4WW2 C;  4L8C A;  3VWJ A;  2RFX A;  1E28 A;  4ZUS A;  1FO0 H;  4EI5 A;  4MVB A;  3SDX A;  5SWQ A;  5ACZ A;  5C0J A;  3VFO A;  4PJF A;  3M17 A;  3PAB A;  1S9X A;  3WS3 A;  4K71 B;  5HHM A;  2AXG A;  3V5D A;  2VLK A;  1Q94 A;  5C09 A;  2VLJ A;  1JGE A;  3GSO A;  3VJ6 A;  1HOC A;  4HV8 A;  1FZM A;  3L9R A;  1YPZ A;  3FT2 A;  1QRN A;  1ZVS A;  5HHO A;  3VXR A;  4PJC A;  4PGC A;  5B38 A;  2FZ3 A;  3ARF A;  4PRI A;  1G7P A;  2AV1 A;  1GZQ A;  2VAA A;  1RJY A;  3RWG A;  2BVP A;  4S0U C;  1K5N A;  1A1N A;  2GTZ A;  2VE6 A;  1HHG A;  3P4O A;  1N2R A;  5IB2 A;  3CCH A;  5D7L A;  3ARD A;  3MRJ A;  1NAM H;  2IA1 A;  2JCC A;  3P4N A;  5E8N A;  4JRX A;  2VLR A;  4X6F A;  4I4W A;  4Y4K A;  3QDM A;  3UTT A;  1S7Q A;  4HUV A;  1RK0 A;  3JTT A;  3JVG A;  3GMO A;  4PGD A;  1BQH A;  4ZUW A;  3JTC A;  1S7S A;  4NT6 A;  2ZSW A;  3RZC A;  2VAB A;  3WS6 A;  3FQR A;  1FZK A;  1AGD A;  3BZF A;  2DYP A;  1LP9 A;  3KPO A;  3MRN A;  1T80 A;  5IB5 A;  4F7M A;  1VGK A;  4L8B A;  3DX7 A;  1EXU A;  5C9J A;  1WBY A;  3KYO A;  4O2C A;  4EN3 C;  3IXA A;  4WDI A;  3D39 A;  3VFN A;  1QR1 A;  5D7I A;  3TPU E;  4PRN A;  5IM7 A;  1S7T A;  4U1N A;  3U0P A;  3ARG A;  3OXR A;  1QLF A;  3LKR A;  3KPM A;  3VFT A;  4CVX A;  4MJ6 A;  4NQV A;  4NHU E;  1S7U A;  3VFS A;  4PJB A;  5HGB A;  4NNX A;  3GSQ A;  5D9S A;  4PJ5 A;  1A1O A;  3GSW A;  4JFF A;  3E6F A;  3VRJ A;  3RWC A;  4WWK C;  2BSS A;  3QDG A;  3QEQ A;  2P5W A;  3P73 A;  1AGB A;  4MX7 A;  4N8V A;  2FIK A;  1HSA A;  1QVO A;  2BNQ A;  1YDP A;  2J8U A;  1CD1 A;  4LNR A;  1CG9 A;  1N3N A;  2FWO A;  3MRB A;  5J6G A;  3O3B A;  3CC5 A;  3GMM A;  3LKO A;  3VFM A;  5MEQ A;  4WO4 A;  3AM8 A;  4PG9 A;  1KPU A;  4HS3 A;  4JRY A;  1QSF A;  2X4P A;  3QUL A;  1QO3 A;  1SYS A;  3TO4 A;  1I1A A;  5C0F A;  5FA3 A;  4PGB A;  3VFR A;  5HHQ A;  3TA3 A;  3JTS A;  4ONO A;  1T7V A;  1ZT7 A;  4PJX A;  4NO2 A;  4X6C A;  4QRU A;  1A1M A;  3PWP A;  3RWJ A;  1OF2 A;  3TID A;  3FQN A;  4U1H A;  2AKR A;  3D25 A;  4LCY A;  3KYN A;  3BVN A;  1RK1 A;  3HUJ A;  4G9F A;  1XZ0 A;  4MS8 A;  3D3V A;  1S7W A;  1W0V A;  4N5E A;  3TBY A;  3UTS A;  3BGM A;  1WBZ A;  3TBW A;  5FA4 A;  3RWF A;  3QQ4 A;  1MWA H;  5F1N A;  3W0W A;  3HE6 A;  3DX6 A;  3C8K A;  3MRR A;  3DTX A;  3MRO A;  4L29 A;  4PJ8 A;  4F7P A;  4Z76 A;  1DDH A;  3LN5 A;  3O9W A;  3VH8 A;  1S7X A;  2Q7Y A;  3PWU A;  1K8D A;  1XR9 A;  4NO0 A;  3REW A;  4Z78 A;  1FFP A;  1JPG A;  5H94 A;  3X11 A;  4CVZ A;  5D5M A;  1ONQ A;  4L4V A;  1VAD A;  4NQE A;  3BH9 A;  3FT3 A;  4O2F A;  3FTG A;  5DEG A;  3UTQ A;  3VFW A;  3VRI A;  1UXS A;  1INQ A;  1Z5L A;  3FQU A;  5IB3 A;  1MHE A;  5EU4 A;  1TVH A;  3VXN A;  1HHI A;  1KJ3 H;  4F7C A;  4LHU A;  3ILP A;  3LN4 A;  4PRP A;  1U58 A;  3BO8 A;  4PJI A;  3RL2 A;  3V5H A;  3SCM A;  3L3I A;  2BVO A;  3TBV A;  3B6S A;  2D31 A;  1P4L A;  3P9M A;  5C0A A;  4G43 A;  5EO1 A;  5MEP A;  4U1M A;  5ISZ A;  4IHO A;  2A83 A;  4L3E A;  5HGD A;  4BKW A;  4FTV A;  1FFN A;  4PR5 A;  1LD9 A;  1S7V A;  1ZSD A;  1T0N A;  1HSB A;  3FRU A;  3P4M A;  3RWI A;  3MRI A;  1YN6 A;  1I7R A;  1A6Z A;  1KCG C;  3BEW A;  1EFX A;  3O3E A;  4QRS A;  1PQZ A;  1IM3 A;  4IRS A;  4L4T A;  4PJA A;  1ZHB A;  5IEK A;  2X70 A;  3I6L D;  5DDH A;  3RUG A;  1OGA A;  3HAE A;  1I1Y A;  3FOM A;  3S6C A;  3L3H A;  2X4N A;  2XPG A;  2XFX A;  2HLA A;  5E6I C;  5J6H A;  5EUO A;  1HYR C;  3GMN A;  4PP8 C;  5BRZ A;  1LDP H;  5L2K A;  3SKO A;  3MGO A;  5BS0 A;  5ENW A;  3KPL A;  1B3J A;  4PJH A;  3KPS A;  1AKJ A;  2F74 A;  2BNR A;  4ELM A;  1M05 A;  1R3H A;  1RJZ A;  5BJT A;  1I1F A;  2ZOK A;  4HUX A;  3BUY A;  3LKQ A;  1AGC A;  3KPR A;  3PWJ A;  1HHJ A;  3MRF A;  4G42 A;  2F54 A;  5L2J A;  5HHP A;  4Y4F A;  1T7Z A;  4Y2D A;  3HG1 A;  2PYE A;  3GMP A;  4JQX A;  1S8D A;  2HJK A;  1I7U A;  3BP4 A;  4WUU A;  5C0G A;  1IM9 A;  3QQ3 A;  5D2N A;  4U1S A;  5GSR A;  5IB4 A;  2CIK A;  4MXQ A;  4N0U A;  2GTW A;  3L3J A;  5INC A;  4PG2 A;  3BWA A;  3CPL A;  3OX8 A;  4ZUV A;  4PV8 A;  4ZFZ A;  3D2U A;  2WY3 A;  2MHA A;  1NAN H;  1T21 A;  5C0B A;  4L8D A;  1ZHN A;  5MER A;  3O3A A;  3DMM A;  4FFE X;  3KPQ A;  4K7F A;  3PWN A;  3ROL A;  3VXM A;  4GKN A;  4D0D A;  1BZ9 A;  5BXF A;  1N59 A;  2YPK A;  1I7T A;  4F7E A;  4QRT A;  4UQ3 A;  1ZS8 A;  3L3G A;  3CH1 A;  1AGE A;  3L3D A;  3TJH A;  3MGT A;  4QOK A;  3G08 A;  4PJD A;  3ILQ C;  4MQ7 A;  1ZHK A;  2HJL A;  3KLA A;  5EOT A;  4Y16 A;  2FO4 A;  4NQX A;  3BHB A;  4PJE A;  5HGH A;  4D0C A;  3BW9 A;  3NFN A;  3QDJ A;  3RWH A;  3H9S A;  3MRK A;  4ZUT A;  1MHC A;  5D2L A;  3RL1 A;  3BZE A;  1S9Y A;  4GKS A;  3KPP A;  3CZF A;  1HHH A;  3WLB A;  1MI5 A;  4MNQ A;  4PJG A;  5MEO A;  3DBX A;  1KBG H;  3FFC A;  1W72 A;  1ZAG A;  3KXF A;  3PWL A;  4JFQ A;  2ZOL A;  4MJ5 A;  2ZSV A;  5FKP A;  3TVM A;  3X14 A;  2YPL A;  4U6Y A;  1JUF A;  3VFU A;  3GSR A;  2UWE A;  3MV7 A;  2V2W A;  2NYK A;  3DX8 A;  3VXU A;  1JF1 A;  2BVQ A;  5C0E A;  3MRH A;  3SDC A;  4CW1 A;  3DXA A;  2E7L E;  2ESV A;  3QFD A;  3RTQ A;  3LKN A;  1T1Y A;  3QFJ A;  3RWE A;  1DE4 A;  2GIT A;  1JHT A;  3CDG A;  4PRA A;  3VFV A;  3TBS A;  3PWV A;  4IRJ A;  3B3I A;  1T0M A;  1XH3 A;  4PJ7 A;  4E5X A;  1A9E A;  2BSR A;  1JPF A;  4N0C A;  4NQC A;  3BEV A;  5C08 A;  5FDW A;  3TF7 A;  2H26 A;  3GIV A;  4JFO A;  2F53 A;  3ECB A;  4N0F A;  5IB1 A;  1NEZ A;  3MR9 A;  1GZP A;  4APQ A;  4JFE A;  2CLZ A;  3E2H A;  3SDA A;  5JHD A;  3VFP A;  3P77 A;  3O3D A;  5DEF A;  5IVX A;  4X6D A;  5EFI A;  3HLA A;  5EU6 A;  2FYY A;  3SPV A;  1W0W A;  1UQS A;  1KJM A;  1JE6 A;  1G7Q A;  1LK2 A;  5F1I A;  3QUZ A;  4U1I A;  1YN7 A;  3KWW A;  3TBT A;  1OSZ A;  3GSV A;  3BH8 A;  2X4S A;  4JQV A;  5SWZ A;  5C0D A;  3M1B A;  4I48 A;  3VXP A;  5GSV A;  3QI9 A;  4L3C A;  3O8X A;  4MJI A;  1L8J A;  1DUZ A;  1EEY A;  1QEW A;  3MA7 A;  4GUP A;  5IEH A;  3P9L A;  4HUU A;  3WL9 A;  3CVH A;  3V5K A;  2AXF A;  3W39 A;  3E3Q A;  1G6R H;  4HUW A;  1FZJ A;  2X4R A;  4EUP A;  1JFM A;  1T1X A;  5C07 A;  3LV3 A; 
#chains in the Genus database with same CATH homology
 1N5A A;  4HWZ A;  4IIQ C;  4JFP A;  1KTL A;  2X4O A;  2CII A;  5HGA A;  3MRG A;  4U6X A;  2HN7 A;  4WU7 A;  5B39 A;  3UPR A;  1DUY A;  5E00 A;  3X12 A;  5HHN A;  4HX1 A;  4LCW A;  5F7D A;  5E8O A;  3UBX A;  4WU5 A;  3MRQ A;  3ERY A;  3HPJ A;  3L3K A;  1UXW A;  1ZT4 A;  4NO3 A;  3KPN A;  4NQD A;  3BP7 A;  3MV8 A;  3RGV C;  4E0R A;  5EU5 A;  2VLL A;  5AD0 A;  4ZUU A;  3VXO A;  3HE7 A;  5F9J A;  5D7J C;  2X4Q A;  3C9N A;  3ES6 A;  2AK4 A;  3MRL A;  3BXN A;  4PRH A;  3AU1 A;  3O4L A;  3TN0 A;  4ZAK A;  1T20 A;  2P5E A;  4UQ2 A;  5EU3 A;  1AO7 A;  5J1A A;  1JGD A;  1LQV A;  4G8G A;  1ED3 A;  1KPV A;  1T7X A;  4PRB A;  3RWD A;  5MEN A;  2V2X A;  5SWS A;  4QRR A;  1T22 A;  4HKJ A;  3VWK A;  3PQY A;  4V3E B;  4PGE A;  5C0I A;  2GAZ A;  3I6G A;  2NX5 A;  4G8I A;  1OGT A;  3SKM A;  5IND A;  3SDD A;  1FZO A;  1S7R A;  4F7T A;  4PV9 A;  1AGF A;  1SYV A;  3GSN H;  2PO6 A;  2BCK A;  3GMR A;  3MRC A;  1I4F A;  1T1W A;  1S9W A;  2GJ6 A;  4NO5 A;  2NW3 A;  4D0B A;  1T7Y A;  3H7B A;  4G59 A;  1LEK A;  3H9H A;  3T8X A;  3VCL A;  3GJF A;  3TIE A;  1E27 A;  1ZHL A;  4L8S C;  3GSX A;  4PRD A;  4U1K A;  3GML A;  4U1L A;  1XR8 A;  3MYJ A;  3QZW A;  1FFO A;  3I6K A;  4WJ5 A;  1BII A;  1P7Q A;  3E6H A;  3ARB A;  1WBX A;  1P1Z A;  3TO2 A;  2X4T A;  3D18 A;  3FON A;  3QUX A;  4NSK A;  2CKB H;  2GT9 A;  2X4U A;  3T1F A;  4QRQ A;  4O2E A;  5E8P A;  3IT8 D;  4XXC A;  4LCC C;  4JFD A;  4Z77 A;  3GMQ A;  4X6E A;  4PRE A;  1TVB A;  3QUK A;  4NNY A;  1KJV A;  3TFK A;  3OXS A;  2OI9 A;  3FT4 A;  1CE6 A;  1QSE A;  4U1J A;  2CLV A;  3OV6 A;  3FQW A;  5EO0 A;  1X7Q A;  3X13 A;  2GUO A;  1BD2 A;  3MRP A;  1T1Z A;  4G9D A;  1TMC A;  1T7W A;  1EEZ A;  1ZT1 A;  5IRO A;  3HCV A;  4PDC E;  4V3D B;  1FG2 A;  5E9D A;  1B0G A;  3FOL A;  1KJ2 H;  2AV7 A;  1VAC A;  2YEZ A;  2BST A;  3LKP A;  5C0C A;  2C7U A;  1C16 A;  3LKS A;  3QUY A;  3MV9 A;  2H6P A;  3ROO A;  4MNG A;  3FQX A;  3SJV A;  3WUW A;  3ARE A;  1KPR A;  3GSU A;  4L9L C;  2OL3 H;  3VXS A;  3MRD A;  3MRM A;  4Y4H A;  3MRE A;  4PJ9 A;  1B0R A;  1LEG A;  3FQT A;  2CLR A;  3TZV C;  1M6O A;  5HYJ A;  1A9B A;  1HHK A;  1QQD A;  4QRP A;  4WW2 C;  4L8C A;  3VWJ A;  2RFX A;  1E28 A;  4ZUS A;  1FO0 H;  4EI5 A;  4MVB A;  3SDX A;  5SWQ A;  5ACZ A;  5C0J A;  3VFO A;  4PJF A;  3M17 A;  3PAB A;  1S9X A;  3WS3 A;  4K71 B;  5HHM A;  2AXG A;  3V5D A;  2VLK A;  1Q94 A;  5C09 A;  2VLJ A;  1JGE A;  3GSO A;  3VJ6 A;  1HOC A;  4HV8 A;  1FZM A;  3L9R A;  1YPZ A;  3FT2 A;  1QRN A;  1ZVS A;  5HHO A;  3VXR A;  4PJC A;  4PGC A;  5B38 A;  2FZ3 A;  3ARF A;  4PRI A;  1G7P A;  2AV1 A;  1GZQ A;  2VAA A;  1RJY A;  3RWG A;  2BVP A;  4S0U C;  1K5N A;  1A1N A;  2GTZ A;  2VE6 A;  1HHG A;  3P4O A;  1N2R A;  5IB2 A;  3CCH A;  5D7L A;  3ARD A;  3MRJ A;  1NAM H;  2JCC A;  3P4N A;  5E8N A;  4JRX A;  2VLR A;  4X6F A;  4I4W A;  4Y4K A;  3QDM A;  3UTT A;  1S7Q A;  4HUV A;  1RK0 A;  3JTT A;  3JVG A;  3GMO A;  4PGD A;  1BQH A;  4ZUW A;  3JTC A;  1S7S A;  4NT6 A;  2ZSW A;  3RZC A;  2VAB A;  3WS6 A;  3FQR A;  1FZK A;  1AGD A;  3BZF A;  2DYP A;  1LP9 A;  3KPO A;  3MRN A;  1T80 A;  5IB5 A;  4F7M A;  1VGK A;  4L8B A;  3DX7 A;  1EXU A;  5C9J A;  1WBY A;  3KYO A;  4O2C A;  4EN3 C;  3IXA A;  4WDI A;  3D39 A;  3VFN A;  1QR1 A;  5D7I A;  3TPU E;  4PRN A;  5IM7 A;  1S7T A;  4U1N A;  3U0P A;  3ARG A;  3OXR A;  1QLF A;  3LKR A;  3KPM A;  3VFT A;  4CVX A;  4MJ6 A;  4NQV A;  4NHU E;  1S7U A;  3VFS A;  4PJB A;  5HGB A;  4NNX A;  3GSQ A;  5D9S A;  4PJ5 A;  1A1O A;  3GSW A;  4JFF A;  3E6F A;  3VRJ A;  3RWC A;  4WWK C;  2BSS A;  3QDG A;  3QEQ A;  2P5W A;  3P73 A;  1AGB A;  4MX7 A;  4N8V A;  2FIK A;  1HSA A;  1QVO A;  2BNQ A;  1YDP A;  2J8U A;  1CD1 A;  4LNR A;  1CG9 A;  1N3N A;  2FWO A;  3MRB A;  5J6G A;  3O3B A;  3CC5 A;  3GMM A;  3LKO A;  3VFM A;  5MEQ A;  4WO4 A;  3AM8 A;  4PG9 A;  1KPU A;  4HS3 A;  4JRY A;  1QSF A;  2X4P A;  3QUL A;  1QO3 A;  1SYS A;  3TO4 A;  1I1A A;  5C0F A;  5FA3 A;  4PGB A;  3VFR A;  5HHQ A;  3TA3 A;  3JTS A;  4ONO A;  1T7V A;  1ZT7 A;  4PJX A;  4NO2 A;  4X6C A;  4QRU A;  1A1M A;  3PWP A;  3RWJ A;  1OF2 A;  3TID A;  3FQN A;  4U1H A;  2AKR A;  3D25 A;  4LCY A;  3KYN A;  3BVN A;  1RK1 A;  3HUJ A;  4G9F A;  1XZ0 A;  4MS8 A;  3D3V A;  1S7W A;  1W0V A;  4N5E A;  3TBY A;  3UTS A;  3BGM A;  1WBZ A;  3TBW A;  5FA4 A;  3RWF A;  3QQ4 A;  1MWA H;  5F1N A;  3W0W A;  3HE6 A;  3DX6 A;  3C8K A;  3MRR A;  3DTX A;  3MRO A;  4L29 A;  4PJ8 A;  4F7P A;  4Z76 A;  1DDH A;  3LN5 A;  3O9W A;  3VH8 A;  1S7X A;  2Q7Y A;  3PWU A;  1K8D A;  1XR9 A;  4NO0 A;  3REW A;  4Z78 A;  1FFP A;  1JPG A;  5H94 A;  3X11 A;  4CVZ A;  5D5M A;  1ONQ A;  4L4V A;  1VAD A;  4NQE A;  3BH9 A;  3FT3 A;  4O2F A;  3FTG A;  5DEG A;  3UTQ A;  3VFW A;  3VRI A;  1UXS A;  1INQ A;  1Z5L A;  3FQU A;  5IB3 A;  1MHE A;  5EU4 A;  1TVH A;  3VXN A;  1HHI A;  1KJ3 H;  4F7C A;  4LHU A;  3ILP A;  3LN4 A;  4PRP A;  1U58 A;  3BO8 A;  4PJI A;  3RL2 A;  3V5H A;  3SCM A;  3L3I A;  2BVO A;  3TBV A;  3B6S A;  2D31 A;  1P4L A;  3P9M A;  5C0A A;  4G43 A;  5EO1 A;  5MEP A;  4U1M A;  5ISZ A;  4IHO A;  2A83 A;  4L3E A;  5HGD A;  4FTV A;  1FFN A;  4PR5 A;  1LD9 A;  1S7V A;  1ZSD A;  1T0N A;  1HSB A;  3FRU A;  3P4M A;  3RWI A;  3MRI A;  1YN6 A;  1I7R A;  1A6Z A;  1KCG C;  3BEW A;  1EFX A;  3O3E A;  4QRS A;  1PQZ A;  1IM3 A;  4IRS A;  4L4T A;  4PJA A;  1ZHB A;  5IEK A;  2X70 A;  3I6L D;  5DDH A;  3RUG A;  1OGA A;  3HAE A;  1I1Y A;  3FOM A;  3S6C A;  3L3H A;  2X4N A;  2XPG A;  2XFX A;  2HLA A;  5E6I C;  5J6H A;  5EUO A;  1HYR C;  3GMN A;  4PP8 C;  5BRZ A;  1LDP H;  5L2K A;  3SKO A;  3MGO A;  5BS0 A;  5ENW A;  3KPL A;  1B3J A;  4PJH A;  3KPS A;  1AKJ A;  2F74 A;  2BNR A;  4ELM A;  1M05 A;  1R3H A;  1RJZ A;  5BJT A;  1I1F A;  2ZOK A;  4HUX A;  3BUY A;  3LKQ A;  1AGC A;  3KPR A;  3PWJ A;  1HHJ A;  3MRF A;  4G42 A;  2F54 A;  5L2J A;  5HHP A;  4Y4F A;  1T7Z A;  4Y2D A;  3HG1 A;  2PYE A;  3GMP A;  4JQX A;  1S8D A;  2HJK A;  1I7U A;  3BP4 A;  4WUU A;  5C0G A;  1IM9 A;  3QQ3 A;  5D2N A;  4U1S A;  5GSR A;  5IB4 A;  2CIK A;  4MXQ A;  4N0U A;  2GTW A;  3L3J A;  5INC A;  4PG2 A;  3BWA A;  3CPL A;  3OX8 A;  4ZUV A;  4PV8 A;  4ZFZ A;  3D2U A;  2WY3 A;  2MHA A;  1NAN H;  1T21 A;  5C0B A;  4L8D A;  1ZHN A;  5MER A;  3O3A A;  3DMM A;  4FFE X;  3KPQ A;  4K7F A;  3PWN A;  3ROL A;  3VXM A;  4GKN A;  4D0D A;  1BZ9 A;  5BXF A;  1N59 A;  2YPK A;  1I7T A;  4F7E A;  4QRT A;  4UQ3 A;  1ZS8 A;  3L3G A;  3CH1 A;  1AGE A;  3L3D A;  3TJH A;  3MGT A;  4QOK A;  3G08 A;  4PJD A;  3ILQ C;  4MQ7 A;  1ZHK A;  2HJL A;  3KLA A;  5EOT A;  4Y16 A;  2FO4 A;  4NQX A;  3BHB A;  4PJE A;  5HGH A;  4D0C A;  3BW9 A;  3NFN A;  3QDJ A;  3RWH A;  3H9S A;  3MRK A;  4ZUT A;  1MHC A;  5D2L A;  3RL1 A;  3BZE A;  1S9Y A;  4GKS A;  3KPP A;  3CZF A;  1HHH A;  3WLB A;  1MI5 A;  4MNQ A;  4PJG A;  5MEO A;  3DBX A;  1KBG H;  3FFC A;  1W72 A;  1ZAG A;  3KXF A;  3PWL A;  4JFQ A;  2ZOL A;  4MJ5 A;  2ZSV A;  5FKP A;  3TVM A;  3X14 A;  2YPL A;  4U6Y A;  1JUF A;  3VFU A;  3GSR A;  2UWE A;  3MV7 A;  2V2W A;  3DX8 A;  3VXU A;  1JF1 A;  2BVQ A;  5C0E A;  3MRH A;  3SDC A;  4CW1 A;  3DXA A;  2E7L E;  2ESV A;  3QFD A;  3RTQ A;  3LKN A;  1T1Y A;  3QFJ A;  3RWE A;  1DE4 A;  2GIT A;  1JHT A;  3CDG A;  4PRA A;  3VFV A;  3TBS A;  3PWV A;  4IRJ A;  3B3I A;  1T0M A;  1XH3 A;  4PJ7 A;  4E5X A;  1A9E A;  2BSR A;  1JPF A;  4N0C A;  4NQC A;  3BEV A;  5C08 A;  5FDW A;  3TF7 A;  2H26 A;  3GIV A;  4JFO A;  2F53 A;  3ECB A;  4N0F A;  5IB1 A;  1NEZ A;  3MR9 A;  1GZP A;  4APQ A;  4JFE A;  2CLZ A;  3E2H A;  3SDA A;  5JHD A;  3VFP A;  3P77 A;  3O3D A;  5DEF A;  5IVX A;  4X6D A;  5EFI A;  3HLA A;  5EU6 A;  2FYY A;  3SPV A;  1W0W A;  1UQS A;  1KJM A;  1JE6 A;  1G7Q A;  1LK2 A;  5F1I A;  3QUZ A;  4U1I A;  1YN7 A;  3KWW A;  3TBT A;  1OSZ A;  3GSV A;  3BH8 A;  2X4S A;  4JQV A;  5SWZ A;  5C0D A;  3M1B A;  4I48 A;  3VXP A;  5GSV A;  3QI9 A;  4L3C A;  3O8X A;  4MJI A;  1L8J A;  1DUZ A;  1EEY A;  1QEW A;  3MA7 A;  4GUP A;  5IEH A;  3P9L A;  4HUU A;  3WL9 A;  3CVH A;  3V5K A;  2AXF A;  3W39 A;  3E3Q A;  1G6R H;  4HUW A;  1FZJ A;  2X4R A;  4EUP A;  1JFM A;  1T1X A;  5C07 A;  3LV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...