4N5EA

42f3 tcr pcpa12/h-2ld complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
174
structure length
174
Chain Sequence
PHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQIAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQWMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 42F3 alpha VmCh
publication title Structural interplay between germline interactions and adaptive recognition determines the bandwidth of TCR-peptide-MHC cross-reactivity.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 52
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2013-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4n5eA00
3P9LA 1S7VA 4PRBA 4PJBA 3RZCA 1FFOA 1GZPA 4IRSA 2X4UA 5C0BA 4G8IA 1T1YA 4WU5A 1T1ZA 3L3GA 2GT9A 4PJHA 4Y2DA 3FQTA 1MWAH 5IM7A 1KJVA 5INCA 5E8PA 4HS3A 5EO1A 4PJXA 4F7CA 1ZAGA 2BNRA 3ARFA 4NQEA 1LK2A 3ARBA 4PJIA 3BHBA 3UBXA 2HN7A 3JTSA 1OGAA 1AGDA 1AGCA 3MRJA 4U1NA 5C0DA 4Z77A 3VFOA 3DXAA 3ROLA 5D7LA 4E5XA 4G42A 3D2UA 4PRNA 4I48A 1KCGC 5HYJA 2CKBH 3U0PA 4PG9A 3VWJA 5MEOA 5HHOA 1A1NA 2Q7YA 3KPLA 1VACA 2H26A 4LCCC 4MJ5A 1S7UA 3FRUA 1T21A 4PJ8A 5J6GA 4LCYA 3VRJA 1S7XA 1TVHA 3FT3A 4HWZA 5E9DA 4MS8A 1S7SA 4ZUWA 1K5NA 1OF2A 1MHEA 2P5WA 3IXAA 4Z76A 1CE6A 5EUOA 5C07A 1S9YA 4L29A 3GSRA 3ARGA 3E6FA 2HJLA 4HX1A 5HHMA 1VGKA 4NO2A 2CLRA 3BWAA 1QLFA 1BZ9A 1FZMA 4QRSA 4IRJA 4MJIA 5C0FA 1XR8A 3BP7A 3I6KA 1S7QA 1DUZA 1IM9A 1MHCA 1KTLA 3V5HA 2OI9A 4NNXA 3GMPA 1AO7A 3M17A 1RJYA 3RL1A 4G43A 3TVMA 4NO3A 3RUGA 1TVBA 3TBTA 4MVBA 3FQWA 1SYVA 2BSSA 4XXCA 3IT8D 3KPRA 2VABA 3GSOA 4K7FA 3RWJA 2ZOKA 4F7PA 4NHUE 3SCMA 3ERYA 5C9JA 5C0GA 1INQA 3KPQA 2YPLA 3FOLA 2YEZA 5D5MA 3DX7A 5HGBA 1T7WA 5IB4A 4WU7A 4NQVA 2CIIA 3MRGA 1ZT4A 3CPLA 3B6SA 3QQ4A 3WS6A 3BVNA 3PWJA 3PWLA 4PRDA 3D3VA 3MRHA 3P9MA 1QQDA 2J8UA 2VLJA 4HUXA 5B39A 1EEZA 2GTZA 1NANH 4QRQA 1K8DA 1ZT1A 1YPZA 4JQXA 4U6XA 1G7PA 2CLVA 3MRKA 1P7QA 3B3IA 3P4OA 1HHHA 4O2FA 1VADA 3VFMA 5E6IC 3VFRA 3LKPA 5MEPA 1KJ2H 3KPMA 1PQZA 2GTWA 3MRFA 1JF1A 3RTQA 3VFPA 4NQDA 1T1WA 3ILQC 1T7XA 1XZ0A 3MYJA 4N0CA 1XH3A 4WUUA 3SDCA 2X4QA 3L3IA 1A9EA 2HJKA 3MV9A 3PWNA 5BXFA 1FFPA 1T80A 5F1IA 3MROA 3T1FA 2X4PA 3P77A 1T7VA 3CZFA 1R3HA 3E3QA 1ONQA 4UQ2A 1ZHLA 1HHJA 3LKSA 1A6ZA 2GUOA 5EU6A 3LKNA 4F7EA 4APQA 4MNGA 3TO2A 3VXRA 2CLZA 2BSTA 2ZOLA 1I7RA 1JGDA 3SKOA 1QVOA 4Y4FA 3WLBA 3DTXA 3QDMA 4G9DA 1W0WA 5SWQA 3RWIA 3QDJA 3UTSA 3WL9A 4EN3C 3D25A 2X4TA 4Y16A 1I1FA 3HLAA 4JFOA 1OGTA 3SKMA 1ZT7A 3QDGA 5IB5A 1N3NA 4X6EA 5HHNA 4HUVA 3QEQA 1A1OA 2P5EA 3HUJA 4ZUVA 4PREA 3C8KA 2VLLA 1JHTA 1YDPA 4JFEA 4PJGA 5HGHA 2HLAA 1BIIA 2NW3A 1T0NA 2VLRA 4X6DA 2YPKA 3MGTA 4ZUSA 3TIDA 1AGFA 2AV1A 3VRIA 1JFMA 3VJ6A 1UXWA 5DEGA 1N59A 3FFCA 5C0CA 5IEHA 3OV6A 4I4WA 4PV9A 3VCLA 1WBXA 3TBVA 4U1MA 4Y4KA 1LP9A 3BGMA 4PRAA 5BS0A 3BEVA 1M6OA 1S8DA 4ZUUA 5ENWA 4L8CA 2XFXA 3LKQA 1HYRC 2BCKA 4PJFA 3PABA 3VXSA 3BXNA 2JCCA 2F53A 1A9BA 3O8XA 1S9WA 3X11A 2X4NA 3FONA 3FT4A 3JVGA 1I7TA 3AM8A 1QR1A 5ISZA 3P73A 1BD2A 3CCHA 1JE6A 3MRCA 3X14A 3ES6A 3MREA 2DYPA 2D31A 3DMMA 3PQYA 3TJHA 3GIVA 5ACZA 3TF7A 4L8DA 1E28A 1I4FA 1Q94A 3HCVA 3O3BA 3QULA 2WY3A 3QUXA 2F54A 3BO8A 4JQVA 4PJ9A 5IROA 3RWFA 1LDPH 3TFKA 3VFUA 5MEQA 4HUWA 4QRRA 1IM3A 1KBGH 3HE7A 1OSZA 1QSEA 4NQXA 4WW2C 1NEZA 2XPGA 3FQRA 1CD1A 3JTCA 3KYOA 4NO0A 5C0AA 3TIEA 1A1MA 3VH8A 3VXUA 1WBZA 4PRHA 4NSKA 4PJ7A 3WUWA 5E00A 5FA3A 4GKSA 1GZQA 4HKJA 4U1JA 3UTQA 4CVZA 3KYNA 1FZOA 1P4LA 2AV7A 3VFSA 4L9LC 1HSAA 2ZSVA 1B0GA 5D9SA 1T0MA 3GSNH 3KLAA 3LKRA 4O2CA 1QSFA 3O4LA 4ZFZA 1EXUA 3D18A 4JFDA 4S0UC 1ZHBA 3D39A 2A83A 4FTVA 2BNQA 3VXNA 5MENA 3MR9A 3H9SA 5FA4A 1HHGA 5C08A 1FFNA 3NFNA 3QZWA 3O3AA 1C16A 1U58A 3LN5A 3FT2A 2VLKA 1S7TA 2CIKA 1T7ZA 5GSRA 1KPRA 3SDAA 1HOCA 4QRUA 1T22A 3BH8A 3LV3A 1ZVSA 3GMRA 4UQ3A 2X4OA 1DUYA 3TBWA 4X6FA 4NO5A 4V3DB 5AD0A 4LCWA 1N5AA 5C0EA 2NX5A 4JRYA 4K71B 4PGDA 3KPPA 1UXSA 3OXSA 3OXRA 1QO3A 4PJAA 1ZHKA 3W39A 5GSVA 1TMCA 5IVXA 3LN4A 3MRPA 1JPGA 5H94A 4L4TA 4PGBA 4HV8A 1S7WA 1KJMA 5EU3A 4PR5A 1HHKA 3QFDA 3GJFA 4L4VA 3VXPA 4G9FA 4WO4A 3TBYA 5B38A 3BW9A 3ILPA 1L8JA 3FTGA 3KPNA 2MHAA 2UWEA 1ZHNA 4U1IA 1EEYA 3ECBA 4FFEX 1RJZA 1X7QA 5HHQA 4PG2A 4QRTA 1S7RA 3I6LD 2PO6A 4MXQA 1HSBA 3RL2A 5C0JA 2FIKA 3KXFA 1Z5LA 1QRNA 3OX8A 3VFNA 3VWKA 4ZAKA 4CW1A 1KPUA 1E27A 3BZFA 3CC5A 3GSVA 3V5DA 3QUYA 2VE6A 3I6GA 4EUPA 2GITA 4F7TA 5E8NA 3MGOA 3GMNA 4U1HA 3SDXA 1I7UA 4WWKC 5IB2A 1M05A 3FQXA 5INDA 5HGAA 1ED3A 2RFXA 3MRRA 3DX8A 3P4MA 4MQ7A 3VFWA 5IB1A 3M1BA 3QI9A 1KPVA 3P4NA 4PRIA 2FYYA 3JTTA 3H9HA 2BSRA 1B0RA 5D7IA 4G59A 3TO4A 3MRMA 3HPJA 4QRPA 3HE6A 3L3JA 4GUPA 1DDHA 5DEFA 2AK4A 3TZVC 4IHOA 3BUYA 1LQVA 5SWZA 4PV8A 3WS3A 4PGEA 1T1XA 1P1ZA 3BP4A 3QQ3A 5BRZA 3GSUA 3L3KA 4PJEA 5FKPA 2BVOA 3AREA 1FO0H 4LHUA 1LD9A 3KPSA 4Z78A 1G6RH 3GMQA 1BQHA 5C09A 4NNYA 1FG2A 3SDDA 3CH1A 3GMMA 2V2XA 3E2HA 1B3JA 2X4RA 4ELMA 4PDCE 4ZUTA 3O3DA 4Y4HA 3X13A 1S9XA 1EFXA 2H6PA 3PWPA 1T20A 3MA7A 3UTTA 5F1NA 3RWCA 4MNQA 5E8OA 4N0FA 3GMOA 1RK0A 3SJVA 4G8GA 3AU1A 4U1LA 5EOTA 3QFJA 3S6CA 4PRPA 2BVQA 3TN0A 5C0IA 5MERA 5F7DA 1W0VA 5D2NA 5J6HA 4V3EB 1T7YA 3FOMA 3HG1A 2OL3H 3MRLA 4L8SC 4L3CA 4PJDA 3LKOA 1AKJA 4N5EA 2GJ6A 5L2JA 1G7QA 4X6CA 3RWHA 1XR9A 2ESVA 3FQNA 3L3HA 3VFTA 4EI5A 3MRNA 1I1YA 5F9JA 3L9RA 1NAMH 3DBXA 1LEKA 2F74A 4L8BA 3TBSA 4CVXA 1QEWA 4GKNA 1MI5A 2GAZA 3BEWA 5L2KA 4NQCA 1RK1A 4JFQA 4D0DA 1DE4A 3MRDA 1ZS8A 1N2RA 1WBYA 3MRQA 3RGVC 3QUKA 1AGEA 4MJ6A 4JFPA 3V5KA 4PJCA 3L3DA 3MRBA 3KPOA 2AXFA 3GSWA 3H7BA 3KWWA 1FZJA 4U1SA 4WJ5A 5IEKA 3ROOA 5SWSA 3VFVA 2X70A 3E6HA 4U6YA 3BZEA 3PWUA 3BH9A 2PYEA 1YN7A 1FZKA 5EFIA 1CG9A 3CVHA 3MV7A 4JFFA 4HUUA 3W0WA 1I1AA 3X12A 4O2EA 2C7UA 3RWDA 3C9NA 4ONOA 5IB3A 3G08A 3O9WA 4LNRA 4D0BA 2BVPA 3FQUA 3MV8A 4PP8C 3O3EA 5EU4A 5J1AA 3RWGA 5D7JC 4U1KA 4F7MA 1AGBA 1JUFA 1HHIA 2AXGA 4E0RA 3ARDA 4PJ5A 2E7LE 3GSXA 1LEGA 2FZ3A 3CDGA 4IIQC 1SYSA 1UQSA 4PGCA 4N0UA 3RWEA 1W72A 3T8XA 5D2LA 1JPFA 1ZSDA 5EO0A 5JHDA 3MRIA 2V2WA 3GSQA 4MX7A 4NT6A 4WDIA 3GMLA 3VXOA 3QUZA 3VXMA 3REWA 4D0CA 5DDHA 5BJTA 5HHPA 3SPVA 5HGDA 1YN6A 1KJ3H 2X4SA 4QOKA 5EU5A 2VAAA 5FDWA 2AKRA 3TPUE 3UPRA 4L3EA 1JGEA 3TA3A 3PWVA 4N8VA 3DX6A 2FWOA 2FO4A 3HAEA 2ZSWA 4JRXA
chains in the Genus database with same CATH superfamily
3P9LA 1S7VA 4PRBA 4PJBA 3RZCA 1FFOA 1GZPA 4IRSA 2X4UA 5C0BA 4G8IA 1T1YA 4WU5A 1T1ZA 3L3GA 2GT9A 4PJHA 4Y2DA 3FQTA 1MWAH 5IM7A 1KJVA 5INCA 5E8PA 4HS3A 5EO1A 4PJXA 4F7CA 1ZAGA 2BNRA 3ARFA 4NQEA 1LK2A 3ARBA 4PJIA 3BHBA 3UBXA 2HN7A 3JTSA 1OGAA 1AGDA 1AGCA 3MRJA 4U1NA 5C0DA 4Z77A 3VFOA 3DXAA 3ROLA 5D7LA 4E5XA 4G42A 3D2UA 4PRNA 4I48A 1KCGC 5HYJA 2CKBH 3U0PA 4PG9A 3VWJA 5MEOA 5HHOA 1A1NA 2Q7YA 3KPLA 1VACA 2H26A 4LCCC 4MJ5A 1S7UA 3FRUA 1T21A 4PJ8A 5J6GA 2IA1A 4LCYA 3VRJA 1S7XA 1TVHA 3FT3A 4HWZA 5E9DA 4MS8A 1S7SA 4ZUWA 1K5NA 1OF2A 1MHEA 2P5WA 3IXAA 4Z76A 1CE6A 5EUOA 5C07A 1S9YA 4L29A 3GSRA 3ARGA 3E6FA 2HJLA 4HX1A 5HHMA 1VGKA 2NYKA 4NO2A 2CLRA 3BWAA 1QLFA 1BZ9A 1FZMA 4QRSA 4IRJA 4MJIA 5C0FA 1XR8A 3BP7A 3I6KA 1S7QA 1DUZA 1IM9A 1MHCA 1KTLA 3V5HA 2OI9A 4NNXA 3GMPA 1AO7A 3M17A 1RJYA 3RL1A 4G43A 3TVMA 4NO3A 3RUGA 1TVBA 3TBTA 4MVBA 3FQWA 1SYVA 2BSSA 4XXCA 3IT8D 3KPRA 2VABA 3GSOA 4K7FA 3RWJA 2ZOKA 4F7PA 4NHUE 3SCMA 3ERYA 5C9JA 5C0GA 1INQA 3KPQA 2YPLA 3FOLA 2YEZA 5D5MA 3DX7A 5HGBA 1T7WA 3I0TA 5IB4A 4WU7A 4NQVA 2CIIA 3MRGA 1ZT4A 3CPLA 3B6SA 3QQ4A 3WS6A 3BVNA 3PWJA 3PWLA 4PRDA 3D3VA 3MRHA 3P9MA 1QQDA 2J8UA 2VLJA 4HUXA 5B39A 1EEZA 2GTZA 1NANH 4QRQA 1K8DA 1ZT1A 1YPZA 4JQXA 4U6XA 1G7PA 2CLVA 3MRKA 1P7QA 3B3IA 3P4OA 1HHHA 4O2FA 1VADA 3VFMA 5E6IC 3VFRA 3LKPA 5MEPA 1KJ2H 3KPMA 1PQZA 2GTWA 3MRFA 1JF1A 3RTQA 3VFPA 4NQDA 1T1WA 3ILQC 1T7XA 1XZ0A 3MYJA 4N0CA 1XH3A 4WUUA 3SDCA 2X4QA 3L3IA 1A9EA 2HJKA 3MV9A 3PWNA 5BXFA 1FFPA 1T80A 5F1IA 3MROA 3T1FA 2X4PA 3P77A 1T7VA 3CZFA 1R3HA 3E3QA 1ONQA 4UQ2A 1ZHLA 1HHJA 3LKSA 1A6ZA 2GUOA 5EU6A 3LKNA 4F7EA 4APQA 4MNGA 3TO2A 3VXRA 2CLZA 2BSTA 2ZOLA 1I7RA 1JGDA 3SKOA 1QVOA 4Y4FA 3WLBA 3DTXA 3QDMA 4G9DA 1W0WA 5SWQA 3RWIA 3QDJA 3UTSA 3WL9A 4EN3C 4G59C 3D25A 2X4TA 4Y16A 1I1FA 3HLAA 4JFOA 1OGTA 3SKMA 1ZT7A 3QDGA 5IB5A 1N3NA 4X6EA 5HHNA 4HUVA 3QEQA 1A1OA 2P5EA 3HUJA 4ZUVA 4PREA 3C8KA 2VLLA 1JHTA 1YDPA 4JFEA 4PJGA 5HGHA 2HLAA 1BIIA 2NW3A 4BKWA 1T0NA 2VLRA 4X6DA 2YPKA 3MGTA 4ZUSA 3TIDA 1AGFA 2AV1A 3VRIA 1JFMA 3VJ6A 1UXWA 5DEGA 1N59A 3FFCA 5C0CA 5IEHA 3OV6A 4I4WA 4PV9A 3VCLA 1WBXA 3TBVA 4U1MA 4Y4KA 1LP9A 3BGMA 4PRAA 5BS0A 3BEVA 1M6OA 1S8DA 4ZUUA 5ENWA 4L8CA 2XFXA 3LKQA 1HYRC 2BCKA 4PJFA 3PABA 3VXSA 3BXNA 2JCCA 2F53A 1A9BA 3O8XA 1S9WA 3X11A 2X4NA 3FONA 3FT4A 3JVGA 1I7TA 3AM8A 1QR1A 5ISZA 3P73A 1BD2A 3CCHA 1JE6A 3MRCA 3X14A 3ES6A 3MREA 2DYPA 2D31A 3DMMA 3PQYA 3TJHA 3GIVA 5ACZA 3TF7A 4L8DA 1E28A 1I4FA 1Q94A 3HCVA 3O3BA 3QULA 2WY3A 3QUXA 2F54A 3BO8A 4JQVA 4PJ9A 5IROA 3RWFA 1LDPH 3TFKA 3VFUA 5MEQA 4HUWA 4QRRA 1IM3A 1KBGH 3HE7A 1OSZA 1QSEA 4NQXA 4WW2C 1NEZA 2XPGA 3FQRA 1CD1A 3JTCA 3KYOA 4NO0A 5C0AA 3TIEA 1A1MA 3VH8A 3VXUA 1WBZA 4PRHA 4NSKA 4PJ7A 3WUWA 5E00A 5FA3A 4GKSA 1GZQA 4HKJA 4U1JA 3UTQA 4CVZA 3KYNA 1FZOA 1P4LA 2AV7A 3VFSA 4L9LC 1HSAA 2ZSVA 1B0GA 5D9SA 1T0MA 3GSNH 3KLAA 3LKRA 4O2CA 1QSFA 3O4LA 4ZFZA 1EXUA 3D18A 4JFDA 4S0UC 1ZHBA 3D39A 2A83A 4FTVA 2BNQA 3VXNA 5MENA 3MR9A 3H9SA 5FA4A 1HHGA 5C08A 1FFNA 3NFNA 3QZWA 3O3AA 1C16A 1U58A 3LN5A 3FT2A 2VLKA 1S7TA 2CIKA 1T7ZA 5GSRA 1KPRA 3SDAA 1HOCA 4QRUA 1T22A 3BH8A 3LV3A 1ZVSA 3GMRA 4UQ3A 2X4OA 1DUYA 3TBWA 4X6FA 4NO5A 4V3DB 5AD0A 4LCWA 1N5AA 5C0EA 2NX5A 4JRYA 4K71B 4PGDA 3KPPA 1UXSA 3OXSA 3OXRA 1QO3A 4PJAA 1ZHKA 3W39A 5GSVA 1TMCA 5IVXA 3LN4A 3MRPA 1JPGA 5H94A 4L4TA 4PGBA 4HV8A 1S7WA 1KJMA 5EU3A 4PR5A 1HHKA 3QFDA 3GJFA 4L4VA 3VXPA 4G9FA 4WO4A 3TBYA 5B38A 3BW9A 3ILPA 1L8JA 3FTGA 3KPNA 2MHAA 2UWEA 1ZHNA 4U1IA 1EEYA 3ECBA 4FFEX 1RJZA 1X7QA 5HHQA 4PG2A 4QRTA 1S7RA 3I6LD 2PO6A 4MXQA 1HSBA 3RL2A 5C0JA 2FIKA 3KXFA 1Z5LA 1QRNA 3OX8A 3VFNA 3VWKA 4ZAKA 4CW1A 1KPUA 1E27A 3BZFA 3CC5A 3GSVA 3V5DA 3QUYA 2VE6A 3I6GA 4EUPA 2GITA 4F7TA 5E8NA 3MGOA 3GMNA 4U1HA 3SDXA 1I7UA 4WWKC 5IB2A 1M05A 3FQXA 5INDA 5HGAA 1ED3A 2RFXA 3MRRA 3DX8A 3P4MA 4MQ7A 3VFWA 5IB1A 3M1BA 3QI9A 1KPVA 3P4NA 4PRIA 2FYYA 3JTTA 3H9HA 2BSRA 1B0RA 5D7IA 4G59A 3TO4A 3MRMA 3HPJA 4QRPA 3HE6A 3L3JA 4GUPA 1DDHA 5DEFA 2AK4A 3TZVC 4IHOA 3BUYA 1LQVA 5SWZA 4PV8A 3WS3A 4PGEA 1T1XA 1P1ZA 3BP4A 3QQ3A 5BRZA 3GSUA 3L3KA 4PJEA 5FKPA 2BVOA 3AREA 1FO0H 4LHUA 1LD9A 3KPSA 4Z78A 1G6RH 3GMQA 1BQHA 5C09A 4NNYA 1FG2A 3SDDA 3CH1A 3GMMA 2V2XA 3E2HA 1B3JA 2X4RA 4ELMA 4PDCE 4ZUTA 3O3DA 4Y4HA 3X13A 1S9XA 1EFXA 2H6PA 3PWPA 1T20A 3MA7A 3UTTA 5F1NA 3RWCA 4MNQA 5E8OA 4N0FA 3GMOA 1RK0A 3SJVA 4G8GA 3AU1A 4U1LA 5EOTA 3QFJA 3S6CA 4PRPA 2BVQA 3TN0A 2O5NA 5C0IA 5MERA 5F7DA 1W0VA 5D2NA 5J6HA 4V3EB 1T7YA 3FOMA 3HG1A 2OL3H 3MRLA 4L8SC 4L3CA 4PJDA 3LKOA 1AKJA 4N5EA 2GJ6A 5L2JA 1G7QA 4X6CA 3RWHA 1XR9A 2ESVA 3FQNA 3L3HA 3VFTA 4EI5A 3MRNA 1I1YA 5F9JA 3L9RA 1NAMH 3DBXA 1LEKA 2F74A 4L8BA 3TBSA 4CVXA 1QEWA 4GKNA 1MI5A 2GAZA 3BEWA 5L2KA 4NQCA 1RK1A 4JFQA 4D0DA 1DE4A 3MRDA 1ZS8A 1N2RA 1WBYA 3MRQA 3RGVC 3QUKA 1AGEA 4MJ6A 4JFPA 3V5KA 4PJCA 3L3DA 3MRBA 3KPOA 2AXFA 3GSWA 3H7BA 3KWWA 1FZJA 4U1SA 4WJ5A 5IEKA 3ROOA 5SWSA 3VFVA 2X70A 3E6HA 4U6YA 3BZEA 3PWUA 3BH9A 2PYEA 1YN7A 1FZKA 5EFIA 1CG9A 3CVHA 3MV7A 4JFFA 4HUUA 3W0WA 1I1AA 3X12A 4O2EA 2C7UA 3RWDA 3C9NA 4ONOA 5IB3A 3G08A 3O9WA 4LNRA 4D0BA 2BVPA 3FQUA 3MV8A 4PP8C 3O3EA 5EU4A 5J1AA 3RWGA 5D7JC 4U1KA 4F7MA 1AGBA 1JUFA 1HHIA 2AXGA 4E0RA 3ARDA 4PJ5A 2E7LE 3GSXA 1LEGA 2FZ3A 3CDGA 4IIQC 1SYSA 1UQSA 4PGCA 4N0UA 3RWEA 1W72A 3T8XA 5D2LA 1JPFA 1ZSDA 5EO0A 5JHDA 3MRIA 2V2WA 3GSQA 4MX7A 4NT6A 4WDIA 3GMLA 3VXOA 3QUZA 3VXMA 3REWA 4D0CA 5DDHA 5BJTA 5HHPA 3SPVA 5HGDA 1YN6A 1KJ3H 2X4SA 4QOKA 5EU5A 2VAAA 5FDWA 2AKRA 3TPUE 3UPRA 4L3EA 1JGEA 3TA3A 4JO8A 3PWVA 4N8VA 3DX6A 2FWOA 2FO4A 3HAEA 2ZSWA 4JRXA
chains in the Genus database with same CATH topology
3P9LA 1S7VA 4PRBA 4PJBA 3RZCA 1FFOA 1GZPA 4IRSA 2X4UA 5C0BA 4G8IA 1T1YA 4WU5A 1T1ZA 3L3GA 2GT9A 4PJHA 4Y2DA 3FQTA 1MWAH 5IM7A 1KJVA 5INCA 5E8PA 4HS3A 5EO1A 4PJXA 4F7CA 1ZAGA 2BNRA 3ARFA 4NQEA 1LK2A 3ARBA 4PJIA 3BHBA 3UBXA 2HN7A 3JTSA 1OGAA 1AGDA 1AGCA 3MRJA 4U1NA 5C0DA 4Z77A 3VFOA 3DXAA 3ROLA 5D7LA 4E5XA 4G42A 3D2UA 4PRNA 4I48A 1KCGC 5HYJA 2CKBH 3U0PA 4PG9A 3VWJA 5MEOA 5HHOA 1A1NA 2Q7YA 3KPLA 1VACA 2H26A 4LCCC 4MJ5A 1S7UA 3FRUA 1T21A 4PJ8A 5J6GA 4LCYA 3VRJA 1S7XA 1TVHA 3FT3A 4HWZA 5E9DA 4MS8A 1S7SA 4ZUWA 1K5NA 1OF2A 1MHEA 2P5WA 3IXAA 4Z76A 1CE6A 5EUOA 5C07A 1S9YA 4L29A 3GSRA 3ARGA 3E6FA 2HJLA 4HX1A 5HHMA 1VGKA 4NO2A 2CLRA 3BWAA 1QLFA 1BZ9A 1FZMA 4QRSA 4IRJA 4MJIA 5C0FA 1XR8A 3BP7A 3I6KA 1S7QA 1DUZA 1IM9A 1MHCA 1KTLA 3V5HA 2OI9A 4NNXA 3GMPA 1AO7A 3M17A 1RJYA 3RL1A 4G43A 3TVMA 4NO3A 3RUGA 1TVBA 3TBTA 4MVBA 3FQWA 1SYVA 2BSSA 4XXCA 3IT8D 3KPRA 2VABA 3GSOA 4K7FA 3RWJA 2ZOKA 4F7PA 4NHUE 3SCMA 3ERYA 5C9JA 5C0GA 1INQA 3KPQA 2YPLA 3FOLA 2YEZA 5D5MA 3DX7A 5HGBA 1T7WA 5IB4A 4WU7A 4NQVA 2CIIA 3MRGA 1ZT4A 3CPLA 3B6SA 3QQ4A 3WS6A 3BVNA 3PWJA 3PWLA 4PRDA 3D3VA 3MRHA 3P9MA 1QQDA 2J8UA 2VLJA 4HUXA 5B39A 1EEZA 2GTZA 1NANH 4QRQA 1K8DA 1ZT1A 1YPZA 4JQXA 4U6XA 1G7PA 2CLVA 3MRKA 1P7QA 3B3IA 3P4OA 1HHHA 4O2FA 1VADA 3VFMA 5E6IC 3VFRA 3LKPA 5MEPA 1KJ2H 3KPMA 1PQZA 2GTWA 3MRFA 1JF1A 3RTQA 3VFPA 4NQDA 1T1WA 3ILQC 1T7XA 1XZ0A 3MYJA 4N0CA 1XH3A 4WUUA 3SDCA 2X4QA 3L3IA 1A9EA 2HJKA 3MV9A 3PWNA 5BXFA 1FFPA 1T80A 5F1IA 3MROA 3T1FA 2X4PA 3P77A 1T7VA 3CZFA 1R3HA 3E3QA 1ONQA 4UQ2A 1ZHLA 1HHJA 3LKSA 1A6ZA 2GUOA 5EU6A 3LKNA 4F7EA 4APQA 4MNGA 3TO2A 3VXRA 2CLZA 2BSTA 2ZOLA 1I7RA 1JGDA 3SKOA 1QVOA 4Y4FA 3WLBA 3DTXA 3QDMA 4G9DA 1W0WA 5SWQA 3RWIA 3QDJA 3UTSA 3WL9A 4EN3C 3D25A 2X4TA 4Y16A 1I1FA 3HLAA 4JFOA 1OGTA 3SKMA 1ZT7A 3QDGA 5IB5A 1N3NA 4X6EA 5HHNA 4HUVA 3QEQA 1A1OA 2P5EA 3HUJA 4ZUVA 4PREA 3C8KA 2VLLA 1JHTA 1YDPA 4JFEA 4PJGA 5HGHA 2HLAA 1BIIA 2NW3A 1T0NA 2VLRA 4X6DA 2YPKA 3MGTA 4ZUSA 3TIDA 1AGFA 2AV1A 3VRIA 1JFMA 3VJ6A 1UXWA 5DEGA 1N59A 3FFCA 5C0CA 5IEHA 3OV6A 4I4WA 4PV9A 3VCLA 1WBXA 3TBVA 4U1MA 4Y4KA 1LP9A 3BGMA 4PRAA 5BS0A 3BEVA 1M6OA 1S8DA 4ZUUA 5ENWA 4L8CA 2XFXA 3LKQA 1HYRC 2BCKA 4PJFA 3PABA 3VXSA 3BXNA 2JCCA 2F53A 1A9BA 3O8XA 1S9WA 3X11A 2X4NA 3FONA 3FT4A 3JVGA 1I7TA 3AM8A 1QR1A 5ISZA 3P73A 1BD2A 3CCHA 1JE6A 3MRCA 3X14A 3ES6A 3MREA 2DYPA 2D31A 3DMMA 3PQYA 3TJHA 3GIVA 5ACZA 3TF7A 4L8DA 1E28A 1I4FA 1Q94A 3HCVA 3O3BA 3QULA 2WY3A 3QUXA 2F54A 3BO8A 4JQVA 4PJ9A 5IROA 3RWFA 1LDPH 3TFKA 3VFUA 5MEQA 4HUWA 4QRRA 1IM3A 1KBGH 3HE7A 1OSZA 1QSEA 4NQXA 4WW2C 1NEZA 2XPGA 3FQRA 1CD1A 3JTCA 3KYOA 4NO0A 5C0AA 3TIEA 1A1MA 3VH8A 3VXUA 1WBZA 4PRHA 4NSKA 4PJ7A 3WUWA 5E00A 5FA3A 4GKSA 1GZQA 4HKJA 4U1JA 3UTQA 4CVZA 3KYNA 1FZOA 1P4LA 2AV7A 3VFSA 4L9LC 1HSAA 2ZSVA 1B0GA 5D9SA 1T0MA 3GSNH 3KLAA 3LKRA 4O2CA 1QSFA 3O4LA 4ZFZA 1EXUA 3D18A 4JFDA 4S0UC 1ZHBA 3D39A 2A83A 4FTVA 2BNQA 3VXNA 5MENA 3MR9A 3H9SA 5FA4A 1HHGA 5C08A 1FFNA 3NFNA 3QZWA 3O3AA 1C16A 1U58A 3LN5A 3FT2A 2VLKA 1S7TA 2CIKA 1T7ZA 5GSRA 1KPRA 3SDAA 1HOCA 4QRUA 1T22A 3BH8A 3LV3A 1ZVSA 3GMRA 4UQ3A 2X4OA 1DUYA 3TBWA 4X6FA 4NO5A 4V3DB 5AD0A 4LCWA 1N5AA 5C0EA 2NX5A 4JRYA 4K71B 4PGDA 3KPPA 1UXSA 3OXSA 3OXRA 1QO3A 4PJAA 1ZHKA 3W39A 5GSVA 1TMCA 5IVXA 3LN4A 3MRPA 1JPGA 5H94A 4L4TA 4PGBA 4HV8A 1S7WA 1KJMA 5EU3A 4PR5A 1HHKA 3QFDA 3GJFA 4L4VA 3VXPA 4G9FA 4WO4A 3TBYA 5B38A 3BW9A 3ILPA 1L8JA 3FTGA 3KPNA 2MHAA 2UWEA 1ZHNA 4U1IA 1EEYA 3ECBA 4FFEX 1RJZA 1X7QA 5HHQA 4PG2A 4QRTA 1S7RA 3I6LD 2PO6A 4MXQA 1HSBA 3RL2A 5C0JA 2FIKA 3KXFA 1Z5LA 1QRNA 3OX8A 3VFNA 3VWKA 4ZAKA 4CW1A 1KPUA 1E27A 3BZFA 3CC5A 3GSVA 3V5DA 3QUYA 2VE6A 3I6GA 4EUPA 2GITA 4F7TA 5E8NA 3MGOA 3GMNA 4U1HA 3SDXA 1I7UA 4WWKC 5IB2A 1M05A 3FQXA 5INDA 5HGAA 1ED3A 2RFXA 3MRRA 3DX8A 3P4MA 4MQ7A 3VFWA 5IB1A 3M1BA 3QI9A 1KPVA 3P4NA 4PRIA 2FYYA 3JTTA 3H9HA 2BSRA 1B0RA 5D7IA 4G59A 3TO4A 3MRMA 3HPJA 4QRPA 3HE6A 3L3JA 4GUPA 1DDHA 5DEFA 2AK4A 3TZVC 4IHOA 3BUYA 1LQVA 5SWZA 4PV8A 3WS3A 4PGEA 1T1XA 1P1ZA 3BP4A 3QQ3A 5BRZA 3GSUA 3L3KA 4PJEA 5FKPA 2BVOA 3AREA 1FO0H 4LHUA 1LD9A 3KPSA 4Z78A 1G6RH 3GMQA 1BQHA 5C09A 4NNYA 1FG2A 3SDDA 3CH1A 3GMMA 2V2XA 3E2HA 1B3JA 2X4RA 4ELMA 4PDCE 4ZUTA 3O3DA 4Y4HA 3X13A 1S9XA 1EFXA 2H6PA 3PWPA 1T20A 3MA7A 3UTTA 5F1NA 3RWCA 4MNQA 5E8OA 4N0FA 3GMOA 1RK0A 3SJVA 4G8GA 3AU1A 4U1LA 5EOTA 3QFJA 3S6CA 4PRPA 2BVQA 3TN0A 5C0IA 5MERA 5F7DA 1W0VA 5D2NA 5J6HA 4V3EB 1T7YA 3FOMA 3HG1A 2OL3H 3MRLA 4L8SC 4L3CA 4PJDA 3LKOA 1AKJA 4N5EA 2GJ6A 5L2JA 1G7QA 4X6CA 3RWHA 1XR9A 2ESVA 3FQNA 3L3HA 3VFTA 4EI5A 3MRNA 1I1YA 5F9JA 3L9RA 1NAMH 3DBXA 1LEKA 2F74A 4L8BA 3TBSA 4CVXA 1QEWA 4GKNA 1MI5A 2GAZA 3BEWA 5L2KA 4NQCA 1RK1A 4JFQA 4D0DA 1DE4A 3MRDA 1ZS8A 1N2RA 1WBYA 3MRQA 3RGVC 3QUKA 1AGEA 4MJ6A 4JFPA 3V5KA 4PJCA 3L3DA 3MRBA 3KPOA 2AXFA 3GSWA 3H7BA 3KWWA 1FZJA 4U1SA 4WJ5A 5IEKA 3ROOA 5SWSA 3VFVA 2X70A 3E6HA 4U6YA 3BZEA 3PWUA 3BH9A 2PYEA 1YN7A 1FZKA 5EFIA 1CG9A 3CVHA 3MV7A 4JFFA 4HUUA 3W0WA 1I1AA 3X12A 4O2EA 2C7UA 3RWDA 3C9NA 4ONOA 5IB3A 3G08A 3O9WA 4LNRA 4D0BA 2BVPA 3FQUA 3MV8A 4PP8C 3O3EA 5EU4A 5J1AA 3RWGA 5D7JC 4U1KA 4F7MA 1AGBA 1JUFA 1HHIA 2AXGA 4E0RA 3ARDA 4PJ5A 2E7LE 3GSXA 1LEGA 2FZ3A 3CDGA 4IIQC 1SYSA 1UQSA 4PGCA 4N0UA 3RWEA 1W72A 3T8XA 5D2LA 1JPFA 1ZSDA 5EO0A 5JHDA 3MRIA 2V2WA 3GSQA 4MX7A 4NT6A 4WDIA 3GMLA 3VXOA 3QUZA 3VXMA 3REWA 4D0CA 5DDHA 5BJTA 5HHPA 3SPVA 5HGDA 1YN6A 1KJ3H 2X4SA 4QOKA 5EU5A 2VAAA 5FDWA 2AKRA 3TPUE 3UPRA 4L3EA 1JGEA 3TA3A 3PWVA 4N8VA 3DX6A 2FWOA 2FO4A 3HAEA 2ZSWA 4JRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P9L A;  1S7V A;  4PRB A;  4PJB A;  3RZC A;  1FFO A;  1GZP A;  4IRS A;  2X4U A;  5C0B A;  4G8I A;  1T1Y A;  4WU5 A;  1T1Z A;  3L3G A;  2GT9 A;  4PJH A;  4Y2D A;  3FQT A;  1MWA H;  5IM7 A;  1KJV A;  5INC A;  5E8P A;  4HS3 A;  5EO1 A;  4PJX A;  4F7C A;  1ZAG A;  2BNR A;  3ARF A;  4NQE A;  1LK2 A;  3ARB A;  4PJI A;  3BHB A;  3UBX A;  2HN7 A;  3JTS A;  1OGA A;  1AGD A;  1AGC A;  3MRJ A;  4U1N A;  5C0D A;  4Z77 A;  3VFO A;  3DXA A;  3ROL A;  5D7L A;  4E5X A;  4G42 A;  3D2U A;  4PRN A;  4I48 A;  1KCG C;  5HYJ A;  2CKB H;  3U0P A;  4PG9 A;  3VWJ A;  5MEO A;  5HHO A;  1A1N A;  2Q7Y A;  3KPL A;  1VAC A;  2H26 A;  4LCC C;  4MJ5 A;  1S7U A;  3FRU A;  1T21 A;  4PJ8 A;  5J6G A;  4LCY A;  3VRJ A;  1S7X A;  1TVH A;  3FT3 A;  4HWZ A;  5E9D A;  4MS8 A;  1S7S A;  4ZUW A;  1K5N A;  1OF2 A;  1MHE A;  2P5W A;  3IXA A;  4Z76 A;  1CE6 A;  5EUO A;  5C07 A;  1S9Y A;  4L29 A;  3GSR A;  3ARG A;  3E6F A;  2HJL A;  4HX1 A;  5HHM A;  1VGK A;  4NO2 A;  2CLR A;  3BWA A;  1QLF A;  1BZ9 A;  1FZM A;  4QRS A;  4IRJ A;  4MJI A;  5C0F A;  1XR8 A;  3BP7 A;  3I6K A;  1S7Q A;  1DUZ A;  1IM9 A;  1MHC A;  1KTL A;  3V5H A;  2OI9 A;  4NNX A;  3GMP A;  1AO7 A;  3M17 A;  1RJY A;  3RL1 A;  4G43 A;  3TVM A;  4NO3 A;  3RUG A;  1TVB A;  3TBT A;  4MVB A;  3FQW A;  1SYV A;  2BSS A;  4XXC A;  3IT8 D;  3KPR A;  2VAB A;  3GSO A;  4K7F A;  3RWJ A;  2ZOK A;  4F7P A;  4NHU E;  3SCM A;  3ERY A;  5C9J A;  5C0G A;  1INQ A;  3KPQ A;  2YPL A;  3FOL A;  2YEZ A;  5D5M A;  3DX7 A;  5HGB A;  1T7W A;  5IB4 A;  4WU7 A;  4NQV A;  2CII A;  3MRG A;  1ZT4 A;  3CPL A;  3B6S A;  3QQ4 A;  3WS6 A;  3BVN A;  3PWJ A;  3PWL A;  4PRD A;  3D3V A;  3MRH A;  3P9M A;  1QQD A;  2J8U A;  2VLJ A;  4HUX A;  5B39 A;  1EEZ A;  2GTZ A;  1NAN H;  4QRQ A;  1K8D A;  1ZT1 A;  1YPZ A;  4JQX A;  4U6X A;  1G7P A;  2CLV A;  3MRK A;  1P7Q A;  3B3I A;  3P4O A;  1HHH A;  4O2F A;  1VAD A;  3VFM A;  5E6I C;  3VFR A;  3LKP A;  5MEP A;  1KJ2 H;  3KPM A;  1PQZ A;  2GTW A;  3MRF A;  1JF1 A;  3RTQ A;  3VFP A;  4NQD A;  1T1W A;  3ILQ C;  1T7X A;  1XZ0 A;  3MYJ A;  4N0C A;  1XH3 A;  4WUU A;  3SDC A;  2X4Q A;  3L3I A;  1A9E A;  2HJK A;  3MV9 A;  3PWN A;  5BXF A;  1FFP A;  1T80 A;  5F1I A;  3MRO A;  3T1F A;  2X4P A;  3P77 A;  1T7V A;  3CZF A;  1R3H A;  3E3Q A;  1ONQ A;  4UQ2 A;  1ZHL A;  1HHJ A;  3LKS A;  1A6Z A;  2GUO A;  5EU6 A;  3LKN A;  4F7E A;  4APQ A;  4MNG A;  3TO2 A;  3VXR A;  2CLZ A;  2BST A;  2ZOL A;  1I7R A;  1JGD A;  3SKO A;  1QVO A;  4Y4F A;  3WLB A;  3DTX A;  3QDM A;  4G9D A;  1W0W A;  5SWQ A;  3RWI A;  3QDJ A;  3UTS A;  3WL9 A;  4EN3 C;  3D25 A;  2X4T A;  4Y16 A;  1I1F A;  3HLA A;  4JFO A;  1OGT A;  3SKM A;  1ZT7 A;  3QDG A;  5IB5 A;  1N3N A;  4X6E A;  5HHN A;  4HUV A;  3QEQ A;  1A1O A;  2P5E A;  3HUJ A;  4ZUV A;  4PRE A;  3C8K A;  2VLL A;  1JHT A;  1YDP A;  4JFE A;  4PJG A;  5HGH A;  2HLA A;  1BII A;  2NW3 A;  1T0N A;  2VLR A;  4X6D A;  2YPK A;  3MGT A;  4ZUS A;  3TID A;  1AGF A;  2AV1 A;  3VRI A;  1JFM A;  3VJ6 A;  1UXW A;  5DEG A;  1N59 A;  3FFC A;  5C0C A;  5IEH A;  3OV6 A;  4I4W A;  4PV9 A;  3VCL A;  1WBX A;  3TBV A;  4U1M A;  4Y4K A;  1LP9 A;  3BGM A;  4PRA A;  5BS0 A;  3BEV A;  1M6O A;  1S8D A;  4ZUU A;  5ENW A;  4L8C A;  2XFX A;  3LKQ A;  1HYR C;  2BCK A;  4PJF A;  3PAB A;  3VXS A;  3BXN A;  2JCC A;  2F53 A;  1A9B A;  3O8X A;  1S9W A;  3X11 A;  2X4N A;  3FON A;  3FT4 A;  3JVG A;  1I7T A;  3AM8 A;  1QR1 A;  5ISZ A;  3P73 A;  1BD2 A;  3CCH A;  1JE6 A;  3MRC A;  3X14 A;  3ES6 A;  3MRE A;  2DYP A;  2D31 A;  3DMM A;  3PQY A;  3TJH A;  3GIV A;  5ACZ A;  3TF7 A;  4L8D A;  1E28 A;  1I4F A;  1Q94 A;  3HCV A;  3O3B A;  3QUL A;  2WY3 A;  3QUX A;  2F54 A;  3BO8 A;  4JQV A;  4PJ9 A;  5IRO A;  3RWF A;  1LDP H;  3TFK A;  3VFU A;  5MEQ A;  4HUW A;  4QRR A;  1IM3 A;  1KBG H;  3HE7 A;  1OSZ A;  1QSE A;  4NQX A;  4WW2 C;  1NEZ A;  2XPG A;  3FQR A;  1CD1 A;  3JTC A;  3KYO A;  4NO0 A;  5C0A A;  3TIE A;  1A1M A;  3VH8 A;  3VXU A;  1WBZ A;  4PRH A;  4NSK A;  4PJ7 A;  3WUW A;  5E00 A;  5FA3 A;  4GKS A;  1GZQ A;  4HKJ A;  4U1J A;  3UTQ A;  4CVZ A;  3KYN A;  1FZO A;  1P4L A;  2AV7 A;  3VFS A;  4L9L C;  1HSA A;  2ZSV A;  1B0G A;  5D9S A;  1T0M A;  3GSN H;  3KLA A;  3LKR A;  4O2C A;  1QSF A;  3O4L A;  4ZFZ A;  1EXU A;  3D18 A;  4JFD A;  4S0U C;  1ZHB A;  3D39 A;  2A83 A;  4FTV A;  2BNQ A;  3VXN A;  5MEN A;  3MR9 A;  3H9S A;  5FA4 A;  1HHG A;  5C08 A;  1FFN A;  3NFN A;  3QZW A;  3O3A A;  1C16 A;  1U58 A;  3LN5 A;  3FT2 A;  2VLK A;  1S7T A;  2CIK A;  1T7Z A;  5GSR A;  1KPR A;  3SDA A;  1HOC A;  4QRU A;  1T22 A;  3BH8 A;  3LV3 A;  1ZVS A;  3GMR A;  4UQ3 A;  2X4O A;  1DUY A;  3TBW A;  4X6F A;  4NO5 A;  4V3D B;  5AD0 A;  4LCW A;  1N5A A;  5C0E A;  2NX5 A;  4JRY A;  4K71 B;  4PGD A;  3KPP A;  1UXS A;  3OXS A;  3OXR A;  1QO3 A;  4PJA A;  1ZHK A;  3W39 A;  5GSV A;  1TMC A;  5IVX A;  3LN4 A;  3MRP A;  1JPG A;  5H94 A;  4L4T A;  4PGB A;  4HV8 A;  1S7W A;  1KJM A;  5EU3 A;  4PR5 A;  1HHK A;  3QFD A;  3GJF A;  4L4V A;  3VXP A;  4G9F A;  4WO4 A;  3TBY A;  5B38 A;  3BW9 A;  3ILP A;  1L8J A;  3FTG A;  3KPN A;  2MHA A;  2UWE A;  1ZHN A;  4U1I A;  1EEY A;  3ECB A;  4FFE X;  1RJZ A;  1X7Q A;  5HHQ A;  4PG2 A;  4QRT A;  1S7R A;  3I6L D;  2PO6 A;  4MXQ A;  1HSB A;  3RL2 A;  5C0J A;  2FIK A;  3KXF A;  1Z5L A;  1QRN A;  3OX8 A;  3VFN A;  3VWK A;  4ZAK A;  4CW1 A;  1KPU A;  1E27 A;  3BZF A;  3CC5 A;  3GSV A;  3V5D A;  3QUY A;  2VE6 A;  3I6G A;  4EUP A;  2GIT A;  4F7T A;  5E8N A;  3MGO A;  3GMN A;  4U1H A;  3SDX A;  1I7U A;  4WWK C;  5IB2 A;  1M05 A;  3FQX A;  5IND A;  5HGA A;  1ED3 A;  2RFX A;  3MRR A;  3DX8 A;  3P4M A;  4MQ7 A;  3VFW A;  5IB1 A;  3M1B A;  3QI9 A;  1KPV A;  3P4N A;  4PRI A;  2FYY A;  3JTT A;  3H9H A;  2BSR A;  1B0R A;  5D7I A;  4G59 A;  3TO4 A;  3MRM A;  3HPJ A;  4QRP A;  3HE6 A;  3L3J A;  4GUP A;  1DDH A;  5DEF A;  2AK4 A;  3TZV C;  4IHO A;  3BUY A;  1LQV A;  5SWZ A;  4PV8 A;  3WS3 A;  4PGE A;  1T1X A;  1P1Z A;  3BP4 A;  3QQ3 A;  5BRZ A;  3GSU A;  3L3K A;  4PJE A;  5FKP A;  2BVO A;  3ARE A;  1FO0 H;  4LHU A;  1LD9 A;  3KPS A;  4Z78 A;  1G6R H;  3GMQ A;  1BQH A;  5C09 A;  4NNY A;  1FG2 A;  3SDD A;  3CH1 A;  3GMM A;  2V2X A;  3E2H A;  1B3J A;  2X4R A;  4ELM A;  4PDC E;  4ZUT A;  3O3D A;  4Y4H A;  3X13 A;  1S9X A;  1EFX A;  2H6P A;  3PWP A;  1T20 A;  3MA7 A;  3UTT A;  5F1N A;  3RWC A;  4MNQ A;  5E8O A;  4N0F A;  3GMO A;  1RK0 A;  3SJV A;  4G8G A;  3AU1 A;  4U1L A;  5EOT A;  3QFJ A;  3S6C A;  4PRP A;  2BVQ A;  3TN0 A;  5C0I A;  5MER A;  5F7D A;  1W0V A;  5D2N A;  5J6H A;  4V3E B;  1T7Y A;  3FOM A;  3HG1 A;  2OL3 H;  3MRL A;  4L8S C;  4L3C A;  4PJD A;  3LKO A;  1AKJ A;  4N5E A;  2GJ6 A;  5L2J A;  1G7Q A;  4X6C A;  3RWH A;  1XR9 A;  2ESV A;  3FQN A;  3L3H A;  3VFT A;  4EI5 A;  3MRN A;  1I1Y A;  5F9J A;  3L9R A;  1NAM H;  3DBX A;  1LEK A;  2F74 A;  4L8B A;  3TBS A;  4CVX A;  1QEW A;  4GKN A;  1MI5 A;  2GAZ A;  3BEW A;  5L2K A;  4NQC A;  1RK1 A;  4JFQ A;  4D0D A;  1DE4 A;  3MRD A;  1ZS8 A;  1N2R A;  1WBY A;  3MRQ A;  3RGV C;  3QUK A;  1AGE A;  4MJ6 A;  4JFP A;  3V5K A;  4PJC A;  3L3D A;  3MRB A;  3KPO A;  2AXF A;  3GSW A;  3H7B A;  3KWW A;  1FZJ A;  4U1S A;  4WJ5 A;  5IEK A;  3ROO A;  5SWS A;  3VFV A;  2X70 A;  3E6H A;  4U6Y A;  3BZE A;  3PWU A;  3BH9 A;  2PYE A;  1YN7 A;  1FZK A;  5EFI A;  1CG9 A;  3CVH A;  3MV7 A;  4JFF A;  4HUU A;  3W0W A;  1I1A A;  3X12 A;  4O2E A;  2C7U A;  3RWD A;  3C9N A;  4ONO A;  5IB3 A;  3G08 A;  3O9W A;  4LNR A;  4D0B A;  2BVP A;  3FQU A;  3MV8 A;  4PP8 C;  3O3E A;  5EU4 A;  5J1A A;  3RWG A;  5D7J C;  4U1K A;  4F7M A;  1AGB A;  1JUF A;  1HHI A;  2AXG A;  4E0R A;  3ARD A;  4PJ5 A;  2E7L E;  3GSX A;  1LEG A;  2FZ3 A;  3CDG A;  4IIQ C;  1SYS A;  1UQS A;  4PGC A;  4N0U A;  3RWE A;  1W72 A;  3T8X A;  5D2L A;  1JPF A;  1ZSD A;  5EO0 A;  5JHD A;  3MRI A;  2V2W A;  3GSQ A;  4MX7 A;  4NT6 A;  4WDI A;  3GML A;  3VXO A;  3QUZ A;  3VXM A;  3REW A;  4D0C A;  5DDH A;  5BJT A;  5HHP A;  3SPV A;  5HGD A;  1YN6 A;  1KJ3 H;  2X4S A;  4QOK A;  5EU5 A;  2VAA A;  5FDW A;  2AKR A;  3TPU E;  3UPR A;  4L3E A;  1JGE A;  3TA3 A;  3PWV A;  4N8V A;  3DX6 A;  2FWO A;  2FO4 A;  3HAE A;  2ZSW A;  4JRX A; 
#chains in the Genus database with same CATH topology
 3P9L A;  1S7V A;  4PRB A;  4PJB A;  3RZC A;  1FFO A;  1GZP A;  4IRS A;  2X4U A;  5C0B A;  4G8I A;  1T1Y A;  4WU5 A;  1T1Z A;  3L3G A;  2GT9 A;  4PJH A;  4Y2D A;  3FQT A;  1MWA H;  5IM7 A;  1KJV A;  5INC A;  5E8P A;  4HS3 A;  5EO1 A;  4PJX A;  4F7C A;  1ZAG A;  2BNR A;  3ARF A;  4NQE A;  1LK2 A;  3ARB A;  4PJI A;  3BHB A;  3UBX A;  2HN7 A;  3JTS A;  1OGA A;  1AGD A;  1AGC A;  3MRJ A;  4U1N A;  5C0D A;  4Z77 A;  3VFO A;  3DXA A;  3ROL A;  5D7L A;  4E5X A;  4G42 A;  3D2U A;  4PRN A;  4I48 A;  1KCG C;  5HYJ A;  2CKB H;  3U0P A;  4PG9 A;  3VWJ A;  5MEO A;  5HHO A;  1A1N A;  2Q7Y A;  3KPL A;  1VAC A;  2H26 A;  4LCC C;  4MJ5 A;  1S7U A;  3FRU A;  1T21 A;  4PJ8 A;  5J6G A;  2IA1 A;  4LCY A;  3VRJ A;  1S7X A;  1TVH A;  3FT3 A;  4HWZ A;  5E9D A;  4MS8 A;  1S7S A;  4ZUW A;  1K5N A;  1OF2 A;  1MHE A;  2P5W A;  3IXA A;  4Z76 A;  1CE6 A;  5EUO A;  5C07 A;  1S9Y A;  4L29 A;  3GSR A;  3ARG A;  3E6F A;  2HJL A;  4HX1 A;  5HHM A;  1VGK A;  2NYK A;  4NO2 A;  2CLR A;  3BWA A;  1QLF A;  1BZ9 A;  1FZM A;  4QRS A;  4IRJ A;  4MJI A;  5C0F A;  1XR8 A;  3BP7 A;  3I6K A;  1S7Q A;  1DUZ A;  1IM9 A;  1MHC A;  1KTL A;  3V5H A;  2OI9 A;  4NNX A;  3GMP A;  1AO7 A;  3M17 A;  1RJY A;  3RL1 A;  4G43 A;  3TVM A;  4NO3 A;  3RUG A;  1TVB A;  3TBT A;  4MVB A;  3FQW A;  1SYV A;  2BSS A;  4XXC A;  3IT8 D;  3KPR A;  2VAB A;  3GSO A;  4K7F A;  3RWJ A;  2ZOK A;  4F7P A;  4NHU E;  3SCM A;  3ERY A;  5C9J A;  5C0G A;  1INQ A;  3KPQ A;  2YPL A;  3FOL A;  2YEZ A;  5D5M A;  3DX7 A;  5HGB A;  1T7W A;  3I0T A;  5IB4 A;  4WU7 A;  4NQV A;  2CII A;  3MRG A;  1ZT4 A;  3CPL A;  3B6S A;  3QQ4 A;  3WS6 A;  3BVN A;  3PWJ A;  3PWL A;  4PRD A;  3D3V A;  3MRH A;  3P9M A;  1QQD A;  2J8U A;  2VLJ A;  4HUX A;  5B39 A;  1EEZ A;  2GTZ A;  1NAN H;  4QRQ A;  1K8D A;  1ZT1 A;  1YPZ A;  4JQX A;  4U6X A;  1G7P A;  2CLV A;  3MRK A;  1P7Q A;  3B3I A;  3P4O A;  1HHH A;  4O2F A;  1VAD A;  3VFM A;  5E6I C;  3VFR A;  3LKP A;  5MEP A;  1KJ2 H;  3KPM A;  1PQZ A;  2GTW A;  3MRF A;  1JF1 A;  3RTQ A;  3VFP A;  4NQD A;  1T1W A;  3ILQ C;  1T7X A;  1XZ0 A;  3MYJ A;  4N0C A;  1XH3 A;  4WUU A;  3SDC A;  2X4Q A;  3L3I A;  1A9E A;  2HJK A;  3MV9 A;  3PWN A;  5BXF A;  1FFP A;  1T80 A;  5F1I A;  3MRO A;  3T1F A;  2X4P A;  3P77 A;  1T7V A;  3CZF A;  1R3H A;  3E3Q A;  1ONQ A;  4UQ2 A;  1ZHL A;  1HHJ A;  3LKS A;  1A6Z A;  2GUO A;  5EU6 A;  3LKN A;  4F7E A;  4APQ A;  4MNG A;  3TO2 A;  3VXR A;  2CLZ A;  2BST A;  2ZOL A;  1I7R A;  1JGD A;  3SKO A;  1QVO A;  4Y4F A;  3WLB A;  3DTX A;  3QDM A;  4G9D A;  1W0W A;  5SWQ A;  3RWI A;  3QDJ A;  3UTS A;  3WL9 A;  4EN3 C;  4G59 C;  3D25 A;  2X4T A;  4Y16 A;  1I1F A;  3HLA A;  4JFO A;  1OGT A;  3SKM A;  1ZT7 A;  3QDG A;  5IB5 A;  1N3N A;  4X6E A;  5HHN A;  4HUV A;  3QEQ A;  1A1O A;  2P5E A;  3HUJ A;  4ZUV A;  4PRE A;  3C8K A;  2VLL A;  1JHT A;  1YDP A;  4JFE A;  4PJG A;  5HGH A;  2HLA A;  1BII A;  2NW3 A;  4BKW A;  1T0N A;  2VLR A;  4X6D A;  2YPK A;  3MGT A;  4ZUS A;  3TID A;  1AGF A;  2AV1 A;  3VRI A;  1JFM A;  3VJ6 A;  1UXW A;  5DEG A;  1N59 A;  3FFC A;  5C0C A;  5IEH A;  3OV6 A;  4I4W A;  4PV9 A;  3VCL A;  1WBX A;  3TBV A;  4U1M A;  4Y4K A;  1LP9 A;  3BGM A;  4PRA A;  5BS0 A;  3BEV A;  1M6O A;  1S8D A;  4ZUU A;  5ENW A;  4L8C A;  2XFX A;  3LKQ A;  1HYR C;  2BCK A;  4PJF A;  3PAB A;  3VXS A;  3BXN A;  2JCC A;  2F53 A;  1A9B A;  3O8X A;  1S9W A;  3X11 A;  2X4N A;  3FON A;  3FT4 A;  3JVG A;  1I7T A;  3AM8 A;  1QR1 A;  5ISZ A;  3P73 A;  1BD2 A;  3CCH A;  1JE6 A;  3MRC A;  3X14 A;  3ES6 A;  3MRE A;  2DYP A;  2D31 A;  3DMM A;  3PQY A;  3TJH A;  3GIV A;  5ACZ A;  3TF7 A;  4L8D A;  1E28 A;  1I4F A;  1Q94 A;  3HCV A;  3O3B A;  3QUL A;  2WY3 A;  3QUX A;  2F54 A;  3BO8 A;  4JQV A;  4PJ9 A;  5IRO A;  3RWF A;  1LDP H;  3TFK A;  3VFU A;  5MEQ A;  4HUW A;  4QRR A;  1IM3 A;  1KBG H;  3HE7 A;  1OSZ A;  1QSE A;  4NQX A;  4WW2 C;  1NEZ A;  2XPG A;  3FQR A;  1CD1 A;  3JTC A;  3KYO A;  4NO0 A;  5C0A A;  3TIE A;  1A1M A;  3VH8 A;  3VXU A;  1WBZ A;  4PRH A;  4NSK A;  4PJ7 A;  3WUW A;  5E00 A;  5FA3 A;  4GKS A;  1GZQ A;  4HKJ A;  4U1J A;  3UTQ A;  4CVZ A;  3KYN A;  1FZO A;  1P4L A;  2AV7 A;  3VFS A;  4L9L C;  1HSA A;  2ZSV A;  1B0G A;  5D9S A;  1T0M A;  3GSN H;  3KLA A;  3LKR A;  4O2C A;  1QSF A;  3O4L A;  4ZFZ A;  1EXU A;  3D18 A;  4JFD A;  4S0U C;  1ZHB A;  3D39 A;  2A83 A;  4FTV A;  2BNQ A;  3VXN A;  5MEN A;  3MR9 A;  3H9S A;  5FA4 A;  1HHG A;  5C08 A;  1FFN A;  3NFN A;  3QZW A;  3O3A A;  1C16 A;  1U58 A;  3LN5 A;  3FT2 A;  2VLK A;  1S7T A;  2CIK A;  1T7Z A;  5GSR A;  1KPR A;  3SDA A;  1HOC A;  4QRU A;  1T22 A;  3BH8 A;  3LV3 A;  1ZVS A;  3GMR A;  4UQ3 A;  2X4O A;  1DUY A;  3TBW A;  4X6F A;  4NO5 A;  4V3D B;  5AD0 A;  4LCW A;  1N5A A;  5C0E A;  2NX5 A;  4JRY A;  4K71 B;  4PGD A;  3KPP A;  1UXS A;  3OXS A;  3OXR A;  1QO3 A;  4PJA A;  1ZHK A;  3W39 A;  5GSV A;  1TMC A;  5IVX A;  3LN4 A;  3MRP A;  1JPG A;  5H94 A;  4L4T A;  4PGB A;  4HV8 A;  1S7W A;  1KJM A;  5EU3 A;  4PR5 A;  1HHK A;  3QFD A;  3GJF A;  4L4V A;  3VXP A;  4G9F A;  4WO4 A;  3TBY A;  5B38 A;  3BW9 A;  3ILP A;  1L8J A;  3FTG A;  3KPN A;  2MHA A;  2UWE A;  1ZHN A;  4U1I A;  1EEY A;  3ECB A;  4FFE X;  1RJZ A;  1X7Q A;  5HHQ A;  4PG2 A;  4QRT A;  1S7R A;  3I6L D;  2PO6 A;  4MXQ A;  1HSB A;  3RL2 A;  5C0J A;  2FIK A;  3KXF A;  1Z5L A;  1QRN A;  3OX8 A;  3VFN A;  3VWK A;  4ZAK A;  4CW1 A;  1KPU A;  1E27 A;  3BZF A;  3CC5 A;  3GSV A;  3V5D A;  3QUY A;  2VE6 A;  3I6G A;  4EUP A;  2GIT A;  4F7T A;  5E8N A;  3MGO A;  3GMN A;  4U1H A;  3SDX A;  1I7U A;  4WWK C;  5IB2 A;  1M05 A;  3FQX A;  5IND A;  5HGA A;  1ED3 A;  2RFX A;  3MRR A;  3DX8 A;  3P4M A;  4MQ7 A;  3VFW A;  5IB1 A;  3M1B A;  3QI9 A;  1KPV A;  3P4N A;  4PRI A;  2FYY A;  3JTT A;  3H9H A;  2BSR A;  1B0R A;  5D7I A;  4G59 A;  3TO4 A;  3MRM A;  3HPJ A;  4QRP A;  3HE6 A;  3L3J A;  4GUP A;  1DDH A;  5DEF A;  2AK4 A;  3TZV C;  4IHO A;  3BUY A;  1LQV A;  5SWZ A;  4PV8 A;  3WS3 A;  4PGE A;  1T1X A;  1P1Z A;  3BP4 A;  3QQ3 A;  5BRZ A;  3GSU A;  3L3K A;  4PJE A;  5FKP A;  2BVO A;  3ARE A;  1FO0 H;  4LHU A;  1LD9 A;  3KPS A;  4Z78 A;  1G6R H;  3GMQ A;  1BQH A;  5C09 A;  4NNY A;  1FG2 A;  3SDD A;  3CH1 A;  3GMM A;  2V2X A;  3E2H A;  1B3J A;  2X4R A;  4ELM A;  4PDC E;  4ZUT A;  3O3D A;  4Y4H A;  3X13 A;  1S9X A;  1EFX A;  2H6P A;  3PWP A;  1T20 A;  3MA7 A;  3UTT A;  5F1N A;  3RWC A;  4MNQ A;  5E8O A;  4N0F A;  3GMO A;  1RK0 A;  3SJV A;  4G8G A;  3AU1 A;  4U1L A;  5EOT A;  3QFJ A;  3S6C A;  4PRP A;  2BVQ A;  3TN0 A;  2O5N A;  5C0I A;  5MER A;  5F7D A;  1W0V A;  5D2N A;  5J6H A;  4V3E B;  1T7Y A;  3FOM A;  3HG1 A;  2OL3 H;  3MRL A;  4L8S C;  4L3C A;  4PJD A;  3LKO A;  1AKJ A;  4N5E A;  2GJ6 A;  5L2J A;  1G7Q A;  4X6C A;  3RWH A;  1XR9 A;  2ESV A;  3FQN A;  3L3H A;  3VFT A;  4EI5 A;  3MRN A;  1I1Y A;  5F9J A;  3L9R A;  1NAM H;  3DBX A;  1LEK A;  2F74 A;  4L8B A;  3TBS A;  4CVX A;  1QEW A;  4GKN A;  1MI5 A;  2GAZ A;  3BEW A;  5L2K A;  4NQC A;  1RK1 A;  4JFQ A;  4D0D A;  1DE4 A;  3MRD A;  1ZS8 A;  1N2R A;  1WBY A;  3MRQ A;  3RGV C;  3QUK A;  1AGE A;  4MJ6 A;  4JFP A;  3V5K A;  4PJC A;  3L3D A;  3MRB A;  3KPO A;  2AXF A;  3GSW A;  3H7B A;  3KWW A;  1FZJ A;  4U1S A;  4WJ5 A;  5IEK A;  3ROO A;  5SWS A;  3VFV A;  2X70 A;  3E6H A;  4U6Y A;  3BZE A;  3PWU A;  3BH9 A;  2PYE A;  1YN7 A;  1FZK A;  5EFI A;  1CG9 A;  3CVH A;  3MV7 A;  4JFF A;  4HUU A;  3W0W A;  1I1A A;  3X12 A;  4O2E A;  2C7U A;  3RWD A;  3C9N A;  4ONO A;  5IB3 A;  3G08 A;  3O9W A;  4LNR A;  4D0B A;  2BVP A;  3FQU A;  3MV8 A;  4PP8 C;  3O3E A;  5EU4 A;  5J1A A;  3RWG A;  5D7J C;  4U1K A;  4F7M A;  1AGB A;  1JUF A;  1HHI A;  2AXG A;  4E0R A;  3ARD A;  4PJ5 A;  2E7L E;  3GSX A;  1LEG A;  2FZ3 A;  3CDG A;  4IIQ C;  1SYS A;  1UQS A;  4PGC A;  4N0U A;  3RWE A;  1W72 A;  3T8X A;  5D2L A;  1JPF A;  1ZSD A;  5EO0 A;  5JHD A;  3MRI A;  2V2W A;  3GSQ A;  4MX7 A;  4NT6 A;  4WDI A;  3GML A;  3VXO A;  3QUZ A;  3VXM A;  3REW A;  4D0C A;  5DDH A;  5BJT A;  5HHP A;  3SPV A;  5HGD A;  1YN6 A;  1KJ3 H;  2X4S A;  4QOK A;  5EU5 A;  2VAA A;  5FDW A;  2AKR A;  3TPU E;  3UPR A;  4L3E A;  1JGE A;  3TA3 A;  4JO8 A;  3PWV A;  4N8V A;  3DX6 A;  2FWO A;  2FO4 A;  3HAE A;  2ZSW A;  4JRX A; 
#chains in the Genus database with same CATH homology
 3P9L A;  1S7V A;  4PRB A;  4PJB A;  3RZC A;  1FFO A;  1GZP A;  4IRS A;  2X4U A;  5C0B A;  4G8I A;  1T1Y A;  4WU5 A;  1T1Z A;  3L3G A;  2GT9 A;  4PJH A;  4Y2D A;  3FQT A;  1MWA H;  5IM7 A;  1KJV A;  5INC A;  5E8P A;  4HS3 A;  5EO1 A;  4PJX A;  4F7C A;  1ZAG A;  2BNR A;  3ARF A;  4NQE A;  1LK2 A;  3ARB A;  4PJI A;  3BHB A;  3UBX A;  2HN7 A;  3JTS A;  1OGA A;  1AGD A;  1AGC A;  3MRJ A;  4U1N A;  5C0D A;  4Z77 A;  3VFO A;  3DXA A;  3ROL A;  5D7L A;  4E5X A;  4G42 A;  3D2U A;  4PRN A;  4I48 A;  1KCG C;  5HYJ A;  2CKB H;  3U0P A;  4PG9 A;  3VWJ A;  5MEO A;  5HHO A;  1A1N A;  2Q7Y A;  3KPL A;  1VAC A;  2H26 A;  4LCC C;  4MJ5 A;  1S7U A;  3FRU A;  1T21 A;  4PJ8 A;  5J6G A;  4LCY A;  3VRJ A;  1S7X A;  1TVH A;  3FT3 A;  4HWZ A;  5E9D A;  4MS8 A;  1S7S A;  4ZUW A;  1K5N A;  1OF2 A;  1MHE A;  2P5W A;  3IXA A;  4Z76 A;  1CE6 A;  5EUO A;  5C07 A;  1S9Y A;  4L29 A;  3GSR A;  3ARG A;  3E6F A;  2HJL A;  4HX1 A;  5HHM A;  1VGK A;  4NO2 A;  2CLR A;  3BWA A;  1QLF A;  1BZ9 A;  1FZM A;  4QRS A;  4IRJ A;  4MJI A;  5C0F A;  1XR8 A;  3BP7 A;  3I6K A;  1S7Q A;  1DUZ A;  1IM9 A;  1MHC A;  1KTL A;  3V5H A;  2OI9 A;  4NNX A;  3GMP A;  1AO7 A;  3M17 A;  1RJY A;  3RL1 A;  4G43 A;  3TVM A;  4NO3 A;  3RUG A;  1TVB A;  3TBT A;  4MVB A;  3FQW A;  1SYV A;  2BSS A;  4XXC A;  3IT8 D;  3KPR A;  2VAB A;  3GSO A;  4K7F A;  3RWJ A;  2ZOK A;  4F7P A;  4NHU E;  3SCM A;  3ERY A;  5C9J A;  5C0G A;  1INQ A;  3KPQ A;  2YPL A;  3FOL A;  2YEZ A;  5D5M A;  3DX7 A;  5HGB A;  1T7W A;  5IB4 A;  4WU7 A;  4NQV A;  2CII A;  3MRG A;  1ZT4 A;  3CPL A;  3B6S A;  3QQ4 A;  3WS6 A;  3BVN A;  3PWJ A;  3PWL A;  4PRD A;  3D3V A;  3MRH A;  3P9M A;  1QQD A;  2J8U A;  2VLJ A;  4HUX A;  5B39 A;  1EEZ A;  2GTZ A;  1NAN H;  4QRQ A;  1K8D A;  1ZT1 A;  1YPZ A;  4JQX A;  4U6X A;  1G7P A;  2CLV A;  3MRK A;  1P7Q A;  3B3I A;  3P4O A;  1HHH A;  4O2F A;  1VAD A;  3VFM A;  5E6I C;  3VFR A;  3LKP A;  5MEP A;  1KJ2 H;  3KPM A;  1PQZ A;  2GTW A;  3MRF A;  1JF1 A;  3RTQ A;  3VFP A;  4NQD A;  1T1W A;  3ILQ C;  1T7X A;  1XZ0 A;  3MYJ A;  4N0C A;  1XH3 A;  4WUU A;  3SDC A;  2X4Q A;  3L3I A;  1A9E A;  2HJK A;  3MV9 A;  3PWN A;  5BXF A;  1FFP A;  1T80 A;  5F1I A;  3MRO A;  3T1F A;  2X4P A;  3P77 A;  1T7V A;  3CZF A;  1R3H A;  3E3Q A;  1ONQ A;  4UQ2 A;  1ZHL A;  1HHJ A;  3LKS A;  1A6Z A;  2GUO A;  5EU6 A;  3LKN A;  4F7E A;  4APQ A;  4MNG A;  3TO2 A;  3VXR A;  2CLZ A;  2BST A;  2ZOL A;  1I7R A;  1JGD A;  3SKO A;  1QVO A;  4Y4F A;  3WLB A;  3DTX A;  3QDM A;  4G9D A;  1W0W A;  5SWQ A;  3RWI A;  3QDJ A;  3UTS A;  3WL9 A;  4EN3 C;  3D25 A;  2X4T A;  4Y16 A;  1I1F A;  3HLA A;  4JFO A;  1OGT A;  3SKM A;  1ZT7 A;  3QDG A;  5IB5 A;  1N3N A;  4X6E A;  5HHN A;  4HUV A;  3QEQ A;  1A1O A;  2P5E A;  3HUJ A;  4ZUV A;  4PRE A;  3C8K A;  2VLL A;  1JHT A;  1YDP A;  4JFE A;  4PJG A;  5HGH A;  2HLA A;  1BII A;  2NW3 A;  1T0N A;  2VLR A;  4X6D A;  2YPK A;  3MGT A;  4ZUS A;  3TID A;  1AGF A;  2AV1 A;  3VRI A;  1JFM A;  3VJ6 A;  1UXW A;  5DEG A;  1N59 A;  3FFC A;  5C0C A;  5IEH A;  3OV6 A;  4I4W A;  4PV9 A;  3VCL A;  1WBX A;  3TBV A;  4U1M A;  4Y4K A;  1LP9 A;  3BGM A;  4PRA A;  5BS0 A;  3BEV A;  1M6O A;  1S8D A;  4ZUU A;  5ENW A;  4L8C A;  2XFX A;  3LKQ A;  1HYR C;  2BCK A;  4PJF A;  3PAB A;  3VXS A;  3BXN A;  2JCC A;  2F53 A;  1A9B A;  3O8X A;  1S9W A;  3X11 A;  2X4N A;  3FON A;  3FT4 A;  3JVG A;  1I7T A;  3AM8 A;  1QR1 A;  5ISZ A;  3P73 A;  1BD2 A;  3CCH A;  1JE6 A;  3MRC A;  3X14 A;  3ES6 A;  3MRE A;  2DYP A;  2D31 A;  3DMM A;  3PQY A;  3TJH A;  3GIV A;  5ACZ A;  3TF7 A;  4L8D A;  1E28 A;  1I4F A;  1Q94 A;  3HCV A;  3O3B A;  3QUL A;  2WY3 A;  3QUX A;  2F54 A;  3BO8 A;  4JQV A;  4PJ9 A;  5IRO A;  3RWF A;  1LDP H;  3TFK A;  3VFU A;  5MEQ A;  4HUW A;  4QRR A;  1IM3 A;  1KBG H;  3HE7 A;  1OSZ A;  1QSE A;  4NQX A;  4WW2 C;  1NEZ A;  2XPG A;  3FQR A;  1CD1 A;  3JTC A;  3KYO A;  4NO0 A;  5C0A A;  3TIE A;  1A1M A;  3VH8 A;  3VXU A;  1WBZ A;  4PRH A;  4NSK A;  4PJ7 A;  3WUW A;  5E00 A;  5FA3 A;  4GKS A;  1GZQ A;  4HKJ A;  4U1J A;  3UTQ A;  4CVZ A;  3KYN A;  1FZO A;  1P4L A;  2AV7 A;  3VFS A;  4L9L C;  1HSA A;  2ZSV A;  1B0G A;  5D9S A;  1T0M A;  3GSN H;  3KLA A;  3LKR A;  4O2C A;  1QSF A;  3O4L A;  4ZFZ A;  1EXU A;  3D18 A;  4JFD A;  4S0U C;  1ZHB A;  3D39 A;  2A83 A;  4FTV A;  2BNQ A;  3VXN A;  5MEN A;  3MR9 A;  3H9S A;  5FA4 A;  1HHG A;  5C08 A;  1FFN A;  3NFN A;  3QZW A;  3O3A A;  1C16 A;  1U58 A;  3LN5 A;  3FT2 A;  2VLK A;  1S7T A;  2CIK A;  1T7Z A;  5GSR A;  1KPR A;  3SDA A;  1HOC A;  4QRU A;  1T22 A;  3BH8 A;  3LV3 A;  1ZVS A;  3GMR A;  4UQ3 A;  2X4O A;  1DUY A;  3TBW A;  4X6F A;  4NO5 A;  4V3D B;  5AD0 A;  4LCW A;  1N5A A;  5C0E A;  2NX5 A;  4JRY A;  4K71 B;  4PGD A;  3KPP A;  1UXS A;  3OXS A;  3OXR A;  1QO3 A;  4PJA A;  1ZHK A;  3W39 A;  5GSV A;  1TMC A;  5IVX A;  3LN4 A;  3MRP A;  1JPG A;  5H94 A;  4L4T A;  4PGB A;  4HV8 A;  1S7W A;  1KJM A;  5EU3 A;  4PR5 A;  1HHK A;  3QFD A;  3GJF A;  4L4V A;  3VXP A;  4G9F A;  4WO4 A;  3TBY A;  5B38 A;  3BW9 A;  3ILP A;  1L8J A;  3FTG A;  3KPN A;  2MHA A;  2UWE A;  1ZHN A;  4U1I A;  1EEY A;  3ECB A;  4FFE X;  1RJZ A;  1X7Q A;  5HHQ A;  4PG2 A;  4QRT A;  1S7R A;  3I6L D;  2PO6 A;  4MXQ A;  1HSB A;  3RL2 A;  5C0J A;  2FIK A;  3KXF A;  1Z5L A;  1QRN A;  3OX8 A;  3VFN A;  3VWK A;  4ZAK A;  4CW1 A;  1KPU A;  1E27 A;  3BZF A;  3CC5 A;  3GSV A;  3V5D A;  3QUY A;  2VE6 A;  3I6G A;  4EUP A;  2GIT A;  4F7T A;  5E8N A;  3MGO A;  3GMN A;  4U1H A;  3SDX A;  1I7U A;  4WWK C;  5IB2 A;  1M05 A;  3FQX A;  5IND A;  5HGA A;  1ED3 A;  2RFX A;  3MRR A;  3DX8 A;  3P4M A;  4MQ7 A;  3VFW A;  5IB1 A;  3M1B A;  3QI9 A;  1KPV A;  3P4N A;  4PRI A;  2FYY A;  3JTT A;  3H9H A;  2BSR A;  1B0R A;  5D7I A;  4G59 A;  3TO4 A;  3MRM A;  3HPJ A;  4QRP A;  3HE6 A;  3L3J A;  4GUP A;  1DDH A;  5DEF A;  2AK4 A;  3TZV C;  4IHO A;  3BUY A;  1LQV A;  5SWZ A;  4PV8 A;  3WS3 A;  4PGE A;  1T1X A;  1P1Z A;  3BP4 A;  3QQ3 A;  5BRZ A;  3GSU A;  3L3K A;  4PJE A;  5FKP A;  2BVO A;  3ARE A;  1FO0 H;  4LHU A;  1LD9 A;  3KPS A;  4Z78 A;  1G6R H;  3GMQ A;  1BQH A;  5C09 A;  4NNY A;  1FG2 A;  3SDD A;  3CH1 A;  3GMM A;  2V2X A;  3E2H A;  1B3J A;  2X4R A;  4ELM A;  4PDC E;  4ZUT A;  3O3D A;  4Y4H A;  3X13 A;  1S9X A;  1EFX A;  2H6P A;  3PWP A;  1T20 A;  3MA7 A;  3UTT A;  5F1N A;  3RWC A;  4MNQ A;  5E8O A;  4N0F A;  3GMO A;  1RK0 A;  3SJV A;  4G8G A;  3AU1 A;  4U1L A;  5EOT A;  3QFJ A;  3S6C A;  4PRP A;  2BVQ A;  3TN0 A;  5C0I A;  5MER A;  5F7D A;  1W0V A;  5D2N A;  5J6H A;  4V3E B;  1T7Y A;  3FOM A;  3HG1 A;  2OL3 H;  3MRL A;  4L8S C;  4L3C A;  4PJD A;  3LKO A;  1AKJ A;  4N5E A;  2GJ6 A;  5L2J A;  1G7Q A;  4X6C A;  3RWH A;  1XR9 A;  2ESV A;  3FQN A;  3L3H A;  3VFT A;  4EI5 A;  3MRN A;  1I1Y A;  5F9J A;  3L9R A;  1NAM H;  3DBX A;  1LEK A;  2F74 A;  4L8B A;  3TBS A;  4CVX A;  1QEW A;  4GKN A;  1MI5 A;  2GAZ A;  3BEW A;  5L2K A;  4NQC A;  1RK1 A;  4JFQ A;  4D0D A;  1DE4 A;  3MRD A;  1ZS8 A;  1N2R A;  1WBY A;  3MRQ A;  3RGV C;  3QUK A;  1AGE A;  4MJ6 A;  4JFP A;  3V5K A;  4PJC A;  3L3D A;  3MRB A;  3KPO A;  2AXF A;  3GSW A;  3H7B A;  3KWW A;  1FZJ A;  4U1S A;  4WJ5 A;  5IEK A;  3ROO A;  5SWS A;  3VFV A;  2X70 A;  3E6H A;  4U6Y A;  3BZE A;  3PWU A;  3BH9 A;  2PYE A;  1YN7 A;  1FZK A;  5EFI A;  1CG9 A;  3CVH A;  3MV7 A;  4JFF A;  4HUU A;  3W0W A;  1I1A A;  3X12 A;  4O2E A;  2C7U A;  3RWD A;  3C9N A;  4ONO A;  5IB3 A;  3G08 A;  3O9W A;  4LNR A;  4D0B A;  2BVP A;  3FQU A;  3MV8 A;  4PP8 C;  3O3E A;  5EU4 A;  5J1A A;  3RWG A;  5D7J C;  4U1K A;  4F7M A;  1AGB A;  1JUF A;  1HHI A;  2AXG A;  4E0R A;  3ARD A;  4PJ5 A;  2E7L E;  3GSX A;  1LEG A;  2FZ3 A;  3CDG A;  4IIQ C;  1SYS A;  1UQS A;  4PGC A;  4N0U A;  3RWE A;  1W72 A;  3T8X A;  5D2L A;  1JPF A;  1ZSD A;  5EO0 A;  5JHD A;  3MRI A;  2V2W A;  3GSQ A;  4MX7 A;  4NT6 A;  4WDI A;  3GML A;  3VXO A;  3QUZ A;  3VXM A;  3REW A;  4D0C A;  5DDH A;  5BJT A;  5HHP A;  3SPV A;  5HGD A;  1YN6 A;  1KJ3 H;  2X4S A;  4QOK A;  5EU5 A;  2VAA A;  5FDW A;  2AKR A;  3TPU E;  3UPR A;  4L3E A;  1JGE A;  3TA3 A;  3PWV A;  4N8V A;  3DX6 A;  2FWO A;  2FO4 A;  3HAE A;  2ZSW A;  4JRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...