4N5HX

Crystal structure of esterase b from lactobacillus rhamnosis (hn001)
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
315
structure length
315
Chain Sequence
MADEEAMLAKVQASWAQTAARDKARYADERVPEDVHWETEYRYEQSADPQQTLNLYYPAKRRNATMPTVIDIHGGGWFYGDRNLNRNYCRYLASQGYAVMGMGYRLLPDVDLRGQIQDIFASLRWLSHFGPQRGFDLDHVLLTGDSAGGHLASLVACIQQSAELQELFGVSRVNFNFTLVALVCPVAEPSKLPEAAGDMSDMAAFYLDKLSGGDQALVDHLNFSQVVKGLDLPPFMLIGGQNDSFYLQSQALLKVFDANHVTYTTKLWPASAGPHLKHVFNVQHWEWPESIETNLEMLRTFDALSKQQDQAEENE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase/lipase
publication title Crystal structure of ESTERASE B from Lactobacillus Rhamnosis (HN001)
rcsb
source organism Lactobacillus rhamnosus
molecule tags Hydrolase
total genus 128
structure length 315
sequence length 315
ec nomenclature
pdb deposition date 2013-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n5hX00
2XQFA 2CJPA 4UFNA 2ONCA 4TPKA 5FRDA 3LIIA 4XX1A 2QTBA 3E0XA 3PICA 5CT4A 3AZPA 2XMBA 4J0JA 1AKNA 1CUIA 3OG9A 1ZGBA 2B61A 2Y6UA 3H0CA 5EIHA 2GBGA 4I4CA 3WL5A 2PUHA 1B6GA 3WIOA 5EHNA 4YASA 2PSJA 5AK3A 4F0JA 5JADA 1H2XA 1LLFA 2W22A 1YR2A 5C81A 5AKLA 2VT7A 4OYYA 4EUSA 4G5XA 3I2FA 2EDCA 4Q05A 2C58A 4B85A 3O4IA 1DU4A 3M82A 3VVMA 1K5PA 2ACEA 4KRXA 5ALEA 1XRLA 3BIWA 3WMRA 4BC0A 3ZPXA 5BWBA 4UHHA 3ZI7A 4K2AA 2V9ZA 5JAHA 1QIKA 3ICVA 4PV7A 4UFPA 3WA6A 3DD5A 2QJRA 4K5QA 1JMYA 4Z49A 5KBYA 1FSSA 2WFMA 5DNUA 5DYYA 1QIMA 5IVKA 4U2GA 1VE6A 5F4ZA 2WM2A 2I03A 2HA2A 2XMSA 4ZRDA 3WIBA 4BCBA 4BCDA 3PF8A 5E4YA 2ZJ6A 3R3UA 1IZ8A 2ZVDA 2G63A 3G02A 2FX5A 3G7NA 3T4UA 3E3AA 1YAJA 4L72A 4N8SA 4Q3KA 1XZJA 4L3WA 1W4LA 4P93A 1WOMA 1CRLA 5AKYA 1ZIXA 4BC1A 4EA6A 1K4YA 5FV4A 1TAHA 1VLQA 2WQZA 3EIOA 3NOXA 3CN9A 3WLAA 5AKEA 4NVRA 1AMNA 5ALWA 3ESCA 1FFCA 1RYYA 1CR6A 2CUTA 4UUQA 5AI9A 1Q83A 4EY4A 5D6OA 1RWQA 3AIKA 4G8CA 5DJ5A 2WUFA 3HXKA 4Q1VA 5HK9A 3H1BA 1WHTA 3WKBA 4XWGA 2HRQA 1L7RA 1UK6A 2PX6A 1A7UA 3AZQA 2FJ0A 4KAAA 1JFRA 3HYSA 1XZBA 2WIGA 2CKMA 5HF6A 2PUJA 3A6ZA 2XMRA 3IUQA 2YXPX 1R50A 5YASA 3STVA 2WU4A 2WFLB 5DWDA 3BJRA 4PW0A 3STTA 5LKRA 2RGUA 1KU6A 4FLMA 3D4LA 1O6GA 4HXGA 3WYDA 3DOHA 5AKZA 4E46A 2C5GA 2QR5A 5ALVA 3IVMA 4CIAA 2J3DA 3DL4A 4IHAA 2O2IA 2PSEA 3WKCA 1QGED 2XUJA 4B81A 4W1QA 2VEOA 1W1IA 1UOQA 5CTAA 1LZLA 3CN7A 1GZ7A 4H0CA 3I2GA 5FPQA 7YASA 1CUFA 4X90A 2PSHA 3QVMA 5ALNA 2WLSA 4FFVA 4RGYA 1ZGCA 3TEJA 4ZI5A 2HL6A 1Q84A 4Y2YA 5I9IA 3BDIA 4M0MA 1LPNA 4AX4A 2BUAA 3R3YA 3BF8A 1XZEA 2BGNA 4GXNA 1C4XA 2BCEA 2OCLA 1XKLA 3A2MA 1FFAA 2HA7A 1EDDA 3DYVA 1XZGA 4CCWA 1ZI6A 2CMFA 4W1SA 4G9GA 1DT3A 1VKHA 5AK4A 1E89A 4BZZA 2VAXA 1LPPA 2XUHA 2QRUA 1UWCA 2PSFA 1IVYA 5EIAA 1ZD5A 4BDTA 4WDRA 3C8HA 3V1NA 1G66A 1XZFA 2JGJA 3I2HA 3EQ7A 3MUOA 2H7YA 2QJWA 5IVHA 1HPLA 2VJBA 4EZIA 4O08A 2PU7A 5AI4A 1GPKA 3V1MA 3O0DA 4GWLA 1QLWA 3V9AA 4PSUA 1QIGA 1QTRA 2HFJA 5JANA 2RHTA 4W1PA 2VJDA 2G5PA 5KWJA 4CG1A 3DKKA 4DLNA 1EK1A 2ZJFA 4PF1A 5DTIA 3IB3A 1JU3A 5AM4A 2WG1A 4A5SA 1UKCA 2B9VA 4AB1A 4J0HA 1L7QA 2DQZA 1TRHA 2CBGA 1U8EA 5AIBA 1TCBA 2WILA 5ALPA 3O9VA 3BDVA 3H2HA 4KE8A 3P2MA 3DS8A 4RPCA 5K3DA 2VJCA 1CUJA 3AIOA 5LZ8A 2Y2UA 4PQEA 1EHYA 4MWTA 1XQXA 4IH1A 2OXEA 2W6CX 5CURA 3ANSA 3H2IA 2VSQA 3WZMA 5JZSA 1XZAA 4FLEA 4BTVA 1JJIA 3BXPA 4OU5A 4LXGA 1VA5A 4Y2RA 2OQVA 3IUNA 3ESAA 3F8SA 2JGLA 1H23A 1MU0A 3G0IA 1UT6A 3I6MA 1GGVA 4ZREA 4H18A 3R0VA 4GECA 5AI8A 3QMWA 5KWIA 3VJLA 4JNCA 3C6YA 4UBKA 4QDOA 5C8ZA 2VTVA 2X76A 3IURA 2OLEA 1QFMA 4DSAA 4N8EA 5ALOA 2CB9A 3A2LA 3KSRA 4WFKA 1UK8A 1DWQA 1F6WA 3WK5A 5D3KA 2RONA 4DM7A 1FFDA 3FAKA 1MTZA 2GBFA 3G0GA 1ZICA 3LS2A 2WJ4A 3QH4A 1WB5A 4X3CA 2Y2VA 1MO2A 2WUGA 5DNVA 4G4IA 3QPDA 1T4MA 4LHEA 1SCKA 2WIJA 3H18A 4CG2A 4CFSA 1BE0A 2PU5A 2EDAA 1G5FA 1XKTA 3W04A 2XT0A 4AMZA 4IO0A 5J3JA 1N8SA 1MAHA 3ILSA 5ALKA 5EFZA 1CUBA 1QONA 1ODSA 2XI4A 2G4LA 2JGKA 3IUMA 5BOVA 3I2KA 1CLEA 2WFLA 4AO8A 4FBMA 4WCVA 3FYUB 5K3CA 4OU4A 5CT9A 3G0CA 3H19A 4BAGA 3H2JA 3PE6A 3ZLVA 2WTNA 4ARBA 2V98A 4V2IA 2JGFA 4HS9A 1BU8A 1F8UA 5LZ7A 3WK8A 2OCKA 4IH9A 4BZWA 1XZCA 5AM2A 3Q0TA 1XRQA 3F98A 1ZI8A 4B0PA 1ETHA 4D9JA 5AM5A 3PFCA 2I78A 4PSCA 4QLOA 2OGSA 4WJLA 4BAUA 3OOSA 3H1AA 1YAHA 3N2ZB 4PO3X 3D59A 4K6KA 3W9UA 1H22A 5DYWA 2XUIA 3R3WA 1YSCA 3QPCA 1R88A 3WQHA 3HC7A 4UHBA 3DQZA 2HU5A 1N5RA 3GUUA 4GDMA 3H17A 4BCCA 1YS2X 3C87A 3FOBA 1MAAA 4ITVA 5LZ4A 2XMQA 1UK9A 4NMWA 2JBWA 4G9EA 2O7RA 5CH5A 1GKLA 1CVLA 3HEAA 1XZDA 3T52A 3PFBA 1E3QA 4LKOA 3ZWQA 1UOOA 3WWCA 4HZGA 3VXKA 4BP8A 2OQIA 4XVCA 3QPAA 3MVEA 1SFRA 3IBTA 3R3VA 3DKRA 2ZYRA 4X6XA 2O2HA 1G42A 3STWA 4DMHA 3FBWA 5AOAA 1OXMA 2WHQA 3R3ZA 3VJKA 5K5EA 1XLWA 2B20A 4QZVA 4HRYA 4OB6A 1BEZA 1CUAA 2VJAA 4W9RA 1WHSA 3C6XA 3SWWA 1CUUA 2C0QA 5LKAA 1YA4A 5ALFA 1JMKC 4LIPD 5EIEA 4ZWNA 2AJBA 4J0GA 3O95A 1YASA 3DOIA 4KE6A 3C45A 4JUIA 4ETWA 1MX1A 2FJPA 2PSDA 4WFIA 4KACA 1TK3A 4JEIA 2GZSA 1H2ZA 1DINA 3I2JA 5BWCA 2QS9A 4JH0A 5HF5A 3L1IA 5SYMA 1QOZA 3O4HA 3YASA 2Z8ZA 1GKKA 4CCYA 2R11A 1PJAA 3WWPA 4XIIA 1TCCA 4QDXA 2VF2A 5FXMA 5BV7A 2XMDA 1AX9A 5CT6A 1K6EA 4QWWA 2HA5A 3HI4A 5A7GA 2YYSA 3I6YA 4HTAA 2QUAA 5HZGA 1ORWA 5ALMA 5I7UA 2XUFA 4GEGA 1THGA 5K3BA 2AJCA 1LNSA 4H7EA 4JYMA 4KAFA 3STXA 5FOQA 1EXWA 3FVRA 3GA7A 3HACA 1JJFA 3JW8A 4Q82A 4FLFA 5AK5A 4FHZA 4MYSA 4Y2SA 4DMKA 2RAUA 2VA9A 4B6GA 2HDWA 1QIEA 2AJ8A 1JU4A 1EDBA 3PUHA 4FFWA 1XRNA 2WFZA 2XQIA 3K6KA 1IMJA 1CIJA 2GYUA 1MPXA 1ODTC 5E4JA 5ALHA 5ESRA 2HA4A 1DWPA 3WZLA 1ZJ4A 2VT6A 4J3JA 1DQYA 1SC9A 3N0TA 4BE9A 3I28A 5IH7A 3QYJA 1MX5A 1A8UA 1EA5A 2QT9A 3DL7A 3G9UA 4RNCA 3PUIA 3VDXA 1P0IA 4UBNA 1YS1X 3H04A 4FDMA 1USWA 2HA6A 3G9TA 4UHEA 5FUMA 4G1FA 4Y2PA 5ALZA 5T4BA 4XJVA 1CUZA 3I1YA 2C7BA 4AN1A 1QZ3A 2V97A 5JZ9A 3FYUA 4ZGBA 5FLKA 1MN6A 4U2FA 2OGZA 4F21A 4MQLA 3I2IA 1DX4A 2BUBA 1BROA 3D5EA 1FFBA 3B3QA 4OD0A 5FDFA 1Q0RA 1VA4A 4U2CA 4OCZA 4DNPA 1CUCA 1EVEA 5HQ3A 3CXUA 5JAUA 3C6ZA 4AO6A 1GPLA 3S2ZA 3ZLUA 4G8DA 1L7AA 1SCIA 2ZYIA 3C5WP 3DDUA 3G0BA 5CXUA 2ZSIA 1U4NA 3L1JA 3NWOA 3LLCA 3AUKA 2HHAA 4MJ3A 5LP1A 3WWDA 5C8XA 4QLAA 4YPVA 1AQLA 3C8DA 3D2BA 1TIBA 3L1HA 1ODCA 4OSEA 2RI6A 3LIPA 4TVKA 4B82A 1A8SA 2DCMA 1BCSA 2ACKA 4PSDA 3AFIA 4BRSA 5SYNA 2QOEA 4AO7A 5KREA 1R3DA 4KRYA 3KWFA 3C6BA 1LBTA 3FYTA 3IUJA 5AI0A 5HCUA 2X5XA 4B84A 4MQMA 3WA7A 4FNMA 5AKIA 2CZQA 1Y7IA 3S8YA 1IUNA 6YASA 3RM3A 1S8OA 2OGTA 2WUDA 4BVLA 1PFQA 2WHRA 2XUGA 1EB9A 4Y2QA 3Q8WA 5CT8A 4BDSA 3RARA 5AKGA 4QDZA 2WIKA 1R9MA 5HF8A 5C7YA 1MJ5A 2RHWA 1BS9A 4E11A 2LIPA 4GLBA 3IDAA 2OAEA 2QXTA 3G9XA 4S0XA 5ALUA 2VQ6A 1QIJA 4Y9SA 5CW2A 3K9BA 2DQYA 1CQWA 4G4GA 4B7ZA 4X00A 4UFOA 1K8QA 3HLKA 1ACJA 1GQRA 4CCYB 2HA0A 3HZOA 2BAGA 4DNQA 5JD6A 1WPXA 1I6WA 5CBKA 1XLUA 4LYDA 1QO7A 1HDEA 3KXPA 5E4TA 4JYPA 2DHCA 4BATA 3WK6A 4BE4A 2ZYSA 3MGAA 3UMJA 3PDCA 1CUVA 1LPAB 1TQHA 3GBSA 3VVLA 5C8VA 1EINA 4J0KA 5AKKA 3WJ1A 3FLAA 2E3JA 4UHDA 3VJMA 4C88A 1VXOA 5DNWA 3CCCA 2H9YA 4J7AA 1JI3A 4EBBA 3RLIA 1XZMA 1X2EA 4EB0A 1C7JA 5H3HA 1ZD2P 5AOBA 2CEKA 2BGRA 3ESDA 2J4FA 1LPOA 2H7CA 3W05A 3SK0A 1VJ5A 4KEAA 2FUKA 3D0KA 5JARA 4NS4A 5K3FA 1NU6A 2ROQA 2HFKA 4HXEB 4IH4A 2ORYA 4WY5A 1AUOA 1M33A 1EK2A 1XZIA 1FFEA 3LCRA 4H7JA 2XUKA 5ALXA 1BN6A 2D0DA 3UUFA 1X2BA 2O7VA 5EHZA 1F0NA 5IVDA 4C4ZA 4B80A 2AXEA 4K6GA 4IQ4A 5A71A 4FMPA 4UBLA 3KWJA 5DLPA 1HL7A 3GZJA 3U0VA 3C43A 4YX9A 1A8QA 1HLGA 1THTA 4QA9A 3WKDA 3KD2A 4UBMA 2WTMA 5HKAA 2BUCA 1WM1A 4AZ0A 1FJ2A 2XE4A 1XZKA 3FLBA 4LXHA 2GBIA 2R8BA 4OB7A 1K63A 2VATA 2P8SA 2XUAA 3D2CA 4X97A 2WIDA 4H7DA 5EHQA 5AM1A 1XLVA 1NU8A 5ALGA 5CH8A 1DT5A 4FWBA 4C6HA 1BEEA 4DSZA 4QEKA 4Q3LA 4J0DA 1OILA 3EBLA 3DCNA 4H7KA 5ALSA 2AJLI 5FP0A 5JZBA 1DWOA 4NZZA 2WJ3A 5A7FA 3FLEA 2XLCA 4P92A 5AJHA 1AZWA 1KU0A 3FSGA 5HQ3B 2Z3ZA 1VZ2A 1QFSA 2HIHA 4P9NA 2EEPA 1UKBA 2I3ZA 4FTWA 5LZ5A 1CQZA 4HVTA 1H2YA 4X6YA 4X85A 4B0OA 2QKYA 3D2AA 4YK7A 3QMMA 2XUDA 1ZOIA 2O2GA 3BWXA 2XMZA 1TKRA 3AZOA 5AP9A 3WL8A 1XROA 4KAJA 3H2GA 1LPBB 1SOMA 4AQDA 4BB0A 3G8YA 3QBJA 2IIVA 1XQVA 4M0FA 5T4HA 4CI9A 1B41A 1F0PA 4F60A 3TGLA 5AM0A 5AICA 3QM1A 2GYWA 3BIXA 1QJ4A 4INZA 1UKAA 4N5IX 5CRIA 4C4YA 3ICWA 2WSLA 5EGNA 4RE6A 5ALRA 1QIIA 2WG2A 2HA3A 4A16A 4OUKX 1QIDA 3IA2A 2QMQA 3FVTA 2QVBA 5ALQA 1EX9A 4UBIA 4UHCA 3ED1A 5A7HA 2ES4A 1P0MA 2QZPA 3GROA 3LP5A 1D07A 1A88A 1WB4A 1OCEA 5AI5A 4LXIA 4ZV9A 4EY8A 4AXBA 5ALTA 3D7RA 5AK6A 1XZLA 5EHXA 3DNMA 3HABA 1P0QA 3MUNA 5ALJA 5I8PA 3ESBA 4I3FA 3GELA 3EQ8A 2C5FA 1EH5A 2YASA 2HRRA 5FPPA 2B4KA 2PPLA 1JJBA 4DMCA 2GBCA 3H2KA 4MWSA 1QTIA 1HQDA 2PM8A 1JT2A 1LPMA 4DYHA 1QO9A 5HF9A 3R41A 5IVIA 5IKXA 1SCQA 2BFNA 4WY8A 3ANTA 5ALYA 5EI5A 4H7FA 3F96A 5JIBA 2DHDA 5D7BA 2D5LA 3RKSA 2I3DA 2IX9A 3EQ9A 4I19A 1ACLA 4J0IA 1UZAA 4ZV7A 3HRHA 3I6ZA 1GT6A 3NUZA 3OURA 5K3FB 4BVJA 2Z3WA 2XB6A 4MEAA 4HRXA 4C01A 1DTEA 3M81A 3U1TA 2BJHA 4X7BA 4WDQA 4G4JA 4HAIA 3WK9A 1W52X 4UPDA 1QIFA 2QXUA 5JAOA 1XRPA 1J2EA 3NGMA 4UBJA 2WUEA 4B9AA 4GHWA 1BRTA 3R3XA 3F97A 2HU8A 4QWMA 3W2TA 3TRDA 3V48A 3WYNA 2GZRA 4C4XA 5HKBA 1LBSA 2XUOA 1E66A 4QNNA 3OC0A 3WWEA 2NW6A 3AINA 4TGLA 2XQKA 1HBJA 1CPYA 2OAGA 1AGYA 3WKAA 1UFOA 3E1GA 3AJAA 4DNOA 4GBGA 1IZ7A 4KE7A 2G5TA 2JF0A 1MNQA 4DMFA 2JGMA 1MT3A 4QDTA 4U2BA 4BP9A 4KE9A 5JAPA 2WHPA 5AO9A 2XUQA 3DJYA 4CIBA 4H7IA 5JATA 1AC5A 4OB8A 4ZXFA 2JEZA 4EY7A 1XFDA 3G0DA 5LYYA 1VXRA 1JKMA 1P0PA 5T4EA 1J06A 4QDUA 1YCDA 2PBLA 5ALDA 4Q3OA 4AN0A 3HSSA 3HJUA 2HU7A 2XLBA 2OCIA 1CUWA 4CG3A 1EB8A 1LZKA 1DQZA 2QUBA 1CUSA 3W9BA 1VOTA 1CUXA 2OPHA 2Z5GA 1CUDA 5A62A 5HFAA 2IITA 2XUPA 3ZLTA 2RIPA 2BKLA 4W63A 3B12A 3KOOA 4K6HA 3GFFA 5AI6A 2PL5A 2Y1KA 1ZI9A 3F9CA 4J0CA 4KR0A 1Y7HA 2UZ0A 1UOPA 3QZUA 1J07A 4MYDA 1Y37A 4KYVA 3RK4A 4BBZA 2DSNA 4HXFB 4UHFA 1R4ZA 5DTJA 2ZJ7A 5AOCA 4DTCA 1AURA 4PNZA 4DGQA 3V1LA 1ZJ5A 2WJ6A 3PI6A 1GXSA 5JYCA 4U2EA 4G8BA 3M3DA 5ISMA 1IUOA 3K2IA 4C87A 3I1IA 3FCYA 2YH2A 5JALA 5AKJA 3R40A 5AHXA 3A2NA 3O4GA 3O9MA 1N1MA 5K3EA 5ALIA 4QE3A 1LPSA 1BCRA 2VAVA 1BN7A 5AIAA 1CUEA 1NX9A 3IULA 2DFPA 2DR0A 4BYMA 4Y2UA 2XMGA 3CCBA 3BL8A 3X3HA 4Y7DA 3WJ2A 5JD4A 1CEXA 2ECFA 3AIMA 3AILA 3F67A 4C89A 5AH0A 4X71A 4EHBA 2JGEA 2Q0XA 2V96A 2XQGA 4GI1A 4RE5A 3C70A 3FCXA 5HFNA 3DYIA 1GQSA 3QMVA 2Z8XA 3VKFA 1QIHA 1U2EA 2HM7A 5AKXA 1LGYA 1EDEA 5LLSA 2PVSA 1WB6A 1VE7A 3FNBA 5DYTA 1E8MA 1XZHA 4E14A 5ALLA 4W1RA 2QM0A 4Y2VA 4X93A 5JD5A 5D3ZA 3W06A 3OM8A 2ZSHA 3A70A 2ZYHA 1ISPA 2GYVA 4A23A 1XRMA 2K2QB 1IUPA 5CT5A 4FKBA 4H35A 5E2IA 2WIFA 2JEYA 2Y6VA 1EI9A 3DEAA 3SX4A 3BJMA 5CH3A 3VISA 4WFJA 5HK8A 4L9AA 1W6RA 1X70A 2WKWA 1R9NA 4H77A 3TJMA 1G4HA 5FKJA 1E8DA 4H7HA 1TCAA 3PF9A 4B9EA 5LZ2A 4N8DA 1ORVA 4GW3A 3E4DA 2PKYX 1YA8A 4N5HX 4X95A 2WU3A 1N5MA 1T2NA 5A6VA 1GPNA 1ZIYA 1KEZA 1XQYA 3M83A 4P08A 1CUYA 2JIDA 1YB7A 2XQJA 1W76A 1ZD3A 1CUHA 2J4CA 1UK7A 3G9ZA 3DLTA 2XDWA 4BAZA 4MXDA 3V1KA 3WWOA 3ZV7A 2C0PA 3STYA 1Q0ZA 3WK7A 5A2GA 1R1DA 5LZ9A 2WHPB 4B83A 4KJXA 3O4JA 1YB6A 3STUA 4ROTA 4EY6A 4U2DA 1DX6A 4Y2TA 1O6FA 3BF7A 2DHEA 3UUEA 5JASA 1H2WA 4BRZA 3KDAA 2OCGA 1MNAA 3QITA 4F5ZA 3WL7A 1U65A 4FOLA 4X6UA 2JGIA 3C5VA 4Q34A 1QE3A 3OPMA 2H7XA 1MX9A 2WG0A 4DNFA 3WI7A 1W75A 1PV1A 3FWHA 3OTQA 3JYHA 1XRRA 2H1IA 5CXXA 5CMLA 2XMCA 4AMYA 2J3QA 1WPRA 4EY5A 1WCYA 4ARAA 4Y2XA 1CFJA 2AJDA 4BVKA 1HKHA 3D3NA 1E8NA 3FSGD 1UXOA 3WL6A 4LYEA 1Z68A 4AZ3A 5AKHA 4MEBA 3IIIA 1EVQA 1ZD4A 4OYLA 2OG1A 1E5TA 4M0EA 1J1IA 1RP1A 5T4FA 3WKEA 4BTLA 1C7IA 4X94A 5LIPA 3EF3A 3FYUC 1CUGA 3WK4A 4OPMA 2C4HA 4Y2JA 3BE8A 4J03A 4X91A 4E15A 3JWEA 4UBOA 4FNGA 4L0CA 2HADA 5K3AA 1XQWA 4DIUA 3B5EA 5AM3A 3SC2A 1VZ3A 1CV2A 2X8BA 4FBLA 4X92A
chains in the Genus database with same CATH superfamily
1Z0UA 4F91B 3A9CA 2I1QA 2V7BA 1NULA 2FN7A 4YIKA 3AVXA 2VSNA 3IIMA 2KJQA 1EP2B 1FRQA 1DLIA 2PRYA 4LZOA 3N2YA 4WIAA 5EZYF 4ZT2A 3EJ6A 3UJ3X 5K4HA 1UPCA 3AKEA 5ITZB 4IGFA 3G8BA 3WRWA 5KJ6A 3CLRD 4RMJA 1UBCA 4QARA 1Z4IA 4D7AA 1UJBA 2GESA 4GZ3A 4UE2A 3CZ5A 3TOZA 3HUUA 1A76A 1Y7PA 3KV1A 3R8CA 2PE5A 2P4UA 3FJ1A 4MMZB 1YB4A 1BCRB 2HAEA 1QF7A 2WF7A 4IZOA 4TYQA 4DDHA 2V4ZA 2WI8A 1XAIA 3FMGA 1ZGBA 1RKUA 2YMMA 5J2UB 1EX6A 3MC1A 2WSIA 3EEYA 2ZJYA 4LJ6A 4G5QA 5F2NA 1X9IA 2C04A 1KS9A 5EIHA 4YTEA 3KDPA 5EXSA 1RWNA 4OAOA 1TM4E 2P68A 2ZTVA 3ONEA 4CEJB 4YCCA 2JCGA 4QLBA 5B7NA 4NPCA 1G9XA 1WV1A 2EQAA 2QTNA 5KSZA 1QRSA 4YRLA 1UBFA 2EFCB 1SUCA 5G41A 5ICFA 1U6JA 2X7JA 1L5VA 1WLSA 3HLTA 3QE4A 3S8YA 4PG6A 3VAZA 1B6GA 3BS4A 1NMEA 1MX3A 3UW1A 3WIOA 4R31A 3V33A 4DV7B 2P0YA 3BKXA 1FL9A 4YASA 5EHNA 3TDKA 2V4MA 3TDMA 1FFXB 2BBSA 2ZJ0A 2G1AA 3H1GA 4X60A 5LM3A 1LX7A 1OE0A 1EXDA 2FPUA 1Q1BA 3LWNA 1WCIA 2R2AA 7MDHA 3PHHA 1KH3A 1PT8A 5KPJA 4EUSA 1YOBA 4CMJA 2GCNA 3DOOA 1W35A 3TPFA 4ZARA 1V6SA 4DIBA 3LOPA 4D4LA 4IF6A 1Z0IA 2IOYA 2ZBVA 5CB4F 5HCIA 1DB3A 3QPBA 3SZLA 2RH5A 1IEVA 3ZWVA 4B85A 5CDHA 3U7GA 2IZOA 1WD7A 2QL9A 4CM5A 2D2VA 3KOMA 3Q3JB 2BHRA 3UAOA 1NKSA 2Z0MA 1B8PA 3GJ4A 3VI4B 5KEIA 1RAAA 3UJAA 4KRXA 4D25A 1IEXA 2COUA 4DZZA 4GI2A 3I4FA 4IIDA 1B43A 1O03A 2ODPA 2V4UA 5JAZA 2FFBA 3ZQUA 4A2PA 3BIWA 2ZUTA 3FPFA 3ON5A 3WRVA 3FUCA 3OAAA 5BWBA 4GYWA 3MMNA 4IO1A 4KK3A 3GFGA 1LNZA 4K26A 1G8GA 2BRUC 3R6TA 4LX8A 1UBNA 2RJNA 1ZHFA 4ZQFA 4YUAA 2VT3A 1SMKA 1M5UA 4N54A 1SBIA 4ZO6A 4EPRA 5IP5A 3AM3A 1THMA 5EP1A 3CLVA 1J8QA 2NVUB 2X1VA 1L5SA 3M9LA 2HIGA 2BOVA 1C3OB 2FMHA 4FYXA 2UYQA 4LISA 1RM0A 2IIBA 4OXNA 3MJSA 4I4TA 4LF6B 3UCFA 3QWFA 3AOEC 4QYIB 4UFPA 3VAYA 1U0SY 2P3QA 4OXIA 5LQCA 2QJRA 4M6WA 4O8CA 1CC1S 1YQWA 2OC9A 3HADA 2X19A 3MHPA 3MJFA 4KQ1A 2MYUA 4RHXA 1V1RB 1HZZC 1XHEA 3TMYA 3VDNB 3RSZA 1DS6A 1C2YA 3CUUA 4Q3EA 2AG8A 4M0PA 3HJHA 5LYJF 4E4RA 3EGIA 2A1UB 4MKGA 5AVOA 4Z49A 4XB6B 3FGZA 4BB5A 1MJHA 3L5KA 3B6JA 2AQ8A 1F4PA 3AB8A 1KEEA 1XQ1A 1P81A 1DCTA 1FF9A 1VKOA 5AXAA 3E3OA 5DYYA 2GRAA 3CWQA 2KSQA 2VL7A 1J09A 1DP4A 3WAKA 1MIOB 1XR3A 4HKTA 5LQRA 3THYA 2GWHA 4FR5A 5F7JA 2WM2A 1BVYF 3CRRA 2HA2A 2XMSA 1DKUA 2ZEJA 4ZRDA 5FOSA 1FZTA 2Z1DA 1T0JB 1KEWA 1HT2E 1NWCA 1X7ZB 1XC7A 3ACBA 4I8DA 4DREA 5REQB 4BEVA 1ULHA 1MJGA 2J0UB 5JDCC 3EEBA 1SN7A 4UXHA 3EEQA 1ORDA 2DMRA 3OMLA 4MVJI 2G63A 4NBRA 2OQRA 3R7LA 3DSRA 2V0GA 1IBSA 1XJ5A 3DTTA 3IVCA 4NHEA 3T4UA 3NHLA 4GSKA 3TZ6A 4AKGA 1YDWA 3C2QA 2RKWA 4RESA 3CEHA 2XNDA 4B6FA 2C88A 1Z29A 2HSWA 3MEQA 2R6AA 2B3TA 3L43A 3RHZA 3F7OA 3NG1A 1AJEA 3UN1A 1UXIA 2W2KB 2QPOA 2GKSA 3EAQA 4L3WA 1MA0A 4UE3S 3VR5A 3IDSA 5JQGF 4BLSA 4GD3Q 1N1EA 4HAWA 4GNRA 5LUBA 1PQ4A 4DEYA 5BVHB 1CRLA 2EKQA 1V5FA 2QRVB 5AKYA 4AMGA 4LZAA 4GMKA 1K9VF 1KJIA 4D0LB 1V8BA 4DILA 1X7DA 3EZ6A 4GT1A 2NU8A 3ZDQA 2ONJA 3A1EA 1VLQA 2YJ5A 3PQEA 3AHHA 3L40A 4PCAA 1DO2A 4K3UA 2B0CA 3ZV3A 1K7EB 1XVTA 4Z9AA 4R51A 3QA9A 3WLAA 5AJXA 2IH4A 4OI2A 2J67A 5AKEA 5B7QA 4WA7A 1R8YA 1NOJA 3A25A 4YQEA 1GPWB 5ALWA 2P77A 2X4DA 3I8SA 1TECE 4BHTA 3K9FC 2PMEA 1O9BA 4J3NA 3SZOA 5LQMA 1XG5A 2BFEB 2HQBA 4XUGB 1CR6A 1R5OA 2PG3A 3EJWA 4C6SA 1EX1A 4EY4A 4BV9A 3MIIA 1IXRC 2EFHB 4CM8A 3JQGB 2G9UA 2ECKA 1FRVA 2FSVA 4W82A 1U0TA 2PEYA 4ENSA 2WUFA 3HXKA 1RZVA 3JWGA 3HKBB 4Q9IA 1U9CA 1I7NA 1AGXA 2BFFA 1V3QE 3LX8A 4J9VA 4NENA 4TKLA 5A4FS 2QP4A 2O23A 1E3TA 2H51A 2GILA 2NUPB 2QN9A 3AH8A 3FRJA 3GCGA 4C03A 4RJJA 5HK9A 4DC0A 1NVEA 1WHTA 5FULA 3WKBA 3HNOA 3ORFA 2NYRA 3MJRA 4XDGA 2NQ8A 1GOTA 2DCUA 3CEPB 2PX6A 3F74A 3IVAA 4FNOA 4MRPA 4TL9A 1DSSG 4TM8A 4EOGA 3DZ8A 3MM4A 3WQQA 3IIKA 4EG4A 4KAAA 4ZOCA 3GRRA 4BY9E 1XZBA 5JI3E 4DDWA 3KELA 2CKMA 3T3OA 2FEOA 1M67A 1T9AA 2Q3EA 3TEMA 2H9IA 3OTWA 4OI0A 3T6KA 2JCVA 1JTEA 3A9WA 3F71A 2XWBF 4F4HA 2P2DA 1C0EA 2EJWA 4P84A 2YXPX 5YASA 3KKMA 3STVA 2WU4A 3LY8A 3QPVA 4X20A 3MA0A 5DWDA 2JA1A 2X13A 4Z53A 1WIWA 1UDXA 5GGXA 1JUDA 4O4JF 2IOFA 2MSEB 4PW0A 4JLVA 4AY2A 4FFMA 3QUAA 4JP1A 3COYA 2VRNA 4BWYA 4XIJA 5LKRA 2J9ZB 3ABQB 4EKEA 1YNSA 2R1TA 3SS9X 4P7KA 4Q7EA 1ZN8A 4C7JA 3KYIB 4YBRA 4XWTA 5FAKA 1O6GA 2ZZMA 4BRWA 3I4CA 1U80A 3FR8A 3GXBA 3WB0A 2GLTA 1JGTA 3IDQA 1OV6A 4NZYA 1E2GA 2EBUA 2IPXA 2QR5A 5ALVA 3C15C 4CIAA 3A9UA 3EVFA 4Q9HA 4WCFB 1GSIA 2OLJA 1PL0A 1P4AA 2J3DA 3CRMA 2I34A 4AY5A 4Z51A 1FFYA 3WKCA 1QGED 4QD3A 5KDDA 1O7JA 1EG7A 4EEXA 2XTNA 3HA2A 3FAZA 4HVAA 3IESA 3OJLA 4YJKA 1KMCA 5CA1F 1G98A 3WRXA 4QYSA 4RIFA 4YMGA 5CTAA 3U44B 4KREA 4HC4A 4V1CA 4LCBA 3A7EA 2AXNA 3JATB 1RI1A 4M9CA 3V4LA 2R7KA 2FW9A 3I8XA 5JSUA 2R6GA 2ZTHA 4CM4B 1GZ7A 2FZGA 1SJ9A 1LC3A 1B1AA 4OHBA 1LRLA 4O5AA 4XX0A 3U6BA 4X1IA 3HYTA 2PSHA 1NMQA 3QVMA 1CR2A 5G53C 1KI6B 3TW6A 1ABFA 4BNDA 2WLSA 3IT2A 4FFVA 4WCDA 4ZOEA 4N5DA 2POCA 4KVZA 2QRNA 1TEVA 3AP2A 1CS0B 4IILA 1NX6A 5GGYA 2CHFA 5E7QA 4G0NA 5DI3B 3SYNA 4XTRA 1LPNA 2O1XA 2W0SA 1RM3A 1VSVA 2X5JO 3AERB 4DQLA 4WXYB 4RY9A 1G8YA 3ZQJA 2H5IA 1XZEA 4M46A 5CX1A 1T4CA 4CKXA 5I7AA 1O96A 1ENYA 5BR8B 3DB2A 1H0RA 4TQ9A 2X1HA 4IOLA 4BJHB 2CHGA 2HA7A 3OQMA 1P4SA 1SD1A 5ICSA 1TYAE 3VUFA 2I4TA 4EPVA 1L5YA 2C3MA 4W9NC 3V4FA 1J23A 4RHUA 2YIDA 4FIZA 4CCWA 3P9PA 2YV3A 3QUTA 4WZAB 2W98A 2DY1A 3AO0B 3NB0A 1J2UA 1PT7A 1UC8A 4LRTB 2OHVA 5I9MA 2HTFA 4ALNA 3FYHA 3P8ZA 5EXPA 4W1SA 3UHAA 1E89A 1FFGA 3NT4A 4ND3A 5EVCA 3OA0A 1LWOA 3TSYA 5F51A 5F9MA 3W4IA 1SBNE 2RB4A 1LPPA 4JFRA 4E12A 2IS2A 4HFRA 2WJIA 4HTFB 4QL3A 2WJGA 3CONA 1ADYA 1DQPA 2WNHA 3EW9A 5IJXA 2O14A 5IXSA 1H6CA 2OBFA 4IDAA 3BRSA 1SULA 3DMHA 1C8KA 2EZUA 3KTDA 2GZ3A 5KSPA 2NWQA 3LF1A 2F3TA 1JDNA 3L92A 3RAGA 1EDZA 5CYOA 4BDTA 4GMXA 4P7GA 2HQRA 4DA7A 3C8HA 3I62A 3IO3A 1DC3A 2GFHA 2PXCA 3EUWA 2VCHA 3JQFA 1BC5A 1XZFA 3C3MA 1Z7WA 4PGGA 4RQUA 2E5LB 5C8YF 1OMOA 4F6CA 1UPTA 2MSKA 4QXQA 5H9WA 1ZBDA 3I2HA 1BQ3A 3SAJA 4JD5A 3SNHA 3LWZA 2A1TS 1GJRA 2AWNA 2IK8A 3DTVB 2Y8EA 1T2AA 1DBSA 3QTTA 1NW4A 4HYEA 4NFHA 2G3YA 3ZTTA 4EZIA 3W6NA 4CV2A 3D5QA 5C18A 3IP8A 5B2FA 1Y1TA 1SD5A 1ZLYA 4EYKA 3I8OA 4ZYYA 1XTBA 4PVDA 2ZULA 4WGFA 3HHEA 5GJBA 1SXJA 1QTRA 3QVWA 3L2OB 3AMVA 1ECPA 1P2BA 4EG6A 1V8DA 1H2HA 2GPTA 5EKDA 1RP7A 2C5SA 3NV9A 3KFXA 3OD1A 2NZVG 3ZNPA 4AF7A 2I6QA 4E5VA 1TEHA 4BNXA 5KINB 2QM7A 1T5IA 3I5AA 4J4BA 1NBEA 2B1GA 3PDHA 4MV6A 1AHIA 4XD7D 3UQZA 2R48A 3BEOA 2VXYA 5H3LA 1CF4A 4CG1A 2GKOA 3NTLA 4MUGA 4DLNA 1SUFA 2GMWA 2ZJFA 4NU0A 3V5NA 2DXIA 2VPWA 3H4MA 3ZIDA 2DKNA 3HU2A 1Z63A 3LBNA 4PNEA 3D7KA 2E4ZA 1NY5A 1UKEA 2WG1A 2HJRA 3AKDA 1UBKS 4A5SA 2FP4B 3GJ3A 4QDJA 1WSDA 1UKCA 1VTKA 2XHEA 4MQFA 5GQSA 1OAKA 5IKOA 5TX7A 4EW1A 3O8RA 5LU8A 1M74A 3WGIA 3EIQA 4R54A 4TKZA 1SUSA 1Z4OA 3T3IA 4DCPA 7AT1A 2JHFA 1G1MA 1GU7A 1U04A 1JLKA 1ZESA 1E5QA 1KI9A 1KYQA 1MFPA 1Y5MA 2ZTMA 4QHYA 1DRKA 1TRHA 2B35A 1U8EA 1M54A 3PHCA 3A2KA 4FX2A 5ALPA 1UBEA 2W48A 3L0PA 3O9VA 2GM4A 2R1VA 3QX3A 4QAQA 5M34A 3M0EA 2JIZD 3P2MA 4JVMA 4CLEA 3K0HA 4RPCA 2VJCA 4MUYA 3DBLA 5K3DA 4CODB 2AN1A 4EB6B 1I0IA 4K28A 2GOYA 3BXFA 4P58A 3U39A 1IQ0A 4B7CA 3VU3A 3ANLA 1IJEA 1Z4PX 2X8JA 1EHYA 3G5TA 4NG4A 5FOTA 1B14A 1G18A 4HDRB 3ZU5A 3OPYI 1PVDA 5AJUA 5FLYA 4AMBA 3BWCA 3ZGNA 2PAAA 1LDNA 1FX0B 4KO4S 5CURA 1RAEA 4ACAA 1T8WA 4IUCS 2YZ2A 3ANSA 4I9FA 3KVRA 2OORA 5EMMA 2C8VA 3BWYA 3EZXA 1EFTA 4B48A 3WZMA 1NDUA 5KTNA 4QSHA 4HATA 2ZU0C 2VG8A 4E88A 5SYAA 3NEPX 4TV8F 4BTVA 3JR3A 4GG1A 4S2UA 3A6FA 3CLKA 1JJIA 4CF4A 4IVPA 3FB4A 1T2EA 4OU5A 3OBIA 1T8UA 3H13A 3E05A 4KTVE 3Q41A 4QRDA 3IMGA 4NE7A 4OM8A 4M37A 1V8FA 3KQWA 2WDZA 4ZZ1A 4BEBA 1P9LA 2LWIA 3BMOB 1SUBA 3ZCVA 2JGLA 3IBCA 1XMPA 2BR5A 1MU0A 2WPDA 4ASUA 4UZFA 4N5LA 5ILGA 2OTCA 3BTUA 3LP6A 4RD2A 1I1HA 1Y1KE 1U8UA 3D4PA 4BBAA 2H1OA 3F3KA 1CVIA 2GF0A 2FWPA 4K6OA 3NBFA 5ITVA 2IA5A 4E6EA 4TKMA 4A1OA 4D6XA 3VJLA 2A9QA 2FJUA 5H81A 3MN1A 3MINA 1XSEA 2IYSA 4WUVA 5B4TA 3IXMA 3QVTA 5LXTA 4WZZA 1C1DA 1C8LA 2IDZA 1Q7TA 3UH1A 1YMUA 2J6IA 3IURA 4WLOA 5EJAA 2OO7A 5A5GA 2C4TA 4AP9A 4D97A 4TRMA 2GM5A 1FXUA 1U3FA 3ZBPA 3EWAA 1E1CA 2XCUA 1DWQA 2WWXA 3BCUA 1Q0QA 4UVIA 5FHRA 5KC9A 2H2DA 1X8JA 1P62B 2OD7A 4E13A 1VLLA 5D3KA 1KFKB 2VC2B 3ITKA 5LFAA 2RONA 1YH3A 3BX1A 3KG2A 4YJHB 1ZN2A 1IN6A 4GGMX 4BNJA 4BO6A 1DIHA 1DAKA 3OP4A 2Z6UA 3G0GA 4NAHA 1ZICA 1VSTA 1F7UA 1GG8A 1H2FA 1T5DX 3LQRA 4GQAA 1OZFA 1WB5A 4S1TA 3UJPA 4X64B 1SB8A 2LE0A 4X44A 3QLVA 4MWOA 3FM9A 4D3FA 4FJ1A 3DW3X 4Q3DA 3W6OA 5JNRA 2GGSA 4K88A 2AD5A 1R66A 4W5WA 2MSNA 2RJ3A 5SICE 4FZ5A 1T4MA 3O8OB 3T0GA 1F12A 1OR8A 1ETUA 4GS5A 2D2IA 4LHEA 4QJ3A 4B4WA 4ND6A 1CK4A 2VQ3A 3MELA 5DLEA 2VHTA 5ADHA 1CR0A 3FFAA 2O06A 4N49A 3R77A 2OZPA 4OL9A 2AMVA 3I1FA 1SHLA 3W04A 3HYRA 4GEKA 4IO0A 1H6AA 4LSWA 3OOHA 4QOGA 3KQNA 1N8SA 3M6MD 2WQ6A 2FX2A 1BW9A 3SJUA 4EENA 5K8IA 1GYPA 3VV3A 1VL6A 2H2WA 4J4TA 4EEKA 5KSYA 1XMJA 1Z62A 2Q5EA 3MFQA 5EFZA 3RYTC 1ZJWA 1MB0A 1XA0A 4A91A 4ZI7B 3G1UA 4F56A 5CFLA 3G2LA 1ODSA 1NP6A 3GN1A 4Y3UA 5BOVA 5FT9A 4E09A 1E6WA 2PMKA 3SM3A 4EPYA 4M86A 4D4MA 3V34A 2QVGA 4H17A 5A3RA 1LF5A 2OFXA 1I5EA 3LYLA 2FHSA 3OOYA 5C1PA 1X7WB 4AO8A 1L8QA 4CZ2A 4ZOBA 1MP0A 4ZP1A 4CMCA 3FYUB 3FPEA 4OU4A 3WAGA 3AEQA 3RVNA 1LB1B 2FZLA 2R3SA 2ZFUA 5CT9A 2O2XA 3VDQA 5KOHB 3W5CA 4EJ2A 1E96A 4E03A 5C52B 3DC2A 1U0BB 1N8TA 3DH0A 3HB4X 2AW3A 2YXBA 4KK4A 2BKXA 2JVKA 3H2JA 4RK6A 3CUTA 4AJIA 3BE5A 2PWZA 2WTNA 1O8BA 2CLMB 2ZVJA 3NYRA 4HB0A 4QGBA 1QX4A 1VPTA 4IWNA 1IPHA 1BU8A 1F8UA 4O0LA 4O4HB 4WNAB 4KQWA 4B7UA 4LN1A 1HYGA 1DTSA 1ENOA 1J7KA 4HNAA 5DULA 1HDCA 5AM2A 3Q0TA 2W2OA 1KK1A 3F98A 3CEAA 3LWBA 1IHDA 1OXUA 2VOJA 3QK7A 1M1UA 4I50F 5K3OA 4NCIA 5CYFA 4YN3A 4D9JA 1VCMA 5BSTA 1RYZA 2IU4A 1AZLA 4PSCA 4PYOA 5A4KA 4BJ6A 3NANA 3G7UA 1Z4NA 2WMYA 3H8VA 1NUSA 1GZ3A 4UARA 3SN6A 4WJLA 1XRSB 3T38A 1QE5A 4NAVA 4BNIA 4BAUA 5HOEA 1T29A 2AH5A 2ANBA 2IJGX 3KR0A 3ZTWA 4M1ZA 4D79A 4CXMA 3GLGA 1D5WA 1PR4A 4HXYA 1IXKA 4JC4A 4PN3A 5JR3A 1CJVC 3THYB 1HO3A 2YC4C 3S2FA 2IEDA 3OQPA 4EGQA 1H22A 1ODFA 4REOA 4BX2A 1Y8QB 3RABA 3QPCA 3WNBA 3KJIA 2WB2A 3IT3A 3WGZA 3R9XA 1NKTA 1IWPB 1MB9A 2C2ZA 1KI4A 3DQZA 3L6UA 3UENA 2HU5A 5DCLA 3FSEA 4JLPA 4EX6A 3I9KA 1ZIOA 4RC9A 4CMGA 3B1FA 4MI6A 1V4BA 3QEOA 3KB8A 3LC0A 4BCCA 5DTQA 2IPLA 3FOBA 4ITVA 1L5ZA 1LQTA 1MAAA 5FEUA 3JWJA 5A9SA 3H1PA 3NFYA 4NMWA 3S0JA 1QG4A 2O52A 2WD7B 3L4EA 4KPFC 2IXAA 2X3UA 1GKLA 4P82A 3RSGA 4FEAA 4D96A 4EI9A 4AZVA 5B3KA 4K9QA 1MQAA 5EP4A 4YREA 3TXYA 3VPBA 2Z04A 3ZCUA 2FA9A 3PFBA 2WDPA 1FTQA 4UC0A 3E2MA 2O50A 2FPGA 2OHJA 4LKOA 4RZUA 4Y2GA 2JHCA 2VBFA 3P9KA 1UOOA 1QLJA 3HG7A 4J75A 4M1SA 1EJBA 4L27A 3RTEA 3TIVA 5KI6A 5JXGA 4HZGA 1G5TA 1Y4SA 1YJCA 3K2BA 4IIJB 4XSVA 3UAVA 5JEEA 3QJ5A 1D2HA 1VSQA 1XCLA 3FDZA 3PI7A 3QPAA 3OPYB 3EG9A 3UK0A 2R00C 2O19A 3GIWA 1ZD1A 3OX3A 3MVEA 3F5DA 2IPOA 1HE1C 4KIFA 1VKRA 2R60A 1F4VA 3A4YA 2VCEA 4IDQA 3DV0A 3ZQKA 4MA4A 1UXKA 1OGJA 4K9MA 5K6RA 4ON9A 4J16A 4NY1A 1NONA 2RMKA 1RHUA 2XCIA 1BH6A 4LTNA 2VF5X 3G2QA 3QG5A 1O0BA 4XWKA 2J85A 3FBWA 3WLPA 4IGIA 5A4IS 3T1QA 3QLUC 1H0SA 4HDNB 1EQ2A 3OJCA 4I9HA 2C00A 4BQQA 2YN2A 5IUNC 3QVXA 4BNWA 1OXMA 4RKYA 2PH5A 4KO8A 2WHQA 3R3ZA 5K5EA 4D80A 5KJFA 5HKOA 3P9ZA 4XUEA 3AFMA 1B0ZA 4ERNA 4A26A 4CLRA 4QZVA 4HRYA 3TTUA 1JNYA 3RROA 2VJAA 3JQCA 4REMA 3I5YA 3C6XA 2GCIA 1TKCA 4Y6LA 4B34A 5HGJA 2PZAA 4IDPA 3HP4A 2DY0A 3AJ9A 4IINA 4WADA 3V8MA 2A9RA 3ZE7A 3COVA 5J9FA 5JYDA 2LD4A 4ECEA 4M8NE 2G1UA 5LKAA 4YS6A 1SM4A 1EZZA 1U1FA 3K30A 3SLKA 3U5TA 2A9KA 4ENPA 3C5CA 4Q00A 2XOEA 4ZWNA 2A9PA 4RAQA 4BO5A 1V1MB 2YHAA 4KLNA 4BMZA 4ZYLA 1Q92A 3D5TA 4QOJA 3ZVMA 2MINB 1VL8A 2TMYA 1QPGA 2GEBA 3BFKA 3BJEA 3Q6NA 1LV8A 4RORA 3C45A 4LNHA 4P54A 5DN6A 4ETWA 1MX1A 2WPNA 4PPYA 4N3AA 1JEEA 4G0XA 1NQXA 4YXWA 4JJAA 4WFIA 4BVHA 2OENG 3IVXA 3JYOA 5A4JA 1O95A 2CMGA 3TTTA 1VBNA 3T54A 3HYLA 3PP8A 1DAMA 1SB9A 1VBKA 3GVPA 3ADDA 5JSZB 2CFIA 4JEIA 1QFXA 5CUQA 5TVGA 1ENPA 1H2ZA 2VH2A 3T9AA 4B32A 4D3SA 3I37X 4JK3A 1FBNA 2YWFA 3M4ZA 3K6SA 4MDYA 3LH5A 3D6AA 1T43A 6AT1A 1KQOA 4FXOA 5ANRB 3DBIA 3EAGA 1KXJA 4JH0A 1SPBS 3BL5A 3L1IA 3C3WA 4FDTA 1N7GA 5EE1A 2YNMA 4UJ3A 5SYMA 1QOZA 1NHGA 5D7NA 4EYSA 5E9JA 2Z8ZA 5HTKA 3DM9B 5NLLA 5TF4A 1LJUA 4KQJA 4XW2A 5EZYB 3CX6A 4JEHA 5B58C 3WNDA 1NKVA 1QQAA 3MJEA 5IC6A 4QYXA 3VGJA 5BO5A 3H9EO 2O2EA 3CH5A 4XIIA 5B36A 4GX1A 5HS4A 1K9SA 1DUIA 1TCCA 1UFVA 2RBGA 4O1MA 5FNZA 4F96A 1U1EA 3OUZA 1DKQA 5AT1A 3B1YA 3SQNA 3CXRA 2UXBB 4IWYA 5BV7A 4KPEC 1J56A 3K5WA 1U7PA 3LUJA 2XMDA 4TUYF 2JKVA 4MKXA 2D1QA 1AX9A 3QKTA 1TU3A 5DP2A 2W6JA 4RLHA 2PRKA 3EZGA 4LNAA 2BFDB 1VP3A 2XIJA 3TCXB 4HYQA 4D9HA 3FMPB 2E0IA 3B9RA 2YYSA 4HTAA 4DR2B 2E6KA 3PPIA 3OY2A 4ETIA 3IBFA 2P69A 4XR4A 3T8YA 3U4DA 1S2GA 1EYZA 2D13A 1ZWLA 1UODA 3UAXA 1N25A 4AMUA 1QVVA 1GL9B 3KJFA 5HS6A 4LUCA 3T5BA 3LM8A 3IBYA 3ZKAA 1FVOA 1LEHA 2EHDA 1KDVA 5BSEA 1KZ4A 3IQEA 2APJA 1GPAA 1WA5A 3AG6A 5KYTA 2C2XA 4I8IA 3BIFA 2F64A 1ZVKA 3HNPA 2Y1WA 1KPGA 1PNOA 4P6VF 4PSVA 3GA7A 3HACA 3IQFA 1FVXA 1PN3A 4XDYA 1AA6A 2VDRB 1TM5E 3AF0A 3ENVA 1QE0A 1UQRA 4RMGA 3O6VA 1UWVA 2ZSDA 1QNLA 3GGSA 4MYSA 4GX2A 4R83A 1XJ0A 2IUSA 4Y2SA 3LTNC 3N2LA 4GVLA 1ZOSA 4DMKA 1GZ5A 2P1DA 1IEWA 5E1OA 3H86A 1KE2A 2RAUA 4C4OA 3ZCQA 2I0FA 2O8FA 2EKBA 3PIIA 3DHEA 4PXAA 3PPWA 2B21A 2HRZA 2VLIA 5CB4B 2ETVA 2AJ8A 1OFTA 2C95A 4C07A 1HMPA 1TB4A 1Z4MA 1Z5UA 1EDBA 3PUHA 3W7BA 1R5JA 3FPKA 1XCPA 1NSYA 1Y3HA 3L49A 2H06A 1T2DA 2R47A 1ZM7A 2ERCA 4HGNA 1XRNA 3C0KA 1E6LA 1Z8NA 3OZFA 2Y1LA 5IAKA 2GYUA 1ODTC 4O1HA 3MILA 3NDRA 5DWVA 5E4JA 1E1QD 3A6JA 5KPDA 1E20A 3EPHA 2FKNA 2I4LA 4WNCA 5ESRA 3AR6A 2VYVD 4MZXA 2ZITA 2H2IA 1ECFA 3EK2A 4OK5A 3SKXA 5IF3A 4KV7A 4HN9A 1ZCJA 2F8LA 2JZCA 1O77A 2X1LA 2ZUVA 4UQPA 1WPGA 4NH0A 2W42A 3LT0A 3JQAD 2W6MA 5JU6A 3NBZC 4HHEA 4RPIA 2BEWB 4HL6A 3CB2A 3DMGA 1L1FA 3QTLA 5T41A 1Q11A 4S05A 2L19A 2C5EA 3MBIA 4C30A 1R6TA 1QCDA 1JZQA 1MX5A 3EF0A 2VAMA 3CVUA 3LT1A 3RYHB 4TMTA 1GN9A 2O3UA 3T5MA 3N87A 1E0JA 2Y93A 1MR3F 4YMWA 2VSOA 3SEAA 4K86A 1YOVA 1TD1A 4ZIRB 4RPHA 1WMAA 1UQUA 3G9UA 4DKXA 4QU0A 1IG3A 4RL4A 4RNCA 3T06B 1VIYA 5LYJB 4W5OA 1O58A 4LV6A 5AVYA 4R1NA 3EA4A 1C9NA 1RWPA 2W2LD 3CZMA 4J7CA 5H83A 3UTCA 4LF8B 1PQWA 3VDXA 4PZLA 4YDHB 4NE2A 3JQDA 4GL4A 1CTQA 4O3FA 5EERA 1PW7A 5T3YA 2A1TR 2XE6A 3EQZA 4U6SA 3TTYA 1ZA1A 1FRZA 3KU1A 1QDLB 1MOZA 1YS4A 3FCUB 2EFEB 4ISCA 2J3EA 5I7SA 1S89A 3LQ4A 4UBNA 3FTDA 3H04A 4FDMA 2HA6A 4MS4A 1XJQA 3V6LA 4EARA 4JYZA 3RT7A 3ENQA 4F12A 1C50A 4Q6WA 3LFHA 4TM7A 1EPUA 1NVWQ 3I9JA 1VYVA 3I9V6 3CU5A 5AR1A 5T4BA 4BGIA 2CD9A 1GDHA 1GGEA 3I5MA 1XCBA 4LVCA 4Z8XA 5K51A 1CUZA 1DAFA 1NPTO 2QM8A 4FWTA 4WASA 5A9TA 1PZHA 5IHXA 1UP6A 1Z2EA 3BD6A 3LUPA 4AN1A 4C4RA 4DJJA 2JA2A 4CTNA 5JFOA 5FWXA 3LK7A 4ZGBA 3T9CA 3CGWA 1SIBE 3RVDA 1RXSA 2IUYA 3GJTA 3QXJA 4FYWA 5FCDA 3EZ7A 2OZLB 4PWZA 1H65A 1AK2A 2OGZA 4B46A 5M7EA 3WBJA 5JQGB 1WBDA 5JJ5A 1E63A 5JQWA 1WXWA 1P1HA 4IJMA 3RUAA 2YV1A 2R8EA 1J0DA 4HH0A 1YZ3A 1TAQA 3D5EA 1IQUA 3Q40A 3AVPA 2O3RA 1RACA 4PYLA 4XEUA 5AW8A 1EUDB 4XLTA 1G21E 2V1XA 2IBTA 2BCJQ 2YJ6A 1PFVA 2G9VA 4X45A 1D4OA 1L6RA 2XCQA 4A92A 4ZEWA 3GP3A 2VP5A 1GQ2A 1JVNA 2OEPA 3DD1A 3C4QA 2HKIA 1PFYA 2HK7A 1JU9A 2IHUA 3HDJA 3QE3A 3QV1A 4B4UA 2Y76A 8LDHA 1G0OA 1HGXA 3K73O 5AVXA 2HJHA 3RC7A 4AO6A 1Z34A 3VM6A 5AUOB 1AG9A 2XXBA 3FWNA 3GWGA 2JVIA 3FR7A 5G2OA 4B2PA 4U7DA 3IP6A 1N3BA 2ZYIA 3DDUA 3PSAA 4NJEB 3LFUA 4S0ZA 4YI3A 3GV0A 3QVUA 1S2DA 4OG2A 3B38A 3HA3A 5DF1A 3KZNA 3R5TA 3LLCA 3LVFO 1E0AA 1SEPA 1LFAA 2FEPA 1PQPA 1YQTA 4HH4A 3DHYA 1GY8A 4LXTA 4NP6A 3TW8B 3KKQA 4M7WA 1YB2A 2I80A 2OHOA 4F7DA 2AE1A 1SC4A 5B30A 1NPDA 3GARA 4P4UA 1JECA 2RGRA 2CJWA 4H1UA 1HT0A 5IUKC 3OLQA 3CG4A 3USZA 2BZ0A 2OECA 5FB3A 4GM1A 2IUFA 4PTYA 4K9RA 2BBTA 1NAIA 4JITA 3W5VA 4QM6A 1P1RA 2OCYC 1DPFA 5GJWC 2RI6A 4K2HA 2BEJA 1GRRA 4TVKA 3P94A 4M98A 5JFGA 3U62A 5JRJA 1BCSA 5ECYA 1YT5A 3M5CA 1Y4DE 2Z2IA 1B6SA 3CLRC 4IG4A 4QGSA 5SYNA 1QKIA 3N6VA 2PGOA 3S4YA 3PQ2A 1ATZA 1KMMA 1Z2DA 3JALA 1AA9A 3AR4A 4PCUA 2AXQA 3A36A 3CNOA 4Y7CA 4F2PA 1H9BA 3B3AA 2HEIA 2F00A 3ZHXA 1AO0A 3ZDYB 4B44A 5I3CA 4DV6B 4QUGA 3U4GA 1ADJA 2EEZA 1XD8A 3D6FA 3FYTA 4O4JB 1HE5A 1FFHA 4KPUA 2QVCA 4GOMD 2ZPTX 2X5XA 3RODA 1MO4A 2CLLB 3E1SA 4BNZA 1K4MA 1WV0A 1XMOB 2QSYA 3AR2A 4TX1A 2Q6KA 3A1UA 4UTXA 2WUDA 3FDFA 4L5AA 4FEGA 4L9RA 4GRDA 2VQDA 1YI1A 2CHQA 2WHRA 4G1BA 5ADWA 3AY3A 2A9VA 1NYLA 1RM5A 4Y2QA 3OBBA 1VMAA 3WLJA 5KQSA 5DM4A 5ARCA 3RARA 4A6DA 3H97A 2QQ5A 4LVOA 4NZMA 1SCUA 1Z0AA 5HF8A 4AN4A 1JRLA 1U8YA 2O2ZA 3RFCA 5THXA 3RTGA 5EJ7A 1VB3A 2RHWA 3HYNA 1U4OA 4TWJA 5EZQA 3CW9A 5IBRA 5JNWA 1BXGB 1E92A 1ABEA 3IDAA 3P2IA 3RH0A 4BLUA 5DM70 4N12A 1ZM9A 1XWWA 3PFIA 5CA1B 1Z5WA 4D81A 2CXNA 5FHQA 1KZ6A 4RU1A 3VDMA 1M8JA 2BEVB 4KTTE 5CIQA 3BRWD 5A03A 4WXPA 2C03A 4MI1A 3TWOA 5BNIA 5AQ1A 3AJ8A 2AOUA 2GDJA 2OESA 2LKCA 3NBMA 3OE7A 4Q48A 4UFOA 1SUWA 4YRQA 3VPXA 4PX2A 2ZWAA 4WV3A 4QNRA 1WW3A 1SH7A 3ROPA 3THXB 3HLKA 1USVA 2AC2A 2IUUA 1U1GA 1U2RA 1L5RA 1S7CA 5HMMA 2TECE 5AHOA 2VSXA 4XDHA 4L5IA 4IOKA 1WPXA 3NHKA 3NXSA 4CCAA 5TRTA 2QZZA 3ABIA 5CBKA 1WKCA 2BVNA 1IOVA 4HNVA 3PFGA 3PNOA 4LYDA 3A9SA 3TMAA 3OX1A 3H6HA 4F84A 2C9MA 3I12A 3KYCA 2GEDA 3VC3A 5L3QB 2YOGA 4JLKA 4B6OA 2ZVQX 2IYUA 3F9IA 1NI5A 3FHJA 1A5SB 1SG0A 1PAUA 2R6ZA 4M21A 5KNBA 2FRVA 4H4DA 1EINA 3C3KA 4CTKA 3F5SA 1KDZA 3DVRX 3FLAA 2GK3A 1VL5A 2HQOA 2E49A 1RXWA 4MGEA 1PLLA 3AI7A 3B7GA 1OC4A 3ANNA 3O8LA 4LV5B 3JVVA 1KPHA 1X38A 3KJEA 4HQ0A 5EIWA 3D0RA 1D6MA 3B1VA 3RBXA 4EKNB 5LLTA 1M10A 821PA 3NC0C 2ZS7A 3T3EA 2DPXA 2A3NA 3FTPA 3LUHA 1YIOA 4GGOA 4IYRA 3GK3A 3KHSA 1XMIA 1IXSB 2Q3FA 2EBWA 2ZRFA 3B1XA 2CEKA 3HCAA 5H3HA 5SV2A 5F5NA 5KNDH 4L7QA 5EWMA 5LZ2A 2G25A 2PS0A 1XYGA 1FQWA 2QG9A 3WSWA 2H7CA 4KNVA 3BTVA 2VTDA 3BSWA 1M34B 4G3XA 4JI0B 1ECBA 2QU7A 2EYUA 2CLEB 5ESWA 1KS2A 4IY1A 4NL4H 2JZOA 4DT1A 1P44A 1N5LA 1VJ5A 3NZEA 4KEAA 4C5AA 3D0KA 3AR9A 3FBGA 5JARA 3AT1A 1T9DA 3N7UA 5C8YB 1GTZA 5K3FA 3AEZA 3IOBA 2CNWA 3AHIA 4PZ9A 4WKCA 1M1XB 4FSHA 3UXEA 1AUXA 1MOQA 1RLTA 4ESHA 1L5MA 4AI6A 3RC2A 3NDPA 3MUEA 4ZAWA 5JS8A 1RIIA 1RU3A 1Z7GA 4HXEB 3TQSA 1AQYA 2G77B 1MO3A 1DQNA 1CDDA 1YZGA 1FFEA 4HI0E 4XASA 4NEGA 5ALXA 1OLOA 3O1IC 5B1IA 1JG2A 4AJ9A 5A3QA 1CRQA 3HP7A 5JO0A 3L1VA 4U39A 3BMQA 3FYCA 3R5SA 1LU9A 4GI3A 1L7BA 4BYGA 3HCEA 5FV7A 3L7BA 3UZUA 1N77A 1KGDA 1E3SA 3ELBA 4ZVKA 4EPXA 4ME6A 1YDHA 2IHZA 2IZ5A 1B1CA 1K92A 3RBVA 3W6PA 1OWPA 2CXRA 4S1OA 2RHDA 5K8TA 1NUPA 2FSVC 2XMPA 1N5IA 4NLLA 2EJCA 4EPWA 2AUNA 2DETA 5FNVF 4OFZA 1SBTA 4QA9A 4NZNA 4PG8A 5CBPA 2XSZD 3G0OA 1JLSA 1L5FA 2DLDA 4JBNA 1U3GA 2ABWA 4Q4AA 3O38A 1CZUA 1UC5B 1C81A 4TLCA 1GPYA 3TKAA 1XEWX 1FJ2A 1SBHA 2OUKA 3J7TA 2VAPA 1KMQA 3KKPA 4L1KA 3BHNA 4TROA 3UUGA 1XZKA 2GKGA 4ZC1A 1BHQ1 1G17A 1U3DA 3FLBA 3UXHA 5BMOA 5K0GA 1JAIA 2R8BA 2XEDA 2CLIB 2ZUSA 3GT3A 3M1YA 2O3TA 3Q11A 4HGQA 2QW1A 4CEHA 4K9KA 1RZRA 5CG1A 4GO1A 4PHCA 3IQHX 3TRJA 1JVSA 2WBLC 2XUAA 4IZ6A 1T5SA 3Q87B 4X97A 1PTJA 2VHEA 2IYYA 1QGYA 2HMVA 2FHPA 2WIDA 1RJWA 4GOJA 4EHJA 1NRJB 2OFWA 5C35A 1XLVA 5I5GA 5IJ9A 1XEXA 4U9UA 5CH8A 3RSOA 1FY2A 1KIMA 1DT5A 2ICAA 1NUQA 1SOVA 1TCUA 3QF4B 4DYDA 4DSZA 2VZLA 1E7QA 1NBIA 4H3KB 4QEKA 2YJ4A 1L4KA 4J0DA 4PR0A 4CKWA 3EBLA 3BWBA 3DCNA 3T9FA 3UY4A 2HNAA 1KIAA 2WWVD 4UM9D 4ESEA 1PWEA 5CCEA 1DIAA 2L0XA 2ZYTX 4LSMA 1IATA 2GF2A 4YRRA 2VWGA 4WZBE 4TV8B 5A7FA 1KBQA 3WGHA 3N74A 3R5JA 4TVBA 2B9EA 4J90A 2X40A 5KDOA 4GR4A 1KU0A 4EG3A 1X9GA 2WYHA 1KERA 1P45A 1PJCA 2ACVA 3LKDA 2XCTB 1WD5A 4Q66C 2O0KA 3IA7A 1R4NA 2DKOA 3BMCA 3D2LA 3LLVA 3P45A 1YTUA 1X1SA 5DISB 1JBKA 1LBEA 1LBIA 3VHXA 6ADHA 1OFUX 5HTOA 1OFGA 2UVPA 4J1TA 1F5SA 4AUMA 3NAQA 1YDMA 1ZO8A 4INAA 4JX8A 4PC6A 4B3HA 1QU3A 2YZGA 1MB3A 3UMCA 1KR2A 2PY6A 2V03A 4X6YA 2Y1EA 4X85A 2ZU6A 1T6BY 4KSYA 4BO3A 5LB4A 1S2MA 2O2GA 3G3EA 2BFCA 1FQOA 1R5NA 6ABPA 3M6LA 3B78A 4OSOA 2A7QA 5M2QA 2DF8A 4JI8B 4E5DA 1KZYC 1YCHA 4HLCA 1AT1A 3MRVA 4D8XA 4YUZA 1A71A 2JI9A 4JXZA 4D6PA 2GN6A 3GRKA 2ORVA 2XOKD 3K7EA 4UUOA 4DV5B 1GPH1 3T3DA 4OXQA 1I51A 3CUWA 3GYBA 4QUEA 4TZTA 2VRCD 3PQ5A 4AQDA 2WWWA 1EEHA 4GOKA 1E2QA 4S24A 2O8BA 1CP2A 3MQ4A 4OBBA 5KTRA 5EYPB 4OXKA 1RQXA 3K16A 4UNNA 3QVLA 1G8PA 4D9MA 1MQSA 2MCFA 2BF7A 3SHVA 1OVMA 3NVMB 2O8DB 1B41A 4P5PA 3EXHA 2ATIA 3TLZA 2FRXA 1ONNA 3VGPA 1HTWA 2PRJA 4EELA 1MAWA 3GI1A 1EBFA 1K3UB 1W1UA 3QU9A 1Z6YA 3LC1O 4LNUB 4OLJA 5AM0A 3FWYA 4J2HA 3C3PA 4KU4A 4DLSA 4XGNA 5A6SB 2PQ0A 2GLXA 4RABA 3TI9A 3BIXA 2C7QA 1EVIA 3ZV4A 1TJ5A 5FL7A 5JZOA 2QWXA 1KORA 2P2SA 3IE2A 5CRIA 4F72A 3SJAA 3D8NA 1YZFA 2GAAA 3I32A 1E58A 2VNAA 4FFRA 1A69A 2PQMA 4O2LA 3C6KA 4CM6A 5L4NA 5HSGA 1E4VA 4KFSA 5ALRA 5FOWA 3RTDA 2BZGA 1GRVA 4JFAA 4O4IA 2HJWA 1O0SA 3WQBA 5CU7A 4AKIA 3IUBA 3M1IA 5LXTF 5GJCA 3RCBA 1A1SA 1RYNA 1TVEA 5ELLA 3PEEA 4AF6A 3E1KA 3IPLA 1T3LA 4G63A 2QTRA 1GTJ1 5ALQA 3EGEA 2HF9A 3HSKA 1GQFA 4GFDA 4CKBB 3VZRA 1GNSA 3NVKI 1LUAA 2I6FA 2J87A 4AYXA 3ED1A 2W6IA 3ML1A 4YV2A 1GSHA 1KZHA 2FEXA 1YVRA 2JB9A 3F4BA 3C24A 2RKBA 2QZPA 3HJCA 3GROA 4WFQA 1R8SA 3VR2D 2WKQA 4WBXC 3JWHA 4N7RA 3AYXB 3WSTA 1ZC4A 3O4FA 3R5HA 3FCAA 4LXIA 4M60A 5B55A 4QTXA 4ZV9A 4DSUA 1RLMA 1US8A 3FRHA 4O02B 3RFFA 3WGQA 5JE8A 3LXMA 3ZD8A 1SXGA 2IHNA 5C5DA 5AK6A 3S5UA 4Z86A 1FS4A 4LHVA 3I73A 2F9MA 1F9AA 1C9KA 1SXJC 3DNMA 3X43A 4CM9A 3Q7QA 3L7JA 4OK6A 3MTAA 1JG3A 1QS0B 5CDUA 5CVJA 4OHZA 1A5BB 1XHLA 4XVRA 4OHPA 4I3FA 1K5HA 1ZEMA 4JP3A 4MVYA 4ID9A 4DMUB 1P7ZA 2Q6OA 2NXEA 4M0LA 4NCXA 1KJZA 5EWJB 3RIYA 2YASA 4KMMA 3KLBA 5H5JA 4B3TB 5ES4B 3KKZA 4NTZA 2F90A 2Y1XA 4PGAA 3G2OA 5FPPA 1NVVQ 2X6RA 2FUNB 3K0FA 3RKUA 1W48A 2O1EA 4I50B 3N6XA 4LZJA 4C3VA 4IHQA 1QTIA 1B74A 1Z28A 3IPCA 1TU4A 3VKUA 1Z33A 2PM8A 3E27A 3OT1B 3K0BA 5CAEA 4BMYA 2CUKA 1DEOA 5LBTA 1U0OC 5DTRA 1T26A 2AFHB 1CEQA 2BC9A 1FU7A 1T36B 2H92A 3AXTA 4IKEA 5EKTA 2WZDA 3IP1A 3HJGA 4ZT7A 2XTZA 1G20E 2ZI3A 2W6QA 2W4MA 3CQ9A 1XU9A 3EAFA 2B4QA 4BE7B 3QE9Y 2Y27A 2X5NA 3IX7A 2A5DA 1YQ9A 2QP9X 3FLMA 2H0RA 5D3MB 5B6PA 3AWIA 3OKCA 1EUCB 3PDIB 4LDZA 1RRVA 3O93A 4UVDA 5ALYA 3R7NA 1PJBA 4NV0A 3IE1A 2O8VA 3SHFA 2TRSB 4RJIA 3L6DA 4UTZA 4ZT3A 1EFAA 1Q16A 4QJ5A 1QYRA 4BJ3A 2BT4A 3IAFA 4MIEA 3F96A 2ZWMA 3HEMA 4D8YA 3MWDB 4Z4QA 1A72A 2XF8A 3KYDB 5D7BA 5SZHB 1E2FA 3KP1A 5J59A 3DEIA 5JS7A 3OZUA 5EOVA 2I3DA 2BEKA 2OCDA 2Q2WA 2YYYA 3ACDA 2IX9A 3EQ9A 3QJGA 1UXGA 1F4LA 2XWQA 4KX3A 3ZI0A 2ZJ3A 1JFLA 4WY2A 5EXTA 3TLGB 1CKEA 1ACLA 1N2OA 5EAIA 1I6KA 4MRSA 1SQGA 1U8FO 3I6ZA 4EUFA 3I01M 1JHXA 4CQMA 3NUZA 4PEVA 1V96A 5LP6F 4ZCMA 4TLMB 1E4EB 1ZM4A 2PHZA 1OLUA 1N0WA 4YO8A 2JD0A 3ZHUA 4RTRA 4R01A 1PEAA 2LGJA 2V7XA 2Q9AA 4FEEA 2ODBA 4AL4A 1A5ZA 3M81A 3IKLA 3U1TA 4CQNA 1KVUA 2UZ1B 1PWZA 2OHFA 2VK8A 3SQWA 3P5SA 2B83A 1W0JA 1TK9A 1UPAA 2QRQA 5FA8A 4F2WA 1CULC 4X7BA 4H9GA 3B89A 2OP0A 4YIHA 2I29A 4M83A 3B20A 5JCOA 4WL0A 2PFSA 3ISJA 3WGLA 3L6CA 4P31A 1RZRD 5HDBB 1BWSA 1HZJA 4YP0A 3H3JA 2DX7A 3SQOA 1OB2A 3OE5A 5LBIA 1E79A 3A8TA 3BEDA 4BX0A 2JGDA 1C3EA 1UPXA 3JVIA 4ZTZB 3C14C 3SF8A 1ZMBA 5HRAA 4FQ7A 3FNQA 1BHSA 4NMMA 3C3XA 4XCXA 5DBEX 4DRXA 1G8FA 2VTBB 4U8GA 3HL0A 1C1XA 3R3XA 1ZN9A 3RFTA 1LW6E 3E2PA 4PICA 4ZCIA 2DT5A 1QH9A 5ETJA 5G02A 3WXMA 2HU8A 2L18A 5FJIA 2PCJA 3TRDA 3V48A 4EG0A 2PKQO 3GEEA 4B6EA 2O3QA 2FQQA 2XKAA 4YEDA 4C4XA 4MR7A 5HKBA 1NGSA 4RPKA 1OIXA 3OSUA 3U7JA 1F20A 4ED9A 1YQGA 1Y9EA 4LZNA 1XD2A 1L7EA 2Q46A 4QNNA 4JLNA 3OC0A 2WZBA 3IC5A 4L16A 4MUIA 1PFGA 4OQMA 4IQFA 1GVNB 4HYTA 4N01A 3EC7A 1Y6QA 2DUUA 1Y6RA 3ECSA 5BSGA 2XQKA 3SBOA 5AVRA 4RVFA 3QVJA 2XB9A 3WKAA 1N57A 5LD2C 3LL7A 1IJKA 2AMJA 2QF7A 4A0FA 3UV3A 4OREX 5JS6A 3KZ1E 4O2BA 3A6EA 3ONNA 2HOQA 3MUFA 2GZMA 3C4JA 3L02A 3ZK9A 4V0QA 1Z18A 1T5LA 1WKBA 2JGMA 1Q0TA 4QDTA 1IH8A 3EUFA 4B8ZA 1ZN7A 4PX3A 3QLVC 4KE9A 5DU2A 4MYHA 3P4UA 1XZPA 5JAPA 5IS2A 4OLAA 2XNJA 3ZZNA 1Z25A 4I5GA 2XUQA 1JYFA 3DJYA 4DEXA 1SKMA 3AV3A 1CY1A 3LL4A 2J41A 1E4YA 1Z12A 4HDKA 3PDWA 1X7YB 2JFWA 2Q3BA 3L8DA 5JATA 2W00A 1TUBB 2H57A 3BG5A 3EQ2A 1HQCA 3W3ZB 1Z4LA 3A1FA 1QOPB 3ZWOA 3JD2A 3QSYA 1RHJA 3NVAA 3E9EA 4AJ1A 5IK2D 2H1CA 3T1OA 1R5BA 1KSJA 1U98A 2AB0A 3HM9A 1BNCA 4HAZA 1ZR4A 1VE5A 4FB5A 2HWXA 4L8YA 4EO4A 1P19A 4GSYA 1OXVA 2FQXA 3AUSA 1W30A 4OTZA 2UKDA 1O97D 3N76A 3U40A 5M29A 3W7AA 4FT4A 5IH3A 1XJWA 2XKKA 3HJUA 2ZWVA 4JNKA 2XLBA 1E2EA 2OCIA 2QMHA 2ZS9A 1YR9A 4PHTA 5CJJA 1P8JA 3QKRA 4CTJA 2ERXA 1KMHB 2IT1A 4GOLD 5IMBA 4CG3A 4QTUB 3VC2A 3F6EX 2YS7A 1VC2A 3W8DA 2NNLD 3X1WA 3RFXA 3TRIA 4TUYB 5A0VA 1LTKA 1C29B 1CUSA 3P32A 4YV7A 4C3OB 1M6HA 2VXCA 1VOTA 3KLOA 1CUDA 5J4KA 1XMSA 2DPHA 5KNCA 4NBLA 2V7TA 1IPFA 3RRBA 2YMLA 4RACA 4Y0AA 5BY2A 2ONZA 2EJTA 3KSUA 1GA6A 2VEDA 3D3WB 3E18A 3ZLBA 4CEIA 1KAMA 2NUTB 1OFVA 2FWMX 2DYKA 2H54A 4PYQA 3L4KA 3DGFC 3D6VA 4GMHA 5E9WA 5DEIA 2XUPA 3ZLTA 1AUVA 2YW9A 3HKDB 3SYKA 4M9ZA 3DL2A 1B76A 2AT1A 1ZSVA 1ZM3A 1LK7A 3CEMA 4JDPA 1CE8A 3KOOA 4XJXA 3UK1A 2OAQ1 4LDAA 1N2GA 4DBLC 4WKNA 3JY6A 4UQOA 1USKA 3VTKA 3UCXA 1CFZA 4DAOA 4L8LA 5J4VA 4DUYB 2CWDA 1R10A 2FSHA 4MS1A 3H83A 4D9KA 1Y7HA 3P97A 4HDCA 4JENA 4PQGA 4BNFA 2UZ0A 4F6RA 2EIXA 1UDWA 3AESA 3E84A 5IT0A 4PQYA 1DRWA 1CNEA 3PC8C 1W5BA 3PWKA 4MYDA 4ER6A 1Y37A 1TKBA 3CLUD 1RKVA 1J5EB 3D0QA 4MGKR 4XRRA 3RK4A 3Q2KA 3E7WA 3ZH2A 3HCDA 2WUVA 3H1FA 4UHFA 2A94A 3WMFA 4YCSA 2GEKA 5AOCA 2NQ2C 1N6KA 5J63A 3CO0S 1FRNA 4DTCA 2BGTA 4P83A 1ULBA 4DGQA 3V8RA 3F6YA 2BE7A 4CIWA 1RJFA 1O5IA 3WO0A 5BWOA 1GUZA 1KHHA 4GZ5A 1UINA 1V35A 2DKFA 2WT9A 3V1LA 3NAMA 3AF1A 4HJRA 4JODA 1NV8A 3VMMA 4HFNA 1ZJ5A 1O3YA 1N6RA 2Y99A 5JYCA 3PI6A 2PGDA 2B98A 3QNUA 3A27A 2NSJA 1CF9A 4J7UA 4HPXB 1NR7A 2VPYA 3FY4A 5FUYA 5J1TB 4B3CA 2LR0A 1DCMA 4C87A 4Q19A 5CX4A 4EHKA 3T1TA 1YBHA 4G9BA 1ULUA 1JF8A 2AMFA 3B7WA 3QLTA 4LSZA 3I1IA 5F3RA 5F35A 5HE8A 3RTBA 5KTSA 1Z6XA 3JVDA 1AO3A 5AKJA 5ITZA 5L4LA 3GGGA 3A2NA 1X80B 1U3UA 3M3HA 1KSFX 1D9ZA 2YINC 3DVQX 3PA8A 1PQUA 4HO1X 3IB6A 3O4GA 3PC4A 5K3EA 2FEKA 3PPXA 3BXHA 4QE3A 1RD4A 3F78A 4M1QA 2HXSA 2CHVA 1PFKA 3ZCXA 2O8EB 2BFBA 2V7VA 2Y0PA 1BCRA 5ABPA 4FXPA 5LWHA 3S40A 5HZHA 3EZ9A 1CUEA 5B6IA 2YHBA 3VU0A 3ZJUA 1ISMA 3P9CA 5J2TF 1KFJB 3INRA 2G09A 3USES 5K0TA 2DR0A 5L3VA 4Y2UA 5LNK1 3Q6MA 1FU8A 4CKZA 3GLRA 4Q1EA 5GINE 2FW1A 1O9HA 5LMUB 1WUIS 3BL8A 2OSBA 1IN7A 4I6JA 2DFVA 1DBVO 4R71A 1ZISA 3SF0A 3DCIA 4J16C 1P75A 4Y7DA 4IX1A 1DFGA 4NJMB 1UPBA 1WCV1 3WJ2A 3IDOA 1TM3E 3MQ2A 5KTTA 2H1RA 1DKPA 1SRRA 3BRCA 1KYXA 3F67A 3HDTA 5CD1A 5AH0A 2I2CA 4G41A 2YBDA 4MWDA 3SI7A 4UVHA 4XRGA 1FFXA 3CVXA 2FMXA 2H48A 3GFTA 3NW9A 4H1VA 3H8JA 2XQGA 3EA5A 3ZGOA 4AQYB 4J2OA 5AVZA 3A6KA 4X7MA 5D87A 5CIYA 3QI7A 3UV6A 1L1EA 3FCXA 5HFNA 3W4KA 4C20A 4EGSA 2WICA 4C4AA 2DLNA 1HFJA 4R05A 2PL9A 4R1TA 5EFOA 4JJEA 2WTEA 4I4TB 3R3HA 1Q2UA 2X77A 3QMVA 4MKFA 1A4XA 5FOXA 3IP3A 4NFYA 4FQ5A 4OGKA 5G1OA 2IEYA 3LQQA 4JJFA 4MH0R 1U0EA 3CZQA 3TW4A 4M6WB 1BDIA 1VKJA 1RZ3A 1Q7EA 1M1YE 1S96A 1XA3A 2P5TB 2SHKA 1KAGA 1N6NA 4LRWA 5CYPA 3WNCA 1RC1A 5GIPE 1JVBA 2F1OA 1VE7A 1S9HA 1R00A 2RHGB 2QX6A 1WZNA 2JFYA 1BS1A 2NO0A 3BFPA 4F4DA 3I4LA 2GTPA 4HZUB 5BW5A 4MHTA 3BM5A 2ZAGA 3KRTA 4HWRA 4EW6A 2QGNA 4RHCA 3OKAA 2H59A 2C5LA 1YBVA 4FWIB 1TGVA 4YAEA 3R24A 1QGUA 5AW5A 3OTIA 1P33A 2QTCA 4N0DA 1G7CA 1GIAA 3FDXA 1RXYA 3D1JA 1O95C 2ZTSA 2YWJA 3CT4A 3J81A 5K0FA 1HOXA 4OATA 2IIQA 1P73A 5BT8A 1YUBA 5LQSA 4UNIA 2HWWA 3ILYA 1KKUA 2P9YA 3O8QB 4DNXA 3A9RA 3BHJA 1ZXXA 1IWBB 2YMQA 1ULAA 3EUAA 3EOBI 2AOXA 4UEWA 5K8UA 3GLHE 4CM3A 2K2QB 1IUPA 5CT5A 4HADA 4D74A 1GRCA 2WQ7A 4H35A 5E2IA 1VFPA 2Q21A 4Z5XA 3BB1A 1V1RA 2Q1YA 3MOIA 2JEYA 3SLGA 4C0JA 1R0ZA 3VR0A 4MIKA 4BZQA 4DR5B 1ELOA 3G88A 4NATA 1JEAA 4PBSA 3VPGA 4JA2A 4LQLA 3PLAE 2PT7A 2DJ5A 2YDXA 4AY3A 3N9IA 2HZBA 5DHQA 5H4GA 5JTTA 1BDHA 4G97A 5HK8A 2ZJ4A 1U3CA 3TJMA 1OWLA 2WKWA 2GUWA 1G4HA 2ZUBA 3ADOA 4WI1A 1E8DA 1IHYA 4YDQA 2ZZNA 1KXZA 4HNQA 1KJJA 3VZQA 5L51A 1IM5A 1WXXA 1XL0A 2M1ZA 2XJ4A 3RU9A 4B9EA 4IIUA 1X7ZA 4ARSA 2FZ5A 3DE3X 3GUCA 5REQA 3TNJA 2PRSA 2HBYA 3DCJA 3ZHQA 1PRYA 4PC3A 2AQIA 4QICA 1OFIA 3FJOA 4POAA 4Y6PA 3U7QA 1AHPA 3BK2A 1T2NA 1CNMA 1GPNA 1MRSA 2HF8A 4F3RA 5JNTA 3DW1X 2Q7XA 1W8IA 1P60A 4WMLA 5EA2A 3VR3D 2XJ9A 3B7PA 2R6HA 3KD3A 1Q3KA 3P0EA 4NOJA 3RFUA 3WBBA 4EVQA 1YZQA 2PMBA 4P08A 3CVJA 2YL2A 3I5XA 1KVQA 1N5KA 2QRZA 4QC2A 4DE5A 2GEUA 4CM8B 1IBMB 1VHWA 1KZ9A 1Q0LA 2W2KA 1UK7A 4OUDB 1RABA 4GYJA 4IHJF 5DK4A 1PI3A 4NK4A 4EFDA 5C5CA 4DQUA 3SE0A 2BFFB 1FYWA 1U6KA 1IBCA 4BAZA 4BLOA 4NENB 4KXMA 1OH8A 3HJAA 3PIDA 4ZCLA 3WHIA 1CW2B 2H4JA 1PGNA 5JPIA 1UIMA 3E7PA 3FWZA 1TL7C 2WJJA 3ONVA 4GH5A 4Q9NA 4ZT4A 3R0JA 3I6IA 2ZSAA 2Y68A 3FOAA 3ZQ4A 4B35A 3V46A 5FUVA 5A4AA 5A2GA 3EZNA 4RWEA 5LZ9A 4YNBA 2AN9A 2J5BA 2X23A 2R4UA 3AI2A 3C7CB 5KDLA 4YCAA 4IOMA 3WSVA 4B83A 1YB6A 2R79A 4O63O 3D1VA 1NJ1A 4YRKA 3DZIA 3QKUA 2P2ZA 1IZZA 2IE8A 3WOHA 4QBKA 3TJRA 1O6FA 1MRNA 4HDSB 1QP7A 2JPDA 3BF7A 1BJKA 2BFEA 4F46A 1YHYA 1MVNA 3ROGA 3WGYA 3D8SA 5IDQA 1SQSA 2J9YB 4A0RA 2B7BA 1UKZA 1HY3A 2I71A 3ONDA 1MNAA 4LA4A 1I3MA 1QVRA 1U81A 2X9GA 3QITA 3BQ9A 1IBRA 4ITUA 4XQ9A 1IK6A 3D31A 4X20B 421PA 2IZ6A 3KKEA 1GV1A 3GY0A 4FGLA 1ZGJA 4BO2A 3U3ZA 1QE3A 5DHAA 3MAJA 2PLNA 1IZ0A 3CNBA 3CT6A 2VF4X 1PK8A 4F4CA 1M66A 2X2FA 5L7YA 2P6OA 2CK3D 1WDWB 2NUPA 2NQTA 4AJNA 4WXMA 1HFEL 3VR6D 1FLDA 1ONBA 3DF9A 3PKJA 1RXUA 2CE2X 2IE0A 3GR6A 5ER9A 4HQFA 5CXXA 3DE5X 5K0NA 2A3RA 3O3CA 1URPA 3MMXA 3RVSA 4AMYA 4RL6A 2V6MA 3WJAA 4XR9A 1MG0A 3KQMA 4DRZA 2OFPA 2E82A 4AYTA 1EFUA 4Q18A 1HKHA 2GXUA 1C80A 3D3NA 5F3DA 2OV4A 1RDFA 5IZCA 3NAGA 1DKOA 5E38A 4FGKA 1Z68A 3ZEIA 1HFKA 2WHXA 1JJAA 4HX9A 4BLRA 1OBFO 1PZNA 1VE1A 1LQUA 3ADBA 1TM1E 3TM4A 1W34A 3SHOA 1M2NA 3A4LA 4AJLA 4DLWA 1BKDR 1S2IA 4I14A 1Z6GA 2EG5A 2AR0A 4JS0A 5A06A 1LSJA 1RKXA 5U4XA 4D46A 1IZYA 1E5TA 2YZNA 3S8MA 4XGKA 1J1IA 3PCXA 2XGMA 1F60A 4PS1A 1CJUC 5KVSA 3L8GA 2PZ8A 1PEYA 3DBOB 4U4AA 1UBUS 4X94A 4HDAA 1Q1QA 2PZGA 4DB4A 5COBA 2ZS8A 3SXJA 1MJNA 4TRJA 2NTVA 1J0CA 2C4HA 5JECA 3LRTA 1DLJA 1RKBA 4NAUA 2J7KA 2PYDA 3HA5A 3IHWA 2VJQA 3TAUA 4M89A 1Q0PA 2ZIXB 1BHO1 3DO5A 4EGFA 5ER6A 1F17A 1TKAA 4WLVA 4EHNA 1XQWA 3U44A 3CEJA 4R9SA 2Z2ZA 2IEIA 3JATA 4BNLA 3HB1A