4N5EA

42f3 tcr pcpa12/h-2ld complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
174
structure length
174
Chain Sequence
b'PHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQIAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQWMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 42F3 alpha VmCh
publication title Structural interplay between germline interactions and adaptive recognition determines the bandwidth of TCR-peptide-MHC cross-reactivity.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 52
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2013-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4n5eA00
4HKJA 5EUOA 5DEFA 1HOCA 4PJ8A 4X6EA 3SKMA 2ZSWA 2DYPA 3X13A 3ARDA 1W0WA 5SWZA 3JTSA 1I7UA 5IB4A 4ZUTA 3I6KA 1S9XA 4U1MA 3FQUA 4U1HA 1KBGH 1W72A 4LNRA 3T1FA 1NAMH 4G8GA 3BO8A 3AREA 2X4PA 3BZFA 4MNGA 4MNQA 3U0PA 5E8PA 2VE6A 1TVBA 5MEQA 3MRQA 1ZT7A 5C08A 3KPMA 4JFFA 3GSRA 4GKNA 3VFNA 2FYYA 3GMLA 3VJ6A 5AD0A 1DUZA 1ED3A 3MRPA 4QRRA 1XR8A 3FT4A 4PGCA 3TBSA 1E28A 3ROOA 3PWVA 2FIKA 4PRAA 1W0VA 4L9LC 3D3VA 5HHQA 3L9RA 3MRDA 3ECBA 5IM7A 1LDPH 1DDHA 3PWNA 1EFXA 3MRJA 3TF7A 1ZVSA 3KPOA 4S0UC 1T0MA 1XZ0A 4L4TA 5FA4A 5HGDA 1K5NA 3V5KA 4Y2DA 3BH8A 3MRGA 4PRDA 4K7FA 1S7QA 1R3HA 2CLVA 3MREA 3TBWA 3O3EA 1C16A 1VGKA 3E3QA 3D2UA 3KPQA 4U1LA 1A6ZA 3ARFA 3P9MA 1A9BA 3GSNH 3LKSA 2BVQA 5H94A 3RWDA 3GSQA 5GSVA 3SPVA 3P4NA 2H6PA 1EEZA 1QO3A 3GSWA 3FFCA 4U6YA 5C09A 3VFTA 3ILPA 2ZSVA 3H7BA 1CG9A 4LCYA 1JGEA 2BSSA 2X4SA 1XR9A 3O3AA 5D2NA 3BW9A 1ZS8A 1T20A 4NQVA 4WDIA 1HHGA 1ZHNA 3D25A 3VH8A 3KPSA 3FONA 2RFXA 3FT2A 3RZCA 1MWAH 1YDPA 3ARBA 1OF2A 3P73A 3TO2A 3SKOA 1LK2A 2UWEA 1JPFA 5GSRA 4ZFZA 4L8SC 4JFDA 1FFOA 2HJKA 3BWAA 3ROLA 1Z5LA 3VXOA 3C8KA 1N3NA 1LQVA 1U58A 3KLAA 3VRJA 5MEOA 1S7SA 2X4QA 4HUWA 3VFWA 4PRHA 3KPRA 3FQXA 4L8DA 3VRIA 1KJVA 4MQ7A 5EU4A 3QDJA 4JFPA 1T80A 3SJVA 2ZOLA 4MJ5A 1JGDA 2GTWA 3ARGA 3MR9A 1QRNA 4NNYA 1E27A 3PQYA 3ERYA 3MV8A 4G9DA 1KJ2H 4PGBA 2FWOA 1JF1A 2CKBH 2X4RA 4N0FA 5HHNA 1T7WA 4EI5A 3JTTA 3OXRA 3MRNA 3OXSA 3WUWA 2FO4A 5MERA 3GMRA 2GJ6A 3BP7A 3PWLA 1S7XA 2PYEA 3QUZA 5C0GA 2VLLA 3P77A 1GZQA 1HHHA 3UPRA 3TBYA 3RL2A 1FG2A 5HGHA 4F7MA 2VLRA 3O3DA 4MJIA 3FOLA 3O8XA 4EN3C 4EUPA 2P5WA 4N5EA 3LKNA 1ONQA 3ILQC 3E6HA 2VABA 3GMOA 4NNXA 3TBTA 1I1AA 4IRSA 4FTVA 1B0GA 4PDCE 4ZAKA 1KPUA 1RJZA 1KPRA 1VACA 2AK4A 2YPKA 1HHJA 4PJ7A 4PV8A 2OL3H 3NFNA 2CIKA 4O2CA 4U1KA 4PJFA 4V3EB 4U1IA 1I7TA 5L2JA 3DTXA 3TO4A 1M05A 2X4NA 3PABA 4O2FA 5FA3A 1KPVA 3H9SA 1KJMA 1B0RA 4NQCA 3S6CA 5IB5A 3FTGA 2BVOA 1QLFA 2VAAA 4Y4HA 4NO0A 3RWJA 3QDGA 1JHTA 1QSFA 3TJHA 2VLJA 3X14A 4Z77A 3DX6A 3VFVA 2WY3A 2D31A 2J8UA 1I1YA 3MV7A 3MA7A 2AV1A 3FQRA 4HS3A 4V3DB 4Y4FA 5IB2A 1RJYA 3FQNA 4JFOA 5F1IA 5ISZA 3SDXA 3UTQA 2BSRA 4ZUSA 1BQHA 1S7RA 1YN6A 3OV6A 5ACZA 5IEHA 4JRXA 1P4LA 5HGAA 3TZVC 4L3CA 1I1FA 2AXFA 5IB3A 4IRJA 4PREA 1HSAA 4NO5A 2CLRA 4PP8C 5BJTA 1YN7A 1FO0H 4LCWA 3MRLA 1XH3A 4PRBA 1QQDA 4PRNA 1VADA 3D39A 3LKPA 3GMNA 5D2LA 5ENWA 1HYRC 1A1NA 3QUXA 3RWFA 1TMCA 1A9EA 3SCMA 4PR5A 4G9FA 5E8NA 3FQTA 1ZT4A 2GAZA 4LCCC 4QOKA 1T21A 4D0BA 4MVBA 3ES6A 1LEKA 4E5XA 1K8DA 1I4FA 4PGEA 1QSEA 1S7TA 3O3BA 1ZT1A 3FOMA 4NO2A 5D5MA 1BIIA 1JE6A 5C0EA 4PJBA 1UXSA 3DX8A 3SDAA 5HHMA 1AKJA 3GMPA 4PJEA 2YPLA 3MRBA 4UQ3A 3B6SA 3QULA 3GIVA 2AV7A 3TBVA 1A1OA 3VFSA 5EU3A 3LKRA 2NX5A 2CLZA 2GUOA 1UXWA 3GSUA 4G8IA 3MRKA 3AU1A 4JFQA 4NQXA 2A83A 3M17A 3FT3A 3P9LA 4PJGA 3SDCA 2ZOKA 1LD9A 1T1ZA 4NSKA 5D7LA 4MJ6A 3KYNA 2CIIA 3PWPA 1P1ZA 3VWKA 3CC5A 4HUUA 4PG2A 2X70A 3X11A 5IEKA 3UTTA 3MRRA 5MEPA 2GITA 3IXAA 4PV9A 1WBZA 2VLKA 3VXRA 3DMMA 3MRMA 5EO0A 1Q94A 5C0FA 1FZKA 1MHCA 3VFMA 1RK0A 1ZHKA 3FRUA 1FZJA 4JRYA 5C0DA 2GTZA 3PWJA 3QQ3A 5IB1A 4WO4A 1DE4A 4U1NA 4HV8A 4CVXA 4F7EA 2X4OA 3HG1A 1ZHBA 3VXMA 3GSVA 5J6GA 3GSXA 4NQEA 4PJ9A 4UQ2A 3FQWA 3L3KA 2ESVA 4FFEX 4D0DA 5BS0A 4L3EA 3TPUE 4PJ5A 2F53A 3L3GA 3I6LD 3MYJA 2BNRA 2F54A 3VFPA 1KJ3H 1L8JA 3VXPA 4GUPA 3D18A 3UBXA 3KPPA 4F7TA 2BSTA 1G7PA 4HUXA 1LP9A 1KCGC 1N59A 3LV3A 1G6RH 1MI5A 4PJXA 3G08A 2AKRA 4L8CA 3QEQA 4PJAA 5F1NA 3O4LA 4NHUE 1AGEA 1WBXA 1T7YA 2V2WA 2XFXA 1T7XA 5E00A 1YPZA 4NO3A 1AGDA 1BD2A 3RL1A 3QFJA 3TVMA 3CVHA 1ZSDA 1CE6A 5EFIA 3RWEA 1G7QA 3BUYA 3BH9A 3I6GA 3O9WA 3VFOA 2BVPA 3L3JA 3SDDA 3WS3A 5C0IA 1T0NA 3JVGA 3REWA 1S7VA 2YEZA 2HLAA 3DXAA 3QDMA 3TA3A 5C07A 4JQVA 1SYSA 3HAEA 4ZUUA 3VWJA 3WLBA 1QR1A 3RWCA 3QI9A 4ZUWA 4PJCA 3RGVC 4I4WA 3KPLA 5DDHA 5E9DA 4APQA 1T1WA 3W0WA 1EEYA 3PWUA 1IM9A 4G43A 5D7IA 5J6HA 4L8BA 3QZWA 4WW2C 5FKPA 1S9YA 3JTCA 5INCA 1FFPA 3RTQA 4WWKC 4X6FA 4CW1A 3TIDA 1BZ9A 5SWQA 4U6XA 5C0AA 4QRTA 2X4TA 4NT6A 5EOTA 5IROA 3QQ4A 1AGFA 3KWWA 4IIQC 3TIEA 4Z76A 1I7RA 5C9JA 3HLAA 2PO6A 3RWGA 5B38A 1AO7A 3DX7A 3WS6A 3P4MA 1OGTA 3BZEA 3BVNA 3GSOA 1KTLA 3VFUA 3CDGA 3KXFA 1INQA 2P5EA 3CZFA 4PJHA 2BCKA 5E8OA 5F7DA 4QRSA 5JHDA 3T8XA 3BEWA 3LKOA 3VXUA 4ONOA 1RK1A 5SWSA 4IHOA 1ZAGA 4JFEA 4HX1A 1P7QA 1AGCA 4WUUA 3E2HA 3V5HA 1FZOA 1SYVA 4HUVA 3HE6A 2C7UA 5C0CA 4WJ5A 3OX8A 5EO1A 4G42A 4N0UA 3TFKA 2JCCA 1S7WA 3BGMA 3BP4A 2GT9A 3HE7A 3X12A 1HHIA 1HHKA 4K71B 3QUKA 4PJIA 3KPNA 1T7VA 1FZMA 1IM3A 3RWHA 5HHPA 1A1MA 5BXFA 3GJFA 3AM8A 4N8VA 4X6DA 4ZUVA 4PJDA 3MRHA 3W39A 3QUYA 1JPGA 1M6OA 1JFMA 1T7ZA 4E0RA 5L2KA 1UQSA 3E6FA 3GMQA 4D0CA 1N2RA 4PGDA 4QRQA 1ZHLA 2HN7A 1PQZA 1S7UA 1QVOA 1WBYA 1OGAA 3KYOA 1FFNA 1CD1A 1T1XA 2F74A 3MRFA 4MS8A 4N0CA 3VXSA 1QEWA 1S8DA 4ELMA 5EU6A 1NEZA 4MXQA 4X6CA 4QRUA 2V2XA 3UTSA 4PG9A 2NW3A 3B3IA 1AGBA 3DBXA 3M1BA 4GKSA 2OI9A 5DEGA 3L3IA 3QFDA 5HGBA 1JUFA 4WU7A 2X4UA 4PRPA 5D9SA 2BNQA 4Y16A 1HSBA 5C0JA 3LKQA 1NANH 5EU5A 1OSZA 4F7PA 1T22A 4Y4KA 3V5DA 1EXUA 3BHBA 5MENA 1X7QA 1N5AA 3MV9A 1MHEA 5D7JC 4I48A 4QRPA 4Z78A 4MX7A 3IT8D 3P4OA 2MHAA 4O2EA 2Q7YA 3MGTA 5J1AA 2FZ3A 5BRZA 4LHUA 1LEGA 3MROA 5C0BA 3BXNA 4NQDA 2H26A 3HCVA 1S9WA 5IVXA 3BEVA 3GMMA 5E6IC 4U1JA 4WU5A 3WL9A 3LN5A 3CPLA 3RUGA 3VXNA 5B39A 3L3DA 3MRIA 4G59A 4U1SA 3C9NA 4PRIA 5HYJA 4L29A 2HJLA 4JQXA 4F7CA 3HUJA 2XPGA 1GZPA 5HHOA 3LN4A 1B3JA 2E7LE 3CH1A 1T1YA 4L4VA 4XXCA 1TVHA 4CVZA 3VFRA 3HPJA 3CCHA 4HWZA 3MRCA 3H9HA 1DUYA 2AXGA 3RWIA 5F9JA 3VCLA 5INDA 3MGOA 3TN0A 5FDWA 3L3HA
chains in the Genus database with same CATH superfamily
4HKJA 5EUOA 5DEFA 1HOCA 4PJ8A 4X6EA 3SKMA 2ZSWA 2DYPA 3X13A 3ARDA 1W0WA 5SWZA 3JTSA 1I7UA 5IB4A 4ZUTA 3I6KA 1S9XA 4U1MA 3FQUA 4U1HA 1KBGH 1W72A 4LNRA 4G59C 3T1FA 1NAMH 4G8GA 3BO8A 3AREA 2X4PA 3BZFA 4MNGA 4MNQA 3U0PA 5E8PA 2VE6A 1TVBA 5MEQA 3MRQA 1ZT7A 5C08A 3KPMA 4JFFA 3GSRA 4GKNA 3VFNA 2FYYA 3GMLA 3VJ6A 5AD0A 1DUZA 1ED3A 3MRPA 4QRRA 1XR8A 2IA1A 3FT4A 4PGCA 3TBSA 1E28A 3ROOA 3PWVA 2FIKA 4PRAA 1W0VA 4L9LC 3D3VA 5HHQA 3L9RA 3MRDA 3ECBA 5IM7A 1LDPH 1DDHA 3PWNA 1EFXA 3MRJA 3TF7A 1ZVSA 3KPOA 4S0UC 1T0MA 1XZ0A 4L4TA 5FA4A 5HGDA 1K5NA 3V5KA 4Y2DA 3BH8A 3MRGA 4PRDA 4K7FA 1S7QA 1R3HA 2CLVA 3MREA 3TBWA 3O3EA 1C16A 1VGKA 3E3QA 3D2UA 3KPQA 4U1LA 1A6ZA 3ARFA 3P9MA 1A9BA 3GSNH 3LKSA 2BVQA 5H94A 4JO8A 3RWDA 3GSQA 5GSVA 3SPVA 3P4NA 2H6PA 1EEZA 1QO3A 3GSWA 3FFCA 4U6YA 5C09A 3VFTA 3ILPA 2ZSVA 3H7BA 1CG9A 4LCYA 1JGEA 2BSSA 2X4SA 1XR9A 3O3AA 5D2NA 3BW9A 1ZS8A 1T20A 4NQVA 4WDIA 1HHGA 1ZHNA 3D25A 3VH8A 3KPSA 3FONA 2RFXA 3FT2A 3RZCA 1MWAH 1YDPA 3ARBA 1OF2A 3P73A 3TO2A 3SKOA 1LK2A 2UWEA 1JPFA 5GSRA 4ZFZA 4L8SC 4JFDA 1FFOA 2HJKA 3BWAA 3ROLA 1Z5LA 3VXOA 3C8KA 1N3NA 1LQVA 1U58A 3KLAA 3VRJA 5MEOA 1S7SA 2X4QA 4HUWA 3VFWA 4PRHA 3KPRA 3FQXA 4L8DA 3VRIA 1KJVA 4MQ7A 5EU4A 3QDJA 4JFPA 1T80A 3SJVA 2ZOLA 4MJ5A 1JGDA 2GTWA 3ARGA 3MR9A 1QRNA 4NNYA 1E27A 3PQYA 3ERYA 3MV8A 4G9DA 1KJ2H 4PGBA 2FWOA 1JF1A 2CKBH 2X4RA 4N0FA 5HHNA 1T7WA 4EI5A 3JTTA 3OXRA 3MRNA 3OXSA 3WUWA 2FO4A 5MERA 3GMRA 2GJ6A 3BP7A 3PWLA 1S7XA 2PYEA 3QUZA 5C0GA 2VLLA 3P77A 1GZQA 1HHHA 3UPRA 3TBYA 3RL2A 1FG2A 5HGHA 4F7MA 2VLRA 3O3DA 4MJIA 3FOLA 3O8XA 4EN3C 4EUPA 2P5WA 4N5EA 3LKNA 1ONQA 3ILQC 3E6HA 2VABA 3GMOA 4NNXA 3TBTA 1I1AA 4IRSA 4FTVA 1B0GA 4PDCE 4ZAKA 1KPUA 1RJZA 1KPRA 1VACA 2AK4A 2YPKA 1HHJA 4PJ7A 4PV8A 2OL3H 3NFNA 2CIKA 4O2CA 4U1KA 4PJFA 4V3EB 4U1IA 1I7TA 5L2JA 3DTXA 3TO4A 1M05A 2X4NA 3PABA 4O2FA 5FA3A 1KPVA 3H9SA 1KJMA 1B0RA 4NQCA 3S6CA 5IB5A 3FTGA 2BVOA 1QLFA 2VAAA 4Y4HA 4NO0A 3RWJA 3QDGA 1JHTA 1QSFA 3TJHA 2VLJA 3X14A 4Z77A 3DX6A 3VFVA 3I0TA 2WY3A 2D31A 2J8UA 1I1YA 3MV7A 3MA7A 2AV1A 3FQRA 4HS3A 4V3DB 4Y4FA 5IB2A 1RJYA 3FQNA 4JFOA 5F1IA 5ISZA 3SDXA 3UTQA 2BSRA 4ZUSA 1BQHA 1S7RA 1YN6A 3OV6A 5ACZA 5IEHA 4JRXA 1P4LA 5HGAA 3TZVC 4L3CA 1I1FA 2AXFA 5IB3A 4IRJA 4PREA 1HSAA 4NO5A 2CLRA 4PP8C 5BJTA 1YN7A 1FO0H 4LCWA 3MRLA 1XH3A 4PRBA 1QQDA 4PRNA 1VADA 3D39A 3LKPA 3GMNA 5D2LA 5ENWA 1HYRC 1A1NA 3QUXA 3RWFA 1TMCA 1A9EA 3SCMA 4PR5A 4G9FA 5E8NA 3FQTA 1ZT4A 2GAZA 4LCCC 4QOKA 1T21A 4D0BA 4MVBA 3ES6A 1LEKA 4BKWA 4E5XA 1K8DA 1I4FA 4PGEA 1QSEA 1S7TA 3O3BA 1ZT1A 3FOMA 4NO2A 5D5MA 1BIIA 1JE6A 5C0EA 4PJBA 1UXSA 3DX8A 3SDAA 5HHMA 1AKJA 3GMPA 4PJEA 2YPLA 3MRBA 4UQ3A 3B6SA 3QULA 3GIVA 2AV7A 3TBVA 1A1OA 3VFSA 5EU3A 3LKRA 2NX5A 2CLZA 2GUOA 1UXWA 3GSUA 4G8IA 3MRKA 3AU1A 4JFQA 4NQXA 2A83A 3M17A 3FT3A 3P9LA 4PJGA 3SDCA 2ZOKA 1LD9A 1T1ZA 4NSKA 5D7LA 4MJ6A 3KYNA 2CIIA 3PWPA 1P1ZA 3VWKA 3CC5A 4HUUA 4PG2A 2X70A 3X11A 5IEKA 3UTTA 3MRRA 5MEPA 2GITA 3IXAA 4PV9A 1WBZA 2VLKA 3VXRA 3DMMA 3MRMA 5EO0A 1Q94A 5C0FA 1FZKA 1MHCA 3VFMA 1RK0A 1ZHKA 3FRUA 1FZJA 4JRYA 5C0DA 2GTZA 3PWJA 3QQ3A 5IB1A 4WO4A 1DE4A 4U1NA 4HV8A 4CVXA 2NYKA 4F7EA 2X4OA 3HG1A 1ZHBA 3VXMA 3GSVA 5J6GA 3GSXA 4NQEA 4PJ9A 4UQ2A 3FQWA 3L3KA 2ESVA 4FFEX 4D0DA 5BS0A 4L3EA 3TPUE 4PJ5A 2F53A 3L3GA 3I6LD 3MYJA 2BNRA 2F54A 3VFPA 1KJ3H 1L8JA 3VXPA 4GUPA 3D18A 3UBXA 3KPPA 4F7TA 2BSTA 1G7PA 4HUXA 1LP9A 1KCGC 1N59A 2O5NA 3LV3A 1G6RH 1MI5A 4PJXA 3G08A 2AKRA 4L8CA 3QEQA 4PJAA 5F1NA 3O4LA 4NHUE 1AGEA 1WBXA 1T7YA 2V2WA 2XFXA 1T7XA 5E00A 1YPZA 4NO3A 1AGDA 1BD2A 3RL1A 3QFJA 3TVMA 3CVHA 1ZSDA 1CE6A 5EFIA 3RWEA 1G7QA 3BUYA 3BH9A 3I6GA 3O9WA 3VFOA 2BVPA 3L3JA 3SDDA 3WS3A 5C0IA 1T0NA 3JVGA 3REWA 1S7VA 2YEZA 2HLAA 3DXAA 3QDMA 3TA3A 5C07A 4JQVA 1SYSA 3HAEA 4ZUUA 3VWJA 3WLBA 1QR1A 3RWCA 3QI9A 4ZUWA 4PJCA 3RGVC 4I4WA 3KPLA 5DDHA 5E9DA 4APQA 1T1WA 3W0WA 1EEYA 3PWUA 1IM9A 4G43A 5D7IA 5J6HA 4L8BA 3QZWA 4WW2C 5FKPA 1S9YA 3JTCA 5INCA 1FFPA 3RTQA 4WWKC 4X6FA 4CW1A 3TIDA 1BZ9A 5SWQA 4U6XA 5C0AA 4QRTA 2X4TA 4NT6A 5EOTA 5IROA 3QQ4A 1AGFA 3KWWA 4IIQC 3TIEA 4Z76A 1I7RA 5C9JA 3HLAA 2PO6A 3RWGA 5B38A 1AO7A 3DX7A 3WS6A 3P4MA 1OGTA 3BZEA 3BVNA 3GSOA 1KTLA 3VFUA 3CDGA 3KXFA 1INQA 2P5EA 3CZFA 4PJHA 2BCKA 5E8OA 5F7DA 4QRSA 5JHDA 3T8XA 3BEWA 3LKOA 3VXUA 4ONOA 1RK1A 5SWSA 4IHOA 1ZAGA 4JFEA 4HX1A 1P7QA 1AGCA 4WUUA 3E2HA 3V5HA 1FZOA 1SYVA 4HUVA 3HE6A 2C7UA 5C0CA 4WJ5A 3OX8A 5EO1A 4G42A 4N0UA 3TFKA 2JCCA 1S7WA 3BGMA 3BP4A 2GT9A 3HE7A 3X12A 1HHIA 1HHKA 4K71B 3QUKA 4PJIA 3KPNA 1T7VA 1FZMA 1IM3A 3RWHA 5HHPA 1A1MA 5BXFA 3GJFA 3AM8A 4N8VA 4X6DA 4ZUVA 4PJDA 3MRHA 3W39A 3QUYA 1JPGA 1M6OA 1JFMA 1T7ZA 4E0RA 5L2KA 1UQSA 3E6FA 3GMQA 4D0CA 1N2RA 4PGDA 4QRQA 1ZHLA 2HN7A 1PQZA 1S7UA 1QVOA 1WBYA 1OGAA 3KYOA 1FFNA 1CD1A 1T1XA 2F74A 3MRFA 4MS8A 4N0CA 3VXSA 1QEWA 1S8DA 4ELMA 5EU6A 1NEZA 4MXQA 4X6CA 4QRUA 2V2XA 3UTSA 4PG9A 2NW3A 3B3IA 1AGBA 3DBXA 3M1BA 4GKSA 2OI9A 5DEGA 3L3IA 3QFDA 5HGBA 1JUFA 4WU7A 2X4UA 4PRPA 5D9SA 2BNQA 4Y16A 1HSBA 5C0JA 3LKQA 1NANH 5EU5A 1OSZA 4F7PA 1T22A 4Y4KA 3V5DA 1EXUA 3BHBA 5MENA 1X7QA 1N5AA 3MV9A 1MHEA 5D7JC 4I48A 4QRPA 4Z78A 4MX7A 3IT8D 3P4OA 2MHAA 4O2EA 2Q7YA 3MGTA 5J1AA 2FZ3A 5BRZA 4LHUA 1LEGA 3MROA 5C0BA 3BXNA 4NQDA 2H26A 3HCVA 1S9WA 5IVXA 3BEVA 3GMMA 5E6IC 4U1JA 4WU5A 3WL9A 3LN5A 3CPLA 3RUGA 3VXNA 5B39A 3L3DA 3MRIA 4G59A 4U1SA 3C9NA 4PRIA 5HYJA 4L29A 2HJLA 4JQXA 4F7CA 3HUJA 2XPGA 1GZPA 5HHOA 3LN4A 1B3JA 2E7LE 3CH1A 1T1YA 4L4VA 4XXCA 1TVHA 4CVZA 3VFRA 3HPJA 3CCHA 4HWZA 3MRCA 3H9HA 1DUYA 2AXGA 3RWIA 5F9JA 3VCLA 5INDA 3MGOA 3TN0A 5FDWA 3L3HA
chains in the Genus database with same CATH topology
4HKJA 5EUOA 5DEFA 1HOCA 4PJ8A 4X6EA 3SKMA 2ZSWA 2DYPA 3X13A 3ARDA 1W0WA 5SWZA 3JTSA 1I7UA 5IB4A 4ZUTA 3I6KA 1S9XA 4U1MA 3FQUA 4U1HA 1KBGH 1W72A 4LNRA 3T1FA 1NAMH 4G8GA 3BO8A 3AREA 2X4PA 3BZFA 4MNGA 4MNQA 3U0PA 5E8PA 2VE6A 1TVBA 5MEQA 3MRQA 1ZT7A 5C08A 3KPMA 4JFFA 3GSRA 4GKNA 3VFNA 2FYYA 3GMLA 3VJ6A 5AD0A 1DUZA 1ED3A 3MRPA 4QRRA 1XR8A 3FT4A 4PGCA 3TBSA 1E28A 3ROOA 3PWVA 2FIKA 4PRAA 1W0VA 4L9LC 3D3VA 5HHQA 3L9RA 3MRDA 3ECBA 5IM7A 1LDPH 1DDHA 3PWNA 1EFXA 3MRJA 3TF7A 1ZVSA 3KPOA 4S0UC 1T0MA 1XZ0A 4L4TA 5FA4A 5HGDA 1K5NA 3V5KA 4Y2DA 3BH8A 3MRGA 4PRDA 4K7FA 1S7QA 1R3HA 2CLVA 3MREA 3TBWA 3O3EA 1C16A 1VGKA 3E3QA 3D2UA 3KPQA 4U1LA 1A6ZA 3ARFA 3P9MA 1A9BA 3GSNH 3LKSA 2BVQA 5H94A 3RWDA 3GSQA 5GSVA 3SPVA 3P4NA 2H6PA 1EEZA 1QO3A 3GSWA 3FFCA 4U6YA 5C09A 3VFTA 3ILPA 2ZSVA 3H7BA 1CG9A 4LCYA 1JGEA 2BSSA 2X4SA 1XR9A 3O3AA 5D2NA 3BW9A 1ZS8A 1T20A 4NQVA 4WDIA 1HHGA 1ZHNA 3D25A 3VH8A 3KPSA 3FONA 2RFXA 3FT2A 3RZCA 1MWAH 1YDPA 3ARBA 1OF2A 3P73A 3TO2A 3SKOA 1LK2A 2UWEA 1JPFA 5GSRA 4ZFZA 4L8SC 4JFDA 1FFOA 2HJKA 3BWAA 3ROLA 1Z5LA 3VXOA 3C8KA 1N3NA 1LQVA 1U58A 3KLAA 3VRJA 5MEOA 1S7SA 2X4QA 4HUWA 3VFWA 4PRHA 3KPRA 3FQXA 4L8DA 3VRIA 1KJVA 4MQ7A 5EU4A 3QDJA 4JFPA 1T80A 3SJVA 2ZOLA 4MJ5A 1JGDA 2GTWA 3ARGA 3MR9A 1QRNA 4NNYA 1E27A 3PQYA 3ERYA 3MV8A 4G9DA 1KJ2H 4PGBA 2FWOA 1JF1A 2CKBH 2X4RA 4N0FA 5HHNA 1T7WA 4EI5A 3JTTA 3OXRA 3MRNA 3OXSA 3WUWA 2FO4A 5MERA 3GMRA 2GJ6A 3BP7A 3PWLA 1S7XA 2PYEA 3QUZA 5C0GA 2VLLA 3P77A 1GZQA 1HHHA 3UPRA 3TBYA 3RL2A 1FG2A 5HGHA 4F7MA 2VLRA 3O3DA 4MJIA 3FOLA 3O8XA 4EN3C 4EUPA 2P5WA 4N5EA 3LKNA 1ONQA 3ILQC 3E6HA 2VABA 3GMOA 4NNXA 3TBTA 1I1AA 4IRSA 4FTVA 1B0GA 4PDCE 4ZAKA 1KPUA 1RJZA 1KPRA 1VACA 2AK4A 2YPKA 1HHJA 4PJ7A 4PV8A 2OL3H 3NFNA 2CIKA 4O2CA 4U1KA 4PJFA 4V3EB 4U1IA 1I7TA 5L2JA 3DTXA 3TO4A 1M05A 2X4NA 3PABA 4O2FA 5FA3A 1KPVA 3H9SA 1KJMA 1B0RA 4NQCA 3S6CA 5IB5A 3FTGA 2BVOA 1QLFA 2VAAA 4Y4HA 4NO0A 3RWJA 3QDGA 1JHTA 1QSFA 3TJHA 2VLJA 3X14A 4Z77A 3DX6A 3VFVA 2WY3A 2D31A 2J8UA 1I1YA 3MV7A 3MA7A 2AV1A 3FQRA 4HS3A 4V3DB 4Y4FA 5IB2A 1RJYA 3FQNA 4JFOA 5F1IA 5ISZA 3SDXA 3UTQA 2BSRA 4ZUSA 1BQHA 1S7RA 1YN6A 3OV6A 5ACZA 5IEHA 4JRXA 1P4LA 5HGAA 3TZVC 4L3CA 1I1FA 2AXFA 5IB3A 4IRJA 4PREA 1HSAA 4NO5A 2CLRA 4PP8C 5BJTA 1YN7A 1FO0H 4LCWA 3MRLA 1XH3A 4PRBA 1QQDA 4PRNA 1VADA 3D39A 3LKPA 3GMNA 5D2LA 5ENWA 1HYRC 1A1NA 3QUXA 3RWFA 1TMCA 1A9EA 3SCMA 4PR5A 4G9FA 5E8NA 3FQTA 1ZT4A 2GAZA 4LCCC 4QOKA 1T21A 4D0BA 4MVBA 3ES6A 1LEKA 4E5XA 1K8DA 1I4FA 4PGEA 1QSEA 1S7TA 3O3BA 1ZT1A 3FOMA 4NO2A 5D5MA 1BIIA 1JE6A 5C0EA 4PJBA 1UXSA 3DX8A 3SDAA 5HHMA 1AKJA 3GMPA 4PJEA 2YPLA 3MRBA 4UQ3A 3B6SA 3QULA 3GIVA 2AV7A 3TBVA 1A1OA 3VFSA 5EU3A 3LKRA 2NX5A 2CLZA 2GUOA 1UXWA 3GSUA 4G8IA 3MRKA 3AU1A 4JFQA 4NQXA 2A83A 3M17A 3FT3A 3P9LA 4PJGA 3SDCA 2ZOKA 1LD9A 1T1ZA 4NSKA 5D7LA 4MJ6A 3KYNA 2CIIA 3PWPA 1P1ZA 3VWKA 3CC5A 4HUUA 4PG2A 2X70A 3X11A 5IEKA 3UTTA 3MRRA 5MEPA 2GITA 3IXAA 4PV9A 1WBZA 2VLKA 3VXRA 3DMMA 3MRMA 5EO0A 1Q94A 5C0FA 1FZKA 1MHCA 3VFMA 1RK0A 1ZHKA 3FRUA 1FZJA 4JRYA 5C0DA 2GTZA 3PWJA 3QQ3A 5IB1A 4WO4A 1DE4A 4U1NA 4HV8A 4CVXA 4F7EA 2X4OA 3HG1A 1ZHBA 3VXMA 3GSVA 5J6GA 3GSXA 4NQEA 4PJ9A 4UQ2A 3FQWA 3L3KA 2ESVA 4FFEX 4D0DA 5BS0A 4L3EA 3TPUE 4PJ5A 2F53A 3L3GA 3I6LD 3MYJA 2BNRA 2F54A 3VFPA 1KJ3H 1L8JA 3VXPA 4GUPA 3D18A 3UBXA 3KPPA 4F7TA 2BSTA 1G7PA 4HUXA 1LP9A 1KCGC 1N59A 3LV3A 1G6RH 1MI5A 4PJXA 3G08A 2AKRA 4L8CA 3QEQA 4PJAA 5F1NA 3O4LA 4NHUE 1AGEA 1WBXA 1T7YA 2V2WA 2XFXA 1T7XA 5E00A 1YPZA 4NO3A 1AGDA 1BD2A 3RL1A 3QFJA 3TVMA 3CVHA 1ZSDA 1CE6A 5EFIA 3RWEA 1G7QA 3BUYA 3BH9A 3I6GA 3O9WA 3VFOA 2BVPA 3L3JA 3SDDA 3WS3A 5C0IA 1T0NA 3JVGA 3REWA 1S7VA 2YEZA 2HLAA 3DXAA 3QDMA 3TA3A 5C07A 4JQVA 1SYSA 3HAEA 4ZUUA 3VWJA 3WLBA 1QR1A 3RWCA 3QI9A 4ZUWA 4PJCA 3RGVC 4I4WA 3KPLA 5DDHA 5E9DA 4APQA 1T1WA 3W0WA 1EEYA 3PWUA 1IM9A 4G43A 5D7IA 5J6HA 4L8BA 3QZWA 4WW2C 5FKPA 1S9YA 3JTCA 5INCA 1FFPA 3RTQA 4WWKC 4X6FA 4CW1A 3TIDA 1BZ9A 5SWQA 4U6XA 5C0AA 4QRTA 2X4TA 4NT6A 5EOTA 5IROA 3QQ4A 1AGFA 3KWWA 4IIQC 3TIEA 4Z76A 1I7RA 5C9JA 3HLAA 2PO6A 3RWGA 5B38A 1AO7A 3DX7A 3WS6A 3P4MA 1OGTA 3BZEA 3BVNA 3GSOA 1KTLA 3VFUA 3CDGA 3KXFA 1INQA 2P5EA 3CZFA 4PJHA 2BCKA 5E8OA 5F7DA 4QRSA 5JHDA 3T8XA 3BEWA 3LKOA 3VXUA 4ONOA 1RK1A 5SWSA 4IHOA 1ZAGA 4JFEA 4HX1A 1P7QA 1AGCA 4WUUA 3E2HA 3V5HA 1FZOA 1SYVA 4HUVA 3HE6A 2C7UA 5C0CA 4WJ5A 3OX8A 5EO1A 4G42A 4N0UA 3TFKA 2JCCA 1S7WA 3BGMA 3BP4A 2GT9A 3HE7A 3X12A 1HHIA 1HHKA 4K71B 3QUKA 4PJIA 3KPNA 1T7VA 1FZMA 1IM3A 3RWHA 5HHPA 1A1MA 5BXFA 3GJFA 3AM8A 4N8VA 4X6DA 4ZUVA 4PJDA 3MRHA 3W39A 3QUYA 1JPGA 1M6OA 1JFMA 1T7ZA 4E0RA 5L2KA 1UQSA 3E6FA 3GMQA 4D0CA 1N2RA 4PGDA 4QRQA 1ZHLA 2HN7A 1PQZA 1S7UA 1QVOA 1WBYA 1OGAA 3KYOA 1FFNA 1CD1A 1T1XA 2F74A 3MRFA 4MS8A 4N0CA 3VXSA 1QEWA 1S8DA 4ELMA 5EU6A 1NEZA 4MXQA 4X6CA 4QRUA 2V2XA 3UTSA 4PG9A 2NW3A 3B3IA 1AGBA 3DBXA 3M1BA 4GKSA 2OI9A 5DEGA 3L3IA 3QFDA 5HGBA 1JUFA 4WU7A 2X4UA 4PRPA 5D9SA 2BNQA 4Y16A 1HSBA 5C0JA 3LKQA 1NANH 5EU5A 1OSZA 4F7PA 1T22A 4Y4KA 3V5DA 1EXUA 3BHBA 5MENA 1X7QA 1N5AA 3MV9A 1MHEA 5D7JC 4I48A 4QRPA 4Z78A 4MX7A 3IT8D 3P4OA 2MHAA 4O2EA 2Q7YA 3MGTA 5J1AA 2FZ3A 5BRZA 4LHUA 1LEGA 3MROA 5C0BA 3BXNA 4NQDA 2H26A 3HCVA 1S9WA 5IVXA 3BEVA 3GMMA 5E6IC 4U1JA 4WU5A 3WL9A 3LN5A 3CPLA 3RUGA 3VXNA 5B39A 3L3DA 3MRIA 4G59A 4U1SA 3C9NA 4PRIA 5HYJA 4L29A 2HJLA 4JQXA 4F7CA 3HUJA 2XPGA 1GZPA 5HHOA 3LN4A 1B3JA 2E7LE 3CH1A 1T1YA 4L4VA 4XXCA 1TVHA 4CVZA 3VFRA 3HPJA 3CCHA 4HWZA 3MRCA 3H9HA 1DUYA 2AXGA 3RWIA 5F9JA 3VCLA 5INDA 3MGOA 3TN0A 5FDWA 3L3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HKJ A;  5EUO A;  5DEF A;  1HOC A;  4PJ8 A;  4X6E A;  3SKM A;  2ZSW A;  2DYP A;  3X13 A;  3ARD A;  1W0W A;  5SWZ A;  3JTS A;  1I7U A;  5IB4 A;  4ZUT A;  3I6K A;  1S9X A;  4U1M A;  3FQU A;  4U1H A;  1KBG H;  1W72 A;  4LNR A;  3T1F A;  1NAM H;  4G8G A;  3BO8 A;  3ARE A;  2X4P A;  3BZF A;  4MNG A;  4MNQ A;  3U0P A;  5E8P A;  2VE6 A;  1TVB A;  5MEQ A;  3MRQ A;  1ZT7 A;  5C08 A;  3KPM A;  4JFF A;  3GSR A;  4GKN A;  3VFN A;  2FYY A;  3GML A;  3VJ6 A;  5AD0 A;  1DUZ A;  1ED3 A;  3MRP A;  4QRR A;  1XR8 A;  3FT4 A;  4PGC A;  3TBS A;  1E28 A;  3ROO A;  3PWV A;  2FIK A;  4PRA A;  1W0V A;  4L9L C;  3D3V A;  5HHQ A;  3L9R A;  3MRD A;  3ECB A;  5IM7 A;  1LDP H;  1DDH A;  3PWN A;  1EFX A;  3MRJ A;  3TF7 A;  1ZVS A;  3KPO A;  4S0U C;  1T0M A;  1XZ0 A;  4L4T A;  5FA4 A;  5HGD A;  1K5N A;  3V5K A;  4Y2D A;  3BH8 A;  3MRG A;  4PRD A;  4K7F A;  1S7Q A;  1R3H A;  2CLV A;  3MRE A;  3TBW A;  3O3E A;  1C16 A;  1VGK A;  3E3Q A;  3D2U A;  3KPQ A;  4U1L A;  1A6Z A;  3ARF A;  3P9M A;  1A9B A;  3GSN H;  3LKS A;  2BVQ A;  5H94 A;  3RWD A;  3GSQ A;  5GSV A;  3SPV A;  3P4N A;  2H6P A;  1EEZ A;  1QO3 A;  3GSW A;  3FFC A;  4U6Y A;  5C09 A;  3VFT A;  3ILP A;  2ZSV A;  3H7B A;  1CG9 A;  4LCY A;  1JGE A;  2BSS A;  2X4S A;  1XR9 A;  3O3A A;  5D2N A;  3BW9 A;  1ZS8 A;  1T20 A;  4NQV A;  4WDI A;  1HHG A;  1ZHN A;  3D25 A;  3VH8 A;  3KPS A;  3FON A;  2RFX A;  3FT2 A;  3RZC A;  1MWA H;  1YDP A;  3ARB A;  1OF2 A;  3P73 A;  3TO2 A;  3SKO A;  1LK2 A;  2UWE A;  1JPF A;  5GSR A;  4ZFZ A;  4L8S C;  4JFD A;  1FFO A;  2HJK A;  3BWA A;  3ROL A;  1Z5L A;  3VXO A;  3C8K A;  1N3N A;  1LQV A;  1U58 A;  3KLA A;  3VRJ A;  5MEO A;  1S7S A;  2X4Q A;  4HUW A;  3VFW A;  4PRH A;  3KPR A;  3FQX A;  4L8D A;  3VRI A;  1KJV A;  4MQ7 A;  5EU4 A;  3QDJ A;  4JFP A;  1T80 A;  3SJV A;  2ZOL A;  4MJ5 A;  1JGD A;  2GTW A;  3ARG A;  3MR9 A;  1QRN A;  4NNY A;  1E27 A;  3PQY A;  3ERY A;  3MV8 A;  4G9D A;  1KJ2 H;  4PGB A;  2FWO A;  1JF1 A;  2CKB H;  2X4R A;  4N0F A;  5HHN A;  1T7W A;  4EI5 A;  3JTT A;  3OXR A;  3MRN A;  3OXS A;  3WUW A;  2FO4 A;  5MER A;  3GMR A;  2GJ6 A;  3BP7 A;  3PWL A;  1S7X A;  2PYE A;  3QUZ A;  5C0G A;  2VLL A;  3P77 A;  1GZQ A;  1HHH A;  3UPR A;  3TBY A;  3RL2 A;  1FG2 A;  5HGH A;  4F7M A;  2VLR A;  3O3D A;  4MJI A;  3FOL A;  3O8X A;  4EN3 C;  4EUP A;  2P5W A;  4N5E A;  3LKN A;  1ONQ A;  3ILQ C;  3E6H A;  2VAB A;  3GMO A;  4NNX A;  3TBT A;  1I1A A;  4IRS A;  4FTV A;  1B0G A;  4PDC E;  4ZAK A;  1KPU A;  1RJZ A;  1KPR A;  1VAC A;  2AK4 A;  2YPK A;  1HHJ A;  4PJ7 A;  4PV8 A;  2OL3 H;  3NFN A;  2CIK A;  4O2C A;  4U1K A;  4PJF A;  4V3E B;  4U1I A;  1I7T A;  5L2J A;  3DTX A;  3TO4 A;  1M05 A;  2X4N A;  3PAB A;  4O2F A;  5FA3 A;  1KPV A;  3H9S A;  1KJM A;  1B0R A;  4NQC A;  3S6C A;  5IB5 A;  3FTG A;  2BVO A;  1QLF A;  2VAA A;  4Y4H A;  4NO0 A;  3RWJ A;  3QDG A;  1JHT A;  1QSF A;  3TJH A;  2VLJ A;  3X14 A;  4Z77 A;  3DX6 A;  3VFV A;  2WY3 A;  2D31 A;  2J8U A;  1I1Y A;  3MV7 A;  3MA7 A;  2AV1 A;  3FQR A;  4HS3 A;  4V3D B;  4Y4F A;  5IB2 A;  1RJY A;  3FQN A;  4JFO A;  5F1I A;  5ISZ A;  3SDX A;  3UTQ A;  2BSR A;  4ZUS A;  1BQH A;  1S7R A;  1YN6 A;  3OV6 A;  5ACZ A;  5IEH A;  4JRX A;  1P4L A;  5HGA A;  3TZV C;  4L3C A;  1I1F A;  2AXF A;  5IB3 A;  4IRJ A;  4PRE A;  1HSA A;  4NO5 A;  2CLR A;  4PP8 C;  5BJT A;  1YN7 A;  1FO0 H;  4LCW A;  3MRL A;  1XH3 A;  4PRB A;  1QQD A;  4PRN A;  1VAD A;  3D39 A;  3LKP A;  3GMN A;  5D2L A;  5ENW A;  1HYR C;  1A1N A;  3QUX A;  3RWF A;  1TMC A;  1A9E A;  3SCM A;  4PR5 A;  4G9F A;  5E8N A;  3FQT A;  1ZT4 A;  2GAZ A;  4LCC C;  4QOK A;  1T21 A;  4D0B A;  4MVB A;  3ES6 A;  1LEK A;  4E5X A;  1K8D A;  1I4F A;  4PGE A;  1QSE A;  1S7T A;  3O3B A;  1ZT1 A;  3FOM A;  4NO2 A;  5D5M A;  1BII A;  1JE6 A;  5C0E A;  4PJB A;  1UXS A;  3DX8 A;  3SDA A;  5HHM A;  1AKJ A;  3GMP A;  4PJE A;  2YPL A;  3MRB A;  4UQ3 A;  3B6S A;  3QUL A;  3GIV A;  2AV7 A;  3TBV A;  1A1O A;  3VFS A;  5EU3 A;  3LKR A;  2NX5 A;  2CLZ A;  2GUO A;  1UXW A;  3GSU A;  4G8I A;  3MRK A;  3AU1 A;  4JFQ A;  4NQX A;  2A83 A;  3M17 A;  3FT3 A;  3P9L A;  4PJG A;  3SDC A;  2ZOK A;  1LD9 A;  1T1Z A;  4NSK A;  5D7L A;  4MJ6 A;  3KYN A;  2CII A;  3PWP A;  1P1Z A;  3VWK A;  3CC5 A;  4HUU A;  4PG2 A;  2X70 A;  3X11 A;  5IEK A;  3UTT A;  3MRR A;  5MEP A;  2GIT A;  3IXA A;  4PV9 A;  1WBZ A;  2VLK A;  3VXR A;  3DMM A;  3MRM A;  5EO0 A;  1Q94 A;  5C0F A;  1FZK A;  1MHC A;  3VFM A;  1RK0 A;  1ZHK A;  3FRU A;  1FZJ A;  4JRY A;  5C0D A;  2GTZ A;  3PWJ A;  3QQ3 A;  5IB1 A;  4WO4 A;  1DE4 A;  4U1N A;  4HV8 A;  4CVX A;  4F7E A;  2X4O A;  3HG1 A;  1ZHB A;  3VXM A;  3GSV A;  5J6G A;  3GSX A;  4NQE A;  4PJ9 A;  4UQ2 A;  3FQW A;  3L3K A;  2ESV A;  4FFE X;  4D0D A;  5BS0 A;  4L3E A;  3TPU E;  4PJ5 A;  2F53 A;  3L3G A;  3I6L D;  3MYJ A;  2BNR A;  2F54 A;  3VFP A;  1KJ3 H;  1L8J A;  3VXP A;  4GUP A;  3D18 A;  3UBX A;  3KPP A;  4F7T A;  2BST A;  1G7P A;  4HUX A;  1LP9 A;  1KCG C;  1N59 A;  3LV3 A;  1G6R H;  1MI5 A;  4PJX A;  3G08 A;  2AKR A;  4L8C A;  3QEQ A;  4PJA A;  5F1N A;  3O4L A;  4NHU E;  1AGE A;  1WBX A;  1T7Y A;  2V2W A;  2XFX A;  1T7X A;  5E00 A;  1YPZ A;  4NO3 A;  1AGD A;  1BD2 A;  3RL1 A;  3QFJ A;  3TVM A;  3CVH A;  1ZSD A;  1CE6 A;  5EFI A;  3RWE A;  1G7Q A;  3BUY A;  3BH9 A;  3I6G A;  3O9W A;  3VFO A;  2BVP A;  3L3J A;  3SDD A;  3WS3 A;  5C0I A;  1T0N A;  3JVG A;  3REW A;  1S7V A;  2YEZ A;  2HLA A;  3DXA A;  3QDM A;  3TA3 A;  5C07 A;  4JQV A;  1SYS A;  3HAE A;  4ZUU A;  3VWJ A;  3WLB A;  1QR1 A;  3RWC A;  3QI9 A;  4ZUW A;  4PJC A;  3RGV C;  4I4W A;  3KPL A;  5DDH A;  5E9D A;  4APQ A;  1T1W A;  3W0W A;  1EEY A;  3PWU A;  1IM9 A;  4G43 A;  5D7I A;  5J6H A;  4L8B A;  3QZW A;  4WW2 C;  5FKP A;  1S9Y A;  3JTC A;  5INC A;  1FFP A;  3RTQ A;  4WWK C;  4X6F A;  4CW1 A;  3TID A;  1BZ9 A;  5SWQ A;  4U6X A;  5C0A A;  4QRT A;  2X4T A;  4NT6 A;  5EOT A;  5IRO A;  3QQ4 A;  1AGF A;  3KWW A;  4IIQ C;  3TIE A;  4Z76 A;  1I7R A;  5C9J A;  3HLA A;  2PO6 A;  3RWG A;  5B38 A;  1AO7 A;  3DX7 A;  3WS6 A;  3P4M A;  1OGT A;  3BZE A;  3BVN A;  3GSO A;  1KTL A;  3VFU A;  3CDG A;  3KXF A;  1INQ A;  2P5E A;  3CZF A;  4PJH A;  2BCK A;  5E8O A;  5F7D A;  4QRS A;  5JHD A;  3T8X A;  3BEW A;  3LKO A;  3VXU A;  4ONO A;  1RK1 A;  5SWS A;  4IHO A;  1ZAG A;  4JFE A;  4HX1 A;  1P7Q A;  1AGC A;  4WUU A;  3E2H A;  3V5H A;  1FZO A;  1SYV A;  4HUV A;  3HE6 A;  2C7U A;  5C0C A;  4WJ5 A;  3OX8 A;  5EO1 A;  4G42 A;  4N0U A;  3TFK A;  2JCC A;  1S7W A;  3BGM A;  3BP4 A;  2GT9 A;  3HE7 A;  3X12 A;  1HHI A;  1HHK A;  4K71 B;  3QUK A;  4PJI A;  3KPN A;  1T7V A;  1FZM A;  1IM3 A;  3RWH A;  5HHP A;  1A1M A;  5BXF A;  3GJF A;  3AM8 A;  4N8V A;  4X6D A;  4ZUV A;  4PJD A;  3MRH A;  3W39 A;  3QUY A;  1JPG A;  1M6O A;  1JFM A;  1T7Z A;  4E0R A;  5L2K A;  1UQS A;  3E6F A;  3GMQ A;  4D0C A;  1N2R A;  4PGD A;  4QRQ A;  1ZHL A;  2HN7 A;  1PQZ A;  1S7U A;  1QVO A;  1WBY A;  1OGA A;  3KYO A;  1FFN A;  1CD1 A;  1T1X A;  2F74 A;  3MRF A;  4MS8 A;  4N0C A;  3VXS A;  1QEW A;  1S8D A;  4ELM A;  5EU6 A;  1NEZ A;  4MXQ A;  4X6C A;  4QRU A;  2V2X A;  3UTS A;  4PG9 A;  2NW3 A;  3B3I A;  1AGB A;  3DBX A;  3M1B A;  4GKS A;  2OI9 A;  5DEG A;  3L3I A;  3QFD A;  5HGB A;  1JUF A;  4WU7 A;  2X4U A;  4PRP A;  5D9S A;  2BNQ A;  4Y16 A;  1HSB A;  5C0J A;  3LKQ A;  1NAN H;  5EU5 A;  1OSZ A;  4F7P A;  1T22 A;  4Y4K A;  3V5D A;  1EXU A;  3BHB A;  5MEN A;  1X7Q A;  1N5A A;  3MV9 A;  1MHE A;  5D7J C;  4I48 A;  4QRP A;  4Z78 A;  4MX7 A;  3IT8 D;  3P4O A;  2MHA A;  4O2E A;  2Q7Y A;  3MGT A;  5J1A A;  2FZ3 A;  5BRZ A;  4LHU A;  1LEG A;  3MRO A;  5C0B A;  3BXN A;  4NQD A;  2H26 A;  3HCV A;  1S9W A;  5IVX A;  3BEV A;  3GMM A;  5E6I C;  4U1J A;  4WU5 A;  3WL9 A;  3LN5 A;  3CPL A;  3RUG A;  3VXN A;  5B39 A;  3L3D A;  3MRI A;  4G59 A;  4U1S A;  3C9N A;  4PRI A;  5HYJ A;  4L29 A;  2HJL A;  4JQX A;  4F7C A;  3HUJ A;  2XPG A;  1GZP A;  5HHO A;  3LN4 A;  1B3J A;  2E7L E;  3CH1 A;  1T1Y A;  4L4V A;  4XXC A;  1TVH A;  4CVZ A;  3VFR A;  3HPJ A;  3CCH A;  4HWZ A;  3MRC A;  3H9H A;  1DUY A;  2AXG A;  3RWI A;  5F9J A;  3VCL A;  5IND A;  3MGO A;  3TN0 A;  5FDW A;  3L3H A; 
#chains in the Genus database with same CATH topology
 4HKJ A;  5EUO A;  5DEF A;  1HOC A;  4PJ8 A;  4X6E A;  3SKM A;  2ZSW A;  2DYP A;  3X13 A;  3ARD A;  1W0W A;  5SWZ A;  3JTS A;  1I7U A;  5IB4 A;  4ZUT A;  3I6K A;  1S9X A;  4U1M A;  3FQU A;  4U1H A;  1KBG H;  1W72 A;  4LNR A;  4G59 C;  3T1F A;  1NAM H;  4G8G A;  3BO8 A;  3ARE A;  2X4P A;  3BZF A;  4MNG A;  4MNQ A;  3U0P A;  5E8P A;  2VE6 A;  1TVB A;  5MEQ A;  3MRQ A;  1ZT7 A;  5C08 A;  3KPM A;  4JFF A;  3GSR A;  4GKN A;  3VFN A;  2FYY A;  3GML A;  3VJ6 A;  5AD0 A;  1DUZ A;  1ED3 A;  3MRP A;  4QRR A;  1XR8 A;  2IA1 A;  3FT4 A;  4PGC A;  3TBS A;  1E28 A;  3ROO A;  3PWV A;  2FIK A;  4PRA A;  1W0V A;  4L9L C;  3D3V A;  5HHQ A;  3L9R A;  3MRD A;  3ECB A;  5IM7 A;  1LDP H;  1DDH A;  3PWN A;  1EFX A;  3MRJ A;  3TF7 A;  1ZVS A;  3KPO A;  4S0U C;  1T0M A;  1XZ0 A;  4L4T A;  5FA4 A;  5HGD A;  1K5N A;  3V5K A;  4Y2D A;  3BH8 A;  3MRG A;  4PRD A;  4K7F A;  1S7Q A;  1R3H A;  2CLV A;  3MRE A;  3TBW A;  3O3E A;  1C16 A;  1VGK A;  3E3Q A;  3D2U A;  3KPQ A;  4U1L A;  1A6Z A;  3ARF A;  3P9M A;  1A9B A;  3GSN H;  3LKS A;  2BVQ A;  5H94 A;  4JO8 A;  3RWD A;  3GSQ A;  5GSV A;  3SPV A;  3P4N A;  2H6P A;  1EEZ A;  1QO3 A;  3GSW A;  3FFC A;  4U6Y A;  5C09 A;  3VFT A;  3ILP A;  2ZSV A;  3H7B A;  1CG9 A;  4LCY A;  1JGE A;  2BSS A;  2X4S A;  1XR9 A;  3O3A A;  5D2N A;  3BW9 A;  1ZS8 A;  1T20 A;  4NQV A;  4WDI A;  1HHG A;  1ZHN A;  3D25 A;  3VH8 A;  3KPS A;  3FON A;  2RFX A;  3FT2 A;  3RZC A;  1MWA H;  1YDP A;  3ARB A;  1OF2 A;  3P73 A;  3TO2 A;  3SKO A;  1LK2 A;  2UWE A;  1JPF A;  5GSR A;  4ZFZ A;  4L8S C;  4JFD A;  1FFO A;  2HJK A;  3BWA A;  3ROL A;  1Z5L A;  3VXO A;  3C8K A;  1N3N A;  1LQV A;  1U58 A;  3KLA A;  3VRJ A;  5MEO A;  1S7S A;  2X4Q A;  4HUW A;  3VFW A;  4PRH A;  3KPR A;  3FQX A;  4L8D A;  3VRI A;  1KJV A;  4MQ7 A;  5EU4 A;  3QDJ A;  4JFP A;  1T80 A;  3SJV A;  2ZOL A;  4MJ5 A;  1JGD A;  2GTW A;  3ARG A;  3MR9 A;  1QRN A;  4NNY A;  1E27 A;  3PQY A;  3ERY A;  3MV8 A;  4G9D A;  1KJ2 H;  4PGB A;  2FWO A;  1JF1 A;  2CKB H;  2X4R A;  4N0F A;  5HHN A;  1T7W A;  4EI5 A;  3JTT A;  3OXR A;  3MRN A;  3OXS A;  3WUW A;  2FO4 A;  5MER A;  3GMR A;  2GJ6 A;  3BP7 A;  3PWL A;  1S7X A;  2PYE A;  3QUZ A;  5C0G A;  2VLL A;  3P77 A;  1GZQ A;  1HHH A;  3UPR A;  3TBY A;  3RL2 A;  1FG2 A;  5HGH A;  4F7M A;  2VLR A;  3O3D A;  4MJI A;  3FOL A;  3O8X A;  4EN3 C;  4EUP A;  2P5W A;  4N5E A;  3LKN A;  1ONQ A;  3ILQ C;  3E6H A;  2VAB A;  3GMO A;  4NNX A;  3TBT A;  1I1A A;  4IRS A;  4FTV A;  1B0G A;  4PDC E;  4ZAK A;  1KPU A;  1RJZ A;  1KPR A;  1VAC A;  2AK4 A;  2YPK A;  1HHJ A;  4PJ7 A;  4PV8 A;  2OL3 H;  3NFN A;  2CIK A;  4O2C A;  4U1K A;  4PJF A;  4V3E B;  4U1I A;  1I7T A;  5L2J A;  3DTX A;  3TO4 A;  1M05 A;  2X4N A;  3PAB A;  4O2F A;  5FA3 A;  1KPV A;  3H9S A;  1KJM A;  1B0R A;  4NQC A;  3S6C A;  5IB5 A;  3FTG A;  2BVO A;  1QLF A;  2VAA A;  4Y4H A;  4NO0 A;  3RWJ A;  3QDG A;  1JHT A;  1QSF A;  3TJH A;  2VLJ A;  3X14 A;  4Z77 A;  3DX6 A;  3VFV A;  3I0T A;  2WY3 A;  2D31 A;  2J8U A;  1I1Y A;  3MV7 A;  3MA7 A;  2AV1 A;  3FQR A;  4HS3 A;  4V3D B;  4Y4F A;  5IB2 A;  1RJY A;  3FQN A;  4JFO A;  5F1I A;  5ISZ A;  3SDX A;  3UTQ A;  2BSR A;  4ZUS A;  1BQH A;  1S7R A;  1YN6 A;  3OV6 A;  5ACZ A;  5IEH A;  4JRX A;  1P4L A;  5HGA A;  3TZV C;  4L3C A;  1I1F A;  2AXF A;  5IB3 A;  4IRJ A;  4PRE A;  1HSA A;  4NO5 A;  2CLR A;  4PP8 C;  5BJT A;  1YN7 A;  1FO0 H;  4LCW A;  3MRL A;  1XH3 A;  4PRB A;  1QQD A;  4PRN A;  1VAD A;  3D39 A;  3LKP A;  3GMN A;  5D2L A;  5ENW A;  1HYR C;  1A1N A;  3QUX A;  3RWF A;  1TMC A;  1A9E A;  3SCM A;  4PR5 A;  4G9F A;  5E8N A;  3FQT A;  1ZT4 A;  2GAZ A;  4LCC C;  4QOK A;  1T21 A;  4D0B A;  4MVB A;  3ES6 A;  1LEK A;  4BKW A;  4E5X A;  1K8D A;  1I4F A;  4PGE A;  1QSE A;  1S7T A;  3O3B A;  1ZT1 A;  3FOM A;  4NO2 A;  5D5M A;  1BII A;  1JE6 A;  5C0E A;  4PJB A;  1UXS A;  3DX8 A;  3SDA A;  5HHM A;  1AKJ A;  3GMP A;  4PJE A;  2YPL A;  3MRB A;  4UQ3 A;  3B6S A;  3QUL A;  3GIV A;  2AV7 A;  3TBV A;  1A1O A;  3VFS A;  5EU3 A;  3LKR A;  2NX5 A;  2CLZ A;  2GUO A;  1UXW A;  3GSU A;  4G8I A;  3MRK A;  3AU1 A;  4JFQ A;  4NQX A;  2A83 A;  3M17 A;  3FT3 A;  3P9L A;  4PJG A;  3SDC A;  2ZOK A;  1LD9 A;  1T1Z A;  4NSK A;  5D7L A;  4MJ6 A;  3KYN A;  2CII A;  3PWP A;  1P1Z A;  3VWK A;  3CC5 A;  4HUU A;  4PG2 A;  2X70 A;  3X11 A;  5IEK A;  3UTT A;  3MRR A;  5MEP A;  2GIT A;  3IXA A;  4PV9 A;  1WBZ A;  2VLK A;  3VXR A;  3DMM A;  3MRM A;  5EO0 A;  1Q94 A;  5C0F A;  1FZK A;  1MHC A;  3VFM A;  1RK0 A;  1ZHK A;  3FRU A;  1FZJ A;  4JRY A;  5C0D A;  2GTZ A;  3PWJ A;  3QQ3 A;  5IB1 A;  4WO4 A;  1DE4 A;  4U1N A;  4HV8 A;  4CVX A;  2NYK A;  4F7E A;  2X4O A;  3HG1 A;  1ZHB A;  3VXM A;  3GSV A;  5J6G A;  3GSX A;  4NQE A;  4PJ9 A;  4UQ2 A;  3FQW A;  3L3K A;  2ESV A;  4FFE X;  4D0D A;  5BS0 A;  4L3E A;  3TPU E;  4PJ5 A;  2F53 A;  3L3G A;  3I6L D;  3MYJ A;  2BNR A;  2F54 A;  3VFP A;  1KJ3 H;  1L8J A;  3VXP A;  4GUP A;  3D18 A;  3UBX A;  3KPP A;  4F7T A;  2BST A;  1G7P A;  4HUX A;  1LP9 A;  1KCG C;  1N59 A;  2O5N A;  3LV3 A;  1G6R H;  1MI5 A;  4PJX A;  3G08 A;  2AKR A;  4L8C A;  3QEQ A;  4PJA A;  5F1N A;  3O4L A;  4NHU E;  1AGE A;  1WBX A;  1T7Y A;  2V2W A;  2XFX A;  1T7X A;  5E00 A;  1YPZ A;  4NO3 A;  1AGD A;  1BD2 A;  3RL1 A;  3QFJ A;  3TVM A;  3CVH A;  1ZSD A;  1CE6 A;  5EFI A;  3RWE A;  1G7Q A;  3BUY A;  3BH9 A;  3I6G A;  3O9W A;  3VFO A;  2BVP A;  3L3J A;  3SDD A;  3WS3 A;  5C0I A;  1T0N A;  3JVG A;  3REW A;  1S7V A;  2YEZ A;  2HLA A;  3DXA A;  3QDM A;  3TA3 A;  5C07 A;  4JQV A;  1SYS A;  3HAE A;  4ZUU A;  3VWJ A;  3WLB A;  1QR1 A;  3RWC A;  3QI9 A;  4ZUW A;  4PJC A;  3RGV C;  4I4W A;  3KPL A;  5DDH A;  5E9D A;  4APQ A;  1T1W A;  3W0W A;  1EEY A;  3PWU A;  1IM9 A;  4G43 A;  5D7I A;  5J6H A;  4L8B A;  3QZW A;  4WW2 C;  5FKP A;  1S9Y A;  3JTC A;  5INC A;  1FFP A;  3RTQ A;  4WWK C;  4X6F A;  4CW1 A;  3TID A;  1BZ9 A;  5SWQ A;  4U6X A;  5C0A A;  4QRT A;  2X4T A;  4NT6 A;  5EOT A;  5IRO A;  3QQ4 A;  1AGF A;  3KWW A;  4IIQ C;  3TIE A;  4Z76 A;  1I7R A;  5C9J A;  3HLA A;  2PO6 A;  3RWG A;  5B38 A;  1AO7 A;  3DX7 A;  3WS6 A;  3P4M A;  1OGT A;  3BZE A;  3BVN A;  3GSO A;  1KTL A;  3VFU A;  3CDG A;  3KXF A;  1INQ A;  2P5E A;  3CZF A;  4PJH A;  2BCK A;  5E8O A;  5F7D A;  4QRS A;  5JHD A;  3T8X A;  3BEW A;  3LKO A;  3VXU A;  4ONO A;  1RK1 A;  5SWS A;  4IHO A;  1ZAG A;  4JFE A;  4HX1 A;  1P7Q A;  1AGC A;  4WUU A;  3E2H A;  3V5H A;  1FZO A;  1SYV A;  4HUV A;  3HE6 A;  2C7U A;  5C0C A;  4WJ5 A;  3OX8 A;  5EO1 A;  4G42 A;  4N0U A;  3TFK A;  2JCC A;  1S7W A;  3BGM A;  3BP4 A;  2GT9 A;  3HE7 A;  3X12 A;  1HHI A;  1HHK A;  4K71 B;  3QUK A;  4PJI A;  3KPN A;  1T7V A;  1FZM A;  1IM3 A;  3RWH A;  5HHP A;  1A1M A;  5BXF A;  3GJF A;  3AM8 A;  4N8V A;  4X6D A;  4ZUV A;  4PJD A;  3MRH A;  3W39 A;  3QUY A;  1JPG A;  1M6O A;  1JFM A;  1T7Z A;  4E0R A;  5L2K A;  1UQS A;  3E6F A;  3GMQ A;  4D0C A;  1N2R A;  4PGD A;  4QRQ A;  1ZHL A;  2HN7 A;  1PQZ A;  1S7U A;  1QVO A;  1WBY A;  1OGA A;  3KYO A;  1FFN A;  1CD1 A;  1T1X A;  2F74 A;  3MRF A;  4MS8 A;  4N0C A;  3VXS A;  1QEW A;  1S8D A;  4ELM A;  5EU6 A;  1NEZ A;  4MXQ A;  4X6C A;  4QRU A;  2V2X A;  3UTS A;  4PG9 A;  2NW3 A;  3B3I A;  1AGB A;  3DBX A;  3M1B A;  4GKS A;  2OI9 A;  5DEG A;  3L3I A;  3QFD A;  5HGB A;  1JUF A;  4WU7 A;  2X4U A;  4PRP A;  5D9S A;  2BNQ A;  4Y16 A;  1HSB A;  5C0J A;  3LKQ A;  1NAN H;  5EU5 A;  1OSZ A;  4F7P A;  1T22 A;  4Y4K A;  3V5D A;  1EXU A;  3BHB A;  5MEN A;  1X7Q A;  1N5A A;  3MV9 A;  1MHE A;  5D7J C;  4I48 A;  4QRP A;  4Z78 A;  4MX7 A;  3IT8 D;  3P4O A;  2MHA A;  4O2E A;  2Q7Y A;  3MGT A;  5J1A A;  2FZ3 A;  5BRZ A;  4LHU A;  1LEG A;  3MRO A;  5C0B A;  3BXN A;  4NQD A;  2H26 A;  3HCV A;  1S9W A;  5IVX A;  3BEV A;  3GMM A;  5E6I C;  4U1J A;  4WU5 A;  3WL9 A;  3LN5 A;  3CPL A;  3RUG A;  3VXN A;  5B39 A;  3L3D A;  3MRI A;  4G59 A;  4U1S A;  3C9N A;  4PRI A;  5HYJ A;  4L29 A;  2HJL A;  4JQX A;  4F7C A;  3HUJ A;  2XPG A;  1GZP A;  5HHO A;  3LN4 A;  1B3J A;  2E7L E;  3CH1 A;  1T1Y A;  4L4V A;  4XXC A;  1TVH A;  4CVZ A;  3VFR A;  3HPJ A;  3CCH A;  4HWZ A;  3MRC A;  3H9H A;  1DUY A;  2AXG A;  3RWI A;  5F9J A;  3VCL A;  5IND A;  3MGO A;  3TN0 A;  5FDW A;  3L3H A; 
#chains in the Genus database with same CATH homology
 4HKJ A;  5EUO A;  5DEF A;  1HOC A;  4PJ8 A;  4X6E A;  3SKM A;  2ZSW A;  2DYP A;  3X13 A;  3ARD A;  1W0W A;  5SWZ A;  3JTS A;  1I7U A;  5IB4 A;  4ZUT A;  3I6K A;  1S9X A;  4U1M A;  3FQU A;  4U1H A;  1KBG H;  1W72 A;  4LNR A;  3T1F A;  1NAM H;  4G8G A;  3BO8 A;  3ARE A;  2X4P A;  3BZF A;  4MNG A;  4MNQ A;  3U0P A;  5E8P A;  2VE6 A;  1TVB A;  5MEQ A;  3MRQ A;  1ZT7 A;  5C08 A;  3KPM A;  4JFF A;  3GSR A;  4GKN A;  3VFN A;  2FYY A;  3GML A;  3VJ6 A;  5AD0 A;  1DUZ A;  1ED3 A;  3MRP A;  4QRR A;  1XR8 A;  3FT4 A;  4PGC A;  3TBS A;  1E28 A;  3ROO A;  3PWV A;  2FIK A;  4PRA A;  1W0V A;  4L9L C;  3D3V A;  5HHQ A;  3L9R A;  3MRD A;  3ECB A;  5IM7 A;  1LDP H;  1DDH A;  3PWN A;  1EFX A;  3MRJ A;  3TF7 A;  1ZVS A;  3KPO A;  4S0U C;  1T0M A;  1XZ0 A;  4L4T A;  5FA4 A;  5HGD A;  1K5N A;  3V5K A;  4Y2D A;  3BH8 A;  3MRG A;  4PRD A;  4K7F A;  1S7Q A;  1R3H A;  2CLV A;  3MRE A;  3TBW A;  3O3E A;  1C16 A;  1VGK A;  3E3Q A;  3D2U A;  3KPQ A;  4U1L A;  1A6Z A;  3ARF A;  3P9M A;  1A9B A;  3GSN H;  3LKS A;  2BVQ A;  5H94 A;  3RWD A;  3GSQ A;  5GSV A;  3SPV A;  3P4N A;  2H6P A;  1EEZ A;  1QO3 A;  3GSW A;  3FFC A;  4U6Y A;  5C09 A;  3VFT A;  3ILP A;  2ZSV A;  3H7B A;  1CG9 A;  4LCY A;  1JGE A;  2BSS A;  2X4S A;  1XR9 A;  3O3A A;  5D2N A;  3BW9 A;  1ZS8 A;  1T20 A;  4NQV A;  4WDI A;  1HHG A;  1ZHN A;  3D25 A;  3VH8 A;  3KPS A;  3FON A;  2RFX A;  3FT2 A;  3RZC A;  1MWA H;  1YDP A;  3ARB A;  1OF2 A;  3P73 A;  3TO2 A;  3SKO A;  1LK2 A;  2UWE A;  1JPF A;  5GSR A;  4ZFZ A;  4L8S C;  4JFD A;  1FFO A;  2HJK A;  3BWA A;  3ROL A;  1Z5L A;  3VXO A;  3C8K A;  1N3N A;  1LQV A;  1U58 A;  3KLA A;  3VRJ A;  5MEO A;  1S7S A;  2X4Q A;  4HUW A;  3VFW A;  4PRH A;  3KPR A;  3FQX A;  4L8D A;  3VRI A;  1KJV A;  4MQ7 A;  5EU4 A;  3QDJ A;  4JFP A;  1T80 A;  3SJV A;  2ZOL A;  4MJ5 A;  1JGD A;  2GTW A;  3ARG A;  3MR9 A;  1QRN A;  4NNY A;  1E27 A;  3PQY A;  3ERY A;  3MV8 A;  4G9D A;  1KJ2 H;  4PGB A;  2FWO A;  1JF1 A;  2CKB H;  2X4R A;  4N0F A;  5HHN A;  1T7W A;  4EI5 A;  3JTT A;  3OXR A;  3MRN A;  3OXS A;  3WUW A;  2FO4 A;  5MER A;  3GMR A;  2GJ6 A;  3BP7 A;  3PWL A;  1S7X A;  2PYE A;  3QUZ A;  5C0G A;  2VLL A;  3P77 A;  1GZQ A;  1HHH A;  3UPR A;  3TBY A;  3RL2 A;  1FG2 A;  5HGH A;  4F7M A;  2VLR A;  3O3D A;  4MJI A;  3FOL A;  3O8X A;  4EN3 C;  4EUP A;  2P5W A;  4N5E A;  3LKN A;  1ONQ A;  3ILQ C;  3E6H A;  2VAB A;  3GMO A;  4NNX A;  3TBT A;  1I1A A;  4IRS A;  4FTV A;  1B0G A;  4PDC E;  4ZAK A;  1KPU A;  1RJZ A;  1KPR A;  1VAC A;  2AK4 A;  2YPK A;  1HHJ A;  4PJ7 A;  4PV8 A;  2OL3 H;  3NFN A;  2CIK A;  4O2C A;  4U1K A;  4PJF A;  4V3E B;  4U1I A;  1I7T A;  5L2J A;  3DTX A;  3TO4 A;  1M05 A;  2X4N A;  3PAB A;  4O2F A;  5FA3 A;  1KPV A;  3H9S A;  1KJM A;  1B0R A;  4NQC A;  3S6C A;  5IB5 A;  3FTG A;  2BVO A;  1QLF A;  2VAA A;  4Y4H A;  4NO0 A;  3RWJ A;  3QDG A;  1JHT A;  1QSF A;  3TJH A;  2VLJ A;  3X14 A;  4Z77 A;  3DX6 A;  3VFV A;  2WY3 A;  2D31 A;  2J8U A;  1I1Y A;  3MV7 A;  3MA7 A;  2AV1 A;  3FQR A;  4HS3 A;  4V3D B;  4Y4F A;  5IB2 A;  1RJY A;  3FQN A;  4JFO A;  5F1I A;  5ISZ A;  3SDX A;  3UTQ A;  2BSR A;  4ZUS A;  1BQH A;  1S7R A;  1YN6 A;  3OV6 A;  5ACZ A;  5IEH A;  4JRX A;  1P4L A;  5HGA A;  3TZV C;  4L3C A;  1I1F A;  2AXF A;  5IB3 A;  4IRJ A;  4PRE A;  1HSA A;  4NO5 A;  2CLR A;  4PP8 C;  5BJT A;  1YN7 A;  1FO0 H;  4LCW A;  3MRL A;  1XH3 A;  4PRB A;  1QQD A;  4PRN A;  1VAD A;  3D39 A;  3LKP A;  3GMN A;  5D2L A;  5ENW A;  1HYR C;  1A1N A;  3QUX A;  3RWF A;  1TMC A;  1A9E A;  3SCM A;  4PR5 A;  4G9F A;  5E8N A;  3FQT A;  1ZT4 A;  2GAZ A;  4LCC C;  4QOK A;  1T21 A;  4D0B A;  4MVB A;  3ES6 A;  1LEK A;  4E5X A;  1K8D A;  1I4F A;  4PGE A;  1QSE A;  1S7T A;  3O3B A;  1ZT1 A;  3FOM A;  4NO2 A;  5D5M A;  1BII A;  1JE6 A;  5C0E A;  4PJB A;  1UXS A;  3DX8 A;  3SDA A;  5HHM A;  1AKJ A;  3GMP A;  4PJE A;  2YPL A;  3MRB A;  4UQ3 A;  3B6S A;  3QUL A;  3GIV A;  2AV7 A;  3TBV A;  1A1O A;  3VFS A;  5EU3 A;  3LKR A;  2NX5 A;  2CLZ A;  2GUO A;  1UXW A;  3GSU A;  4G8I A;  3MRK A;  3AU1 A;  4JFQ A;  4NQX A;  2A83 A;  3M17 A;  3FT3 A;  3P9L A;  4PJG A;  3SDC A;  2ZOK A;  1LD9 A;  1T1Z A;  4NSK A;  5D7L A;  4MJ6 A;  3KYN A;  2CII A;  3PWP A;  1P1Z A;  3VWK A;  3CC5 A;  4HUU A;  4PG2 A;  2X70 A;  3X11 A;  5IEK A;  3UTT A;  3MRR A;  5MEP A;  2GIT A;  3IXA A;  4PV9 A;  1WBZ A;  2VLK A;  3VXR A;  3DMM A;  3MRM A;  5EO0 A;  1Q94 A;  5C0F A;  1FZK A;  1MHC A;  3VFM A;  1RK0 A;  1ZHK A;  3FRU A;  1FZJ A;  4JRY A;  5C0D A;  2GTZ A;  3PWJ A;  3QQ3 A;  5IB1 A;  4WO4 A;  1DE4 A;  4U1N A;  4HV8 A;  4CVX A;  4F7E A;  2X4O A;  3HG1 A;  1ZHB A;  3VXM A;  3GSV A;  5J6G A;  3GSX A;  4NQE A;  4PJ9 A;  4UQ2 A;  3FQW A;  3L3K A;  2ESV A;  4FFE X;  4D0D A;  5BS0 A;  4L3E A;  3TPU E;  4PJ5 A;  2F53 A;  3L3G A;  3I6L D;  3MYJ A;  2BNR A;  2F54 A;  3VFP A;  1KJ3 H;  1L8J A;  3VXP A;  4GUP A;  3D18 A;  3UBX A;  3KPP A;  4F7T A;  2BST A;  1G7P A;  4HUX A;  1LP9 A;  1KCG C;  1N59 A;  3LV3 A;  1G6R H;  1MI5 A;  4PJX A;  3G08 A;  2AKR A;  4L8C A;  3QEQ A;  4PJA A;  5F1N A;  3O4L A;  4NHU E;  1AGE A;  1WBX A;  1T7Y A;  2V2W A;  2XFX A;  1T7X A;  5E00 A;  1YPZ A;  4NO3 A;  1AGD A;  1BD2 A;  3RL1 A;  3QFJ A;  3TVM A;  3CVH A;  1ZSD A;  1CE6 A;  5EFI A;  3RWE A;  1G7Q A;  3BUY A;  3BH9 A;  3I6G A;  3O9W A;  3VFO A;  2BVP A;  3L3J A;  3SDD A;  3WS3 A;  5C0I A;  1T0N A;  3JVG A;  3REW A;  1S7V A;  2YEZ A;  2HLA A;  3DXA A;  3QDM A;  3TA3 A;  5C07 A;  4JQV A;  1SYS A;  3HAE A;  4ZUU A;  3VWJ A;  3WLB A;  1QR1 A;  3RWC A;  3QI9 A;  4ZUW A;  4PJC A;  3RGV C;  4I4W A;  3KPL A;  5DDH A;  5E9D A;  4APQ A;  1T1W A;  3W0W A;  1EEY A;  3PWU A;  1IM9 A;  4G43 A;  5D7I A;  5J6H A;  4L8B A;  3QZW A;  4WW2 C;  5FKP A;  1S9Y A;  3JTC A;  5INC A;  1FFP A;  3RTQ A;  4WWK C;  4X6F A;  4CW1 A;  3TID A;  1BZ9 A;  5SWQ A;  4U6X A;  5C0A A;  4QRT A;  2X4T A;  4NT6 A;  5EOT A;  5IRO A;  3QQ4 A;  1AGF A;  3KWW A;  4IIQ C;  3TIE A;  4Z76 A;  1I7R A;  5C9J A;  3HLA A;  2PO6 A;  3RWG A;  5B38 A;  1AO7 A;  3DX7 A;  3WS6 A;  3P4M A;  1OGT A;  3BZE A;  3BVN A;  3GSO A;  1KTL A;  3VFU A;  3CDG A;  3KXF A;  1INQ A;  2P5E A;  3CZF A;  4PJH A;  2BCK A;  5E8O A;  5F7D A;  4QRS A;  5JHD A;  3T8X A;  3BEW A;  3LKO A;  3VXU A;  4ONO A;  1RK1 A;  5SWS A;  4IHO A;  1ZAG A;  4JFE A;  4HX1 A;  1P7Q A;  1AGC A;  4WUU A;  3E2H A;  3V5H A;  1FZO A;  1SYV A;  4HUV A;  3HE6 A;  2C7U A;  5C0C A;  4WJ5 A;  3OX8 A;  5EO1 A;  4G42 A;  4N0U A;  3TFK A;  2JCC A;  1S7W A;  3BGM A;  3BP4 A;  2GT9 A;  3HE7 A;  3X12 A;  1HHI A;  1HHK A;  4K71 B;  3QUK A;  4PJI A;  3KPN A;  1T7V A;  1FZM A;  1IM3 A;  3RWH A;  5HHP A;  1A1M A;  5BXF A;  3GJF A;  3AM8 A;  4N8V A;  4X6D A;  4ZUV A;  4PJD A;  3MRH A;  3W39 A;  3QUY A;  1JPG A;  1M6O A;  1JFM A;  1T7Z A;  4E0R A;  5L2K A;  1UQS A;  3E6F A;  3GMQ A;  4D0C A;  1N2R A;  4PGD A;  4QRQ A;  1ZHL A;  2HN7 A;  1PQZ A;  1S7U A;  1QVO A;  1WBY A;  1OGA A;  3KYO A;  1FFN A;  1CD1 A;  1T1X A;  2F74 A;  3MRF A;  4MS8 A;  4N0C A;  3VXS A;  1QEW A;  1S8D A;  4ELM A;  5EU6 A;  1NEZ A;  4MXQ A;  4X6C A;  4QRU A;  2V2X A;  3UTS A;  4PG9 A;  2NW3 A;  3B3I A;  1AGB A;  3DBX A;  3M1B A;  4GKS A;  2OI9 A;  5DEG A;  3L3I A;  3QFD A;  5HGB A;  1JUF A;  4WU7 A;  2X4U A;  4PRP A;  5D9S A;  2BNQ A;  4Y16 A;  1HSB A;  5C0J A;  3LKQ A;  1NAN H;  5EU5 A;  1OSZ A;  4F7P A;  1T22 A;  4Y4K A;  3V5D A;  1EXU A;  3BHB A;  5MEN A;  1X7Q A;  1N5A A;  3MV9 A;  1MHE A;  5D7J C;  4I48 A;  4QRP A;  4Z78 A;  4MX7 A;  3IT8 D;  3P4O A;  2MHA A;  4O2E A;  2Q7Y A;  3MGT A;  5J1A A;  2FZ3 A;  5BRZ A;  4LHU A;  1LEG A;  3MRO A;  5C0B A;  3BXN A;  4NQD A;  2H26 A;  3HCV A;  1S9W A;  5IVX A;  3BEV A;  3GMM A;  5E6I C;  4U1J A;  4WU5 A;  3WL9 A;  3LN5 A;  3CPL A;  3RUG A;  3VXN A;  5B39 A;  3L3D A;  3MRI A;  4G59 A;  4U1S A;  3C9N A;  4PRI A;  5HYJ A;  4L29 A;  2HJL A;  4JQX A;  4F7C A;  3HUJ A;  2XPG A;  1GZP A;  5HHO A;  3LN4 A;  1B3J A;  2E7L E;  3CH1 A;  1T1Y A;  4L4V A;  4XXC A;  1TVH A;  4CVZ A;  3VFR A;  3HPJ A;  3CCH A;  4HWZ A;  3MRC A;  3H9H A;  1DUY A;  2AXG A;  3RWI A;  5F9J A;  3VCL A;  5IND A;  3MGO A;  3TN0 A;  5FDW A;  3L3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...