4N6EA

Crystal structure of amycolatopsis orientalis bexx/cyso complex
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
244
structure length
244
Chain Sequence
DEPWLKIGAREFRSRILVGIEQYDSVPLVRDVLNAAGADVFITTVDPDNRRSSLLLMDLADELPLDDFTWIGTTSFARTKESALRSARILRDSLGIEILKLDVRGDDNTPDNAGTVEAARELRAEGMELLPFILPDLATARALEEAGCAALRVMASPVASGRGIANPAAIRELIEQIGIPVVVEGGIGSARHVAEAMELGASATLVNTALVRAESPLLMAAAMRQAALAGLLSYESGPMPEVAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative thiosugar synthase
publication title Co-opting sulphur-carrier proteins from primary metabolic pathways for 2-thiosugar biosynthesis.
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Lyase/biosynthetic protein
total genus 80
structure length 244
sequence length 244
ec nomenclature
pdb deposition date 2013-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05690 ThiG Thiazole biosynthesis protein ThiG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4n6eA00
1U83A 2H3DA 2FPYA 1AW1A 1Q3NA 3KRSA 4JTLA 3UWQA 3LHYA 2C0AA 1W1ZA 3FIGA 2DZVA 4DO5A 4KWVA 1TTPA 4UTJA 3GIYA 3PF3A 1KV8A 3HMJG 1LBLA 1ZAIA 4O13A 1FCQA 2FTPA 4ZVJA 1W3NA 3HF3A 2QCCA 1VYSX 3PBWA 4K36A 2J6XA 4AF0B 4NNCA 5D37A 4HPXA 3WJYA 4A29A 5KMYA 2X1RA 4FNSA 1P0NA 2NX3A 4O10A 5AYYA 1VH7A 4IMCA 4AWSA 3KVLA 4JX6A 3QSTA 3NQCA 3TKFA 2DP3A 2X1SA 4O8RA 4HIBA 1VZWA 5T26A 5G4EA 1TTIA 1OF6A 2QCLA 4JS3A 1NSJA 1A5SA 1IIGA 2E5BA 3G0XA 3DHFA 5CG7A 3NGJA 4WD0A 2YR1A 4HKPA 1W56A 3PM6A 3A22A 2V2DA 3W7DA 1NAL1 4MJZA 3M7WA 1L6YA 1BWLA 1F73A 2OT0A 4GRSA 4U28A 4UFIA 1OG0A 5FF2A 3GXTA 3R8RA 2B4GA 3MUXA 5BMWA 1W5QA 3U2OA 4PCFA 3LOTA 3P81A 1BEUA 3PVFA 3NQ8A 4PFMA 1TMHA 2YPIA 2E6YA 4GXMA 3C6CA 3WJZA 1RZMA 3W3OA 4CCDA 5TIMA 1H50A 2WPBA 5DY3A 2J27A 4LY8A 3A23A 5J5RA 1AW5A 1SSDA 1WBHA 4X3ZA 3CTLA 4NNBA 1XFBA 1DBTA 3HPZA 3B0UX 1ZY9A 3DXIA 3MI2A 4UNLA 3TFCA 5BMXA 5I3HA 4S1FA 3TNOA 4LC6A 5BW6A 3I7SA 4UTUA 5K9CA 5HUOA 4M6VA 1SO3A 3HGRA 4IWWA 5LHEA 1KTBA 4QNWA 2CWNA 3ZWTA 2QCGA 2BXVA 3STEA 3WJWA 1RD5A 4MZ1A 1WXJA 3M0ZA 1R30A 4IQLA 1LLWA 3B0PA 1VYPX 3C0JA 3L21A 4Z0JA 3FS2A 1YPIA 1V5XA 3FJLA 2ZFAA 1V7YA 3T7VA 1H1ZA 4R7JA 4MY9A 2CLFA 1TV7A 5AHNA 5G1YA 1GG0A 3DGRA 5DN1A 3GDRA 2V9DA 4AEOA 3IIXA 2H3BA 4ML9A 1IF2A 1LRQA 4GJ1A 4O12A 3WJXA 4FXSA 3CT7A 1G67A 4EF9A 1W3IA 3SJ3A 1Z41A 1K7FA 4RZ6A 1JULA 4IPIA 1YLVA 3MHGA 1FXQA 3W2UA 3T40A 4FX8A 4KFOA 1LROA 3WK0A 1F6PA 3Q37A 3THAA 2PRMA 1KBIA 4CCCA 3EWUA 3W22A 1FWSA 3MW7A 3P74A 1B57A 3B0VC 2ZDRA 1TQJA 3JS3A 2Z1BA 5HNRA 1XKYA 1ICSA 1O94A 1VHNA 2E6AA 4XBKA 2QUTA 5K9DA 3IIZA 3GR7A 3AJXA 1EWEA 2BSLA 2EGZA 5KZEA 3BG3A 2X1TA 2TPSA 4KFNA 4RXGA 5LNSA 4YLWA 5DXYA 3NPXA 3THQA 1H51A 3M41A 4LRSA 3O6CA 4UTWC 4B5NA 3MP3A 1G4EA 4PL1A 3W1XA 3PUEA 5HWJA 3DFPA 4UTTA 2J88A 3NL2A 1NFBA 1PVNA 4OBTA 4XBSA 2RH9A 3PC0A 2EHHA 4DBDA 3GNDA 1EA0A 1DHPA 5CPLA 4JTUA 1MXSA 1R2TA 1H1YA 1T0OA 2CLMA 2NV1A 1KLYA 3GVGA 4O54A 1H7WA 5F2MA 2VFDA 1G4SA 1TPC1 3CLMA 1I2RA 3VNDA 3W7PA 2V5LA 3G3MA 4NJKA 5AB3A 4LVBA 1KFEA 3QMSA 3NQ7A 4WOZA 3W73A 3NPUA 3KAOA 3EX4A 3W7JA 3S0CA 4ALDA 2QAFA 4LT9A 3MO7A 4ORIA 4M5PA 3SIZA 1GQNA 3ABQA 4UTMA 1DL3A 1LDCA 3STCA 2DZPA 2ZZ1A 4ADSA 2OX1A 3O1NA 4R34A 1FCBA 2E5CA 5AC7A 1EX5A 2EAWA 4NXKA 2YYTA 1WOAA 4DEFA 1ML1A 4DF0A 4JY9A 3NM3A 5AHEA 2YZRA 4LUJA 1JQVA 2OJPA 3ZS4A 4FX7A 1JCNA 3B4UA 1HO4A 3EEGA 4OQVA 2LLEA 4HT3A 4LU0A 5FEWA 4JX4A 3WK2A 5CPOA 2E6DA 3G8RA 1Z48A 5AFDA 2I1OA 4RKAA 1CX9A 5LNRA 3TROA 4JYFA 2AAMA 2JGYA 4FEZA 3QM3A 1B3OA 3FLUA 3KRZA 3L0NA 1CW2A 4C1KA 3O6DA 3GKAA 5FEXA 2J9ZA 4IMFA 2WQPA 1FWWA 1RQEA 2CZDA 5HUPA 3W7NA 3IIOA 4IMDA 1JCMP 1XDLA 1J4EA 2G5WA 2J9XA 3QW3A 2E77A 4JTSA 1WBJA 3PG9A 1TRIA 4AAJA 5AC6A 3NQVA 3NOEA 1H63A 1PHWA 2VKZG 1SSGA 3W76A 3W1UA 3EX1A 3BGGA 3D0CA 5HMSA 3G1XA 5LNVA 1UB3A 2YYUA 4RX0A 4WY0A 4WY0B 5G1TA 3DAQA 4CQ8A 3TW6A 3YPIA 1VRDA 2X16A 4OV9A 1OFPA 3M1ZA 5FESA 4OHQA 1HO1A 3O8AA 4KFPA 3OVPA 4P2VA 3HQ1A 5D2XA 3JR2A 1PE1A 3OA3A 4IUOA 3QF0A 3NA8A 4CNPA 4TU1A 4MLRA 1WV2A 3DFQA 2Z2UA 1W5OA 1TPDA 4JTIA 3T4CA 2WKJA 1SFLA 1OYAA 2PURA 3A9IA 3EXSA 4OGZA 1OYCA 4EF8A 2WSQA 2E68A 4N4QA 2ZZ6A 5HULA 2ZA2A 2WV8A 4JYEA 4Z1DA 3NL5A 1X1OA 4GFSA 1YDNA 3P5ZA 1QPRA 1G4TA 2A0NA 3K30A 2ZZ4A 4KKXA 3EXTA 5I3JA 5FF0A 4JX5A 4JGDA 3U6WA 4OWGA 1C9DA 3TFXA 3E49A 5K4XA 1XDMA 5CZJA 1GT8A 3NYZA 3TSBA 4MFDA 1ZHAA 4X9SA 1R46A 1GVSA 3QSRA 4WXYA 4JTKA 4LVGA 1WYIA 3TSMA 5C5YA 1VCGA 4O14A 4A22A 1K8YA 2ALDA 4IXXA 3TC7A 3W7IA 3RK8A 4XZ9A 4O4VA 1OX6A 3UXAA 2BWGA 1KTNA 2VFIA 3LCLA 4NX0A 2A7RA 1OVDA 1RPXA 2V2CA 1SW3A 2WO5A 3NQ6A 3SR7A 1XI3A 1TPWA 3W1LA 4MPQA 1TPEA 4WQ6A 1G7UA 4QAIA 2DJLA 4JY8A 5E1QA 3GLCA 2A85A 4DQWA 5C6MA 2Y70A 1XCFA 3C8FA 3O15A 1JCXA 1FCUA 3S1UA 2ZRYA 3I6RA 2OT1A 3W1TA 5DXXA 3IIVA 2DJXA 4UTKA 2E5DA 3M5ZA 3DZ1A 5G5IA 3QRHA 3GZ3A 4O1BA 5MHBA 2H8XA 1W54A 4FB7A 1H7NA 3QQ0A 3DFNA 3LDVA 2JGQA 3M5VA 2YW4A 1XXXA 1S3HA 5AHFA 3A5FA 5A5WA 2QF7A 4Q32A 3UZJA 4Z08A 1TB3A 4MUZA 4L4LA 4QIUA 3QW4B 1PV8A 5DLCA 3ANYA 1JUKA 3MHFA 3LHUA 3W7QA 2GJNA 4IMGA 2C6QA 3TSDA 3EKZA 1JUBA 3NR0A 3EWBX 1GVQA 1SQ7A 2VXNA 3W87A 1KTCA 5LKYA 1SUXA 4WOQA 4S2BA 3W2NA 3PUOA 3DH7A 2RFGA 3KVMA 4UNKA 1JRBA 3G1VA 4NJGA 3H54A 3CWNA 4FNUA 3NZRA 3GDMA 3BW3A 2QJIA 3S42A 1QCWA 5HR6A 1RQBA 1TYGA 1DOSA 4A3UA 1FBAA 1MEWA 3BPWA 4UIOA 5ABTA 2H90A 3LXAA 2QCFA 1LZOA 4UR7A 2BLEA 5KZDA 3L67A 4WXZA 2VFGA 4BWLA 3Q58A 1L9WA 1ICQA 4BF9A 2GQAA 1IXOA 3A21A 1TJPA 3C2FA 1K02A 2AQWA 4JTHA 3RLVA 2W79A 4MZ8A 1KM2A 2R94A 2YFNA 2C13A 3P84A 3LHVA 4GUIA 4NJJA 2O7QA 4Y90A 3W7RA 4N9EA 1GYNA 1SR9A 3HGOA 3KRUA 1BWKA 3EWWA 5LNWA 5DCBA 2Q3OA 2QEZA 4MIMA 2C1HA 1YXCA 2YGYA 4AF0A 1VC4A 1F7BA 4MYAA 2NX9A 3NPWA 3G8EA 1SZNA 3W86A 4EVZA 3LCFA 5D2WA 3WJSA 2JBMA 3R89A 2B7OA 1G4PA 3QH2A 1WDWA 5DBTA 3JRKA 5E0KA 3KHJA 2P0OA 4AWTA 3A24A 3G1AA 4Q4KA 5HQEA 5E93A 5D05A 1GTHA 1TPH1 3L5LA 4RLIA 5CPNA 2G96A 3CEPA 3MJYA 3O05A 3LI1A 3O07A 5FEPA 2XN2A 5CSRA 1QO2A 3CQ0A 3W2KA 4M7SA 1FY6A 4HNTA 4UXDA 5LZLA 2C19A 5A8GA 4CNOA 1KM1A 1QOQA 4FIQA 5CZSA 2Q3RA 3NEVA 4Y9AA 3PSVA 1ADOA 3I7QA 1G6CA 2ZRVA 3TIMA 4E0CA 3CB8A 3NQGA 2Y7GA 3E0IA 4CLMA 2NXIA 3PBUA 3P5YA 4Y8FA 5I3KA 3G1YA 2QCDA 2QCDB 2VEKA 4O17A 1OYBA 4FNTA 3F4NA 3G0SA 2RHGA 5H91A 5F1VA 5F2GA 2YFOA 5CGQA 3LXBA 4FXRA 4UTTC 3V75A 4Z0SA 3RLUA 2GOUA 1N55A 2C14A 2Y88A 2EKCA 1JRCA 2V81A 3NQAA 3W88A 3R12A 4DO6A 2WNZA 2V0TA 4FNPA 1B4EA 2NWSA 2WNNA 3UY7A 3SW6A 3S1XA 4LVAA 3IGUA 4HNNA 3AO0A 2Q8ZA 3W71A 1K7EA 3IVSA 2PRLA 3RF9A 1H60A 4NZJA 4Z1AA 4UC5A 1P1XA 1W37A 3TCEA 3IRDA 3GNNA 3P7YA 4RZ4A 3NQEA 4LS2A 4AWUA 1QAPA 4HHPA 2B7QA 2ZQ0A 3G1FA 3SSJA 3BG9A 1SZFA 4O1DA 2VOMA 1F6KA 1OFQA 1ZFJA 4NJHA 3HOJA 3STFA 3OBKA 3KX6A 3A5VA 3M16A 5KTLA 5D04C 4XUGA 4YL2A 1VLIA 1KM5A 1O60A 2ZA1A 3DU0A 4BI6A 1K7XA 1VYRA 5LSMA 2NWRA 3TJLA 4GUHA 4ZQPA 3L5MA 3TH6A 1TJRA 1YTKA 2CLIA 1I2PA 3M5XA 1W31A 2EPHA 1TIMA 4PL2A 1Q45A 3LV5A 1TREA 3M47A 2QKFA 1N8FA 4UFKA 2VC6A 4BFAA 3TQVA 3SFKA 2WNQA 5BRBA 2G97A 3GXNA 4I7WA 1I8JA 3C2EA 2A6LA 2CZ5A 5FF3A 2V2HA 1DVJA 3LTPA 5IBXA 2A4AA 4ZMGA 5K4ZA 2ZRUA 3BGJA 4CQAA 5D09A 3C4UA 3EWXA 4N9CA 3HO8A 1FWNA 2GVGA 1HL2A 5CPMA 3QJAA 1RVGA 1Q6QA 2IQTA 2PCQA 3FKKA 3NQMA 4GUFA 3I7RA 1U5JA 4QNEA 3G18A 1SU5A 4OU1A 4A21A 4ZQNA 1GVOA 1A5AA 2BX7A 4FHAA 2Y63A 3LGEA 1DJNA 4H4IA 1GTEA 3W2LA 2ZA3A 3HG2A 5FF4A 2CLEA 1I2NA 1FDYA 4NU7A 3W1MA 3UD6A 3CPRA 3S9YA 5LGXA 3P61A 4O52A 1G69A 4GWEA 2QAPA 3W83A 4O53A 4JXCA 3E96A 1L2UA 3WK1A 4FNQA 3HPSA 4RCXA 3W7OA 4LTSA 3SGUA 5K9XA 2ISWA 3BARA 3S5OA 5TBOA 4PTNA 1EUNA 3W7LA 1ALDA 3NDOA 2GUUA 1FDJA 1LOSA 3ABRA 1L6SA 2XN0A 1GOXA 1JCJA 3P82A 1ZNNA 3DFOA 3BLFA 2FB3A 1MO0A 1QDSA 3NQ2A 2R8WA 3GDLA 1EB3A 2C18A 1NF7A 3KFTA 4ADTA 3W1AA 1VHCA 5EY5A 3TAKA 4LWWA 2VEIA 3LCHA 5J5DA 4HSOA 4PODA 3WFAA 3LLFA 3W70A 1VS1A 3LV6A 1SO6A 3S5NA 1IXNA 3OIXA 5CSSA 5L9FA 1XBXA 1DJQA 2WJZA 2ZZ5A 2ZZ7A 4NXSA 2C15A 1OFBA 5U4NA 1LORA 4MY8A 3EKLA 4O0ZA 4HN4A 1YTDA 3I65A 4ZZ9A 4WUIA 4TIMA 3VE7A 2YDAA 4FF7A 2Z6JA 4G1KA 4ORMA 5I3IA 3GK0A 1KM3A 1ZJIA 3P8JA 3DI1A 1NVMA 3LXCA 4Y6GA 3ZR4A 2FIQA 3DHDA 1O4UA 3VI2A 4UMCA 4O19A 3P67A 5C54A 2RDTA 1EP1A 2VEMA 2JKEA 5HJLA 2VFEA 4RXFA 3TXZA 2GVJA 5KZMA 3ABSA 2TYSA 2AGKA 1I4NA 1PHQA 4YXGA 1A5CA 2DORA 1UUMA 1S5WA 3B03A 3BO9A 1OFDA 1B4KA 4FO4A 3T78A 3W7MA 3BG5A 4O0KA 3W7EA 4LV4A 4DF1A 1SO5A 2XFWA 1WOBA 3TC6A 1WQ5A 3UWWA 3HGJA 5F2LA 4NJIA 3NG3A 1KM0A 2R91A 2V8ZA 3B05A 3M43A 4NUWA 3ATZA 3E12A 4NNAA 4M6PA 4JICA 3NZ1A 1E51A 3TXVA 1LOQA 3QMTA 1UASA 3S6DA 4FX6M 2ZYFA 4OT7A 2CFFA 2DU2A 3EX3A 1Z42A 5D2VA 4PEKA 1X6UA 4FNRA 2HMCA 3UWYA 2RDWA 3GAYA 4GNJA 4QITA 3INPA 1H61A 4J9JA 2H8ZA 3PG8A 1GWJA 4GC4A 2VFHA 1Y0EA 4K8HA 3NL3A 4CQ9A 1C8VA 5EMUA 2BZNA 4EWND 2NUXA 2ISSA 3T44A 1LYXA 4JIQA 2QCMA 1B9BA 1UBSA 3R13A 3P80A 4MOZA 1XM3A 4CCEA 3RFAA 2X30A 4K39A 3VCRA 1OHLA 3W9ZA 4K7YA 1TQXA 3PBYA 4JIPA 1OABA 5F4WA 1VLWA 1IXPA 4BWLC 3NO5A 3NVTA 4XQ6A 4O57A 4JDYA 3HG4A 3W2MA 1TPVA 4AHOA 1AL7A 3MBDA 4U4MA 1LRTA 2QCNA 3HPXA 3IVUA 2Q8LA 1LBMA 3W85A 3B04A 1P0KA 4I9AA 4ZQMA 1H62A 4IOTA 4MY1A 3L0KA 4JR5A 3N73A 4TR9A 3LCGA 3TAOA 2A5HA 2A6NA 3S1WA 2PRHA 3QZEA 3C56A 4M6QA 4LNYA 1W0MA 3LRMA 3GB6A 3IEBA 2A7PA 4TO8A 1ME7A 1SFJA 4P61A 2HSAA 4IX0A 4PA8A 1RR2A 3ZFHA 1LCOA 4O4WA 1VQTA 4ZQCA 1RV8A 5BNKA 2ZTKA 5CKSA 1TCDA 1H7OA 3M6YA 1O5XA 1TTJA 3C3NA 1S5TA 3DFTA 1OX4B 4O11A 4ZQRA 3RU6A 3LTSA 4N9DA 2VFFA 3W1NA 1W5PA 2CU0A 1VJIA 3G24A 4R33A 3UYCA 2ZRWA 3FOKA 5F4XA 2J24A 3LHWA 3FJ6A 1K3UA 3W23A 2ZBTA 1R2RA 3EX2A 4N2YA 3LLDA 2OMAA 1ME8A 2ZRXA 4K38A 1SPQA 4DPQA 4N6FA 2YSWA 1QMLA 4GUJA 1TPB1 2FJKA 3LCXA 1O5KA 3CIWA 1KFKA 3GXPA 3TR2A 3TUUA 4O1CA 5C55A 3F03K 1CI1A 3BVJA 1F74A 1FUYA 1MEIA 3PSWA 3SECA 1OF8A 4CNNA 3N2MA 1TPUA 2QJHA 1EPXA 3W2JA 3MYOA 3W1QA 3KVJA 3QPYA 3N19B 1T99A 1I45A 3L2IA 3NQFA 2B0MA 5FF7A 4O1AA 2GJLA 1EIXA 3SZ8A 3W07A 2Y7EA 3TMLA 1GG1A 2NX1A 2QDGA 1KA9F 1F5ZA 1UJPA 4JD4A 1QO5A 4GUGA 1VCFA 2CLOA 1NF0A 1I2QA 1K03A 3LTYA 1F05A 1YTEA 8TIMA 4MKNA 2E09A 4LOCA 4E2BA 1WX0A 1QPNA 3MMTA 1ME9A 3S5ZA 3NL6A 4EOUA 3UPBA 5D2TA 1RQHA 4RJEA 2GQ9A 3FYPA 3HGSA 4IGHA 5F2IA 2B7PA 1W8SA 3USBA 3HB9A 4N9BA 4MLJA 4O28A 1P4CA 5FI8A 4S2CA 5BOOA 2Y61A 2Y6ZA 3LHZA 1H7PA 3DBPA 2EF9A 2KZHA 4RR4A 1Q6RA 3UNDA 3E02A 3BW2A 2NUWA 3TK7A 1D9EA 3UWVA 1JCLA 3EXRA 2UV8G 1JVNA 3HG3A 4H3DA 3UWZA 1FWTA 3MI3A 5DBUA 3C2RA 2WSRA 3IGSA 4L4MA 1JR1A 5K7JA 5AHLA 1QFEA 3NPVA 1XL9A 1NEYA 5G2WA 1SZGA 2G95A 4JDBA 4TMBA 3LCWA 3S5YA 5D33A 4GBUA 3FA5A 1Z44A 3P60A 3G1SA 1AMKA 5G4WA 5IBXC 5U7SA 1GVFA 1W3TA 5CZ0A 4LS1A 1F2JA 2XN1A 1HFBA 2P1FA 3PWAA 3LCIA 3KOFA 1LBFA 3W84A 3IV3A 1VR6A 4UTIA 1XC4A 2NXHA 4UFJA 3G1DA 1KV5A 3MP4A 4BK9A 3FYOA 2QR6A 2DZTA 2F7FA 3O6YX 4IX2A 4WJEA 4QM1A 3ATYA 2Y7DA 3B8DA 4W9TA 3TU9A 2FQIA 4BR1A 2I14A 5AOUA 4ADUA 4TX9A 4UCGA 4Z1CA 3UPWA 3O63A 3E9AA 1LOLA 3TW7A 3DKLA 1KLZA 3M44A 3CHVA 2FDSA 2V30A 4R53A 5K3VA 1UUOA 2A2IA 3Q2DA 1TV5A 3NM1A 3GR8A 1SW7A 1WA3A 4BI5A 3O06A 3TQ0A 3ZWSA 1HUVA 2HTMA 2GQ8A 3QC3A 1BTMA 3IVTA 5D03A 2RDUA 3L5AA 1EP2A 4N4PA 3I68A 2V82A 4DBEA 2C16A 5DELA 4C1LA 1VCVA 1LP6A 3GX9A 1H7RA 4JYDA 3N9SA 3KXQA 2A21A 4NVTA 2JK2A 5AHMA 1KM6A 1W5NA 4GE8A 4DXVA 4LVFA 5KINA 1OK6A 2V5BA 3TQKA 4DO4A 3Q94A 4K6AA 5DY2A 3G3DA 4LC8A 4YWIA 1QR7A 3G22A 4LVDA 3IGXA 4QISA 1LTDA 4EIVA 3OEXA 1YXYA 3B06A 3BW4A 3LBMA 3LRLA 5AYZA 3L65A 3QPZA 3W7CA 4UTHA 3QQ1A 3RMJA 3G0UA 1GJPA 2GPTA 2DZXA 4UTLA 3C52A 3N14A 3HIJA 1F76A 2CZEA 3ELFA 5GVJA 2ABAA 2Z0IA 3LHTA 1EP3A 2OZ0A 3LM7A 3M9YA 1KW1A 4AHQA 3OHIA 2NXGA 4K7VA 2PE4A 2NLIA 2ABBA 4X2RA 4PC8A 2ZTJA 4DELA 2ATMA 5IM51 1K8ZA 1TPFA 1N7KA 4AMAA 3W7HA 4WX2A 4UFMA 4JTGA 4E2DA 2NUYA 4IJBA 1YDVA 3S1VA 3N2XA 5AHIA 4LRTA 1OK4A 2ZCGA 4BI7A 3PBVA 3MP5A 3OG3A 4ONVA 4XTIA 4AB4A 1PS9A 5EL1A 5D02A 4NT0A 5HWMA 4NQ1A 2QUUA 1W5MA 5TQLA 3LB0A 2TRSA 3NNTA 3NQDA 2ZRZA 1KFBA 3QEZA 2ISVA 1A50A 3LERA 1A5BA 2CZFA 4XTDA 2B7NA 3QMRA 2FB2A 1GVRA 2GVLA 4QQ3A 2HS8A 2Y62A 2X1UA 5G2IA 1T8XA 2J9YA 3O16A 3N3MA 1EUAA 1OJXA 2DZWA 3HJZA 1ZCOA 3R2GA 1J2WA 5D30A 3L68A 2Y89A 4JTTA 4FIRA 6TIMA 2YX0A 4ZQOA 1Q6LA 1FDZA 4LUIA 3GAKA 3TA6A 2W6RA 1FWRA 3P62A 1XBZA 4RV8A 5LGZA 1YYAA 4DPPA 1TSIA 1PCKA 4NZFA 4WY0F 2TMDA 5AC8A 2QJGA 1HG3A 4NX5A 3C2OA 4MYXA 4KWWA 1WAUA 4X22A 2CLLA 1A53A 1TTQA 4HPJA 1PIIA 3GDTA 3PAJA 1GYLA 1VGAA 3PB2A 3BV4A 4PH6A 2OCZA 1D3HA 4O16A 3EX6A 4TMCA 1QPOA 1D3GA 1X1ZA 3LRKA 4O18A 4RK8A 4MZYA 5KSWA 5SWUA 1JJKA 1G7VA 7TIMA 1YXDA 3W6YA 1FCVA 5HWNA 3FFSA 4ICNA 3TX9A 3UY8A 5I3GA 1OFRA 3DKJA 1TRDA 5H2ZA 4DF2A 3T55A 2I9EA 4JEQA 3L0GA 4I7VA 4K37A 4AHPA 2Y7FA 3MWAA 1GZGA 3W75A 1ONRA 5FEZA 5EPDA 2H6RA 3DFSA 3CU2A 1AG1O 1FQ0A 1FXPA 3DI0A 1M6JA 3LI0A 3C61A 4YMZA 4UUIA 1OFOA 2E6FA 3BLEA 4A2SA 4XKYA 4XKYB 1Q6OA 2JKAA 2TSYA 3U8GA 4UTWA 1OFEA 4Y96A 4UMAA 5D2YA 1ICPA 3L9CA 4Z1BA 1PL9A 2Y85A 5C2XA 3P8IA 1DORA 1KFJA 1IGSA 4YCPA 3MBFA 3VE9A 1M7OA 2F84A 4XWUA 2VELA 4M19A 5CZTA 3UQNA 4LS0A 5F1UA 3H55A 3TDFA 1XBVA 3GYEA 5D32A 1VPXA 2YW3A 3PR2A 3NAVA 1AW2A 1ZAJA 3WK3A 2P10A 1EEPA 1OFAA 1QNVA 1T96A 1R2SA 3UWUA 3QFEA 4QJ1A 3RNDA 1ZENA 3LBCA 4A2RA 2NZLA 3G1HA 1MEHA 1QWGA 2C3ZA 1TO3A 2RKXA 3TMQA 2CW6A 5G2HA 1XUZA 2FLIA 1QOPA 3SGZA 2FFCA 4I7UA 4IMEA 4LV9A 1DQXA 3NXFA 2X2GA 3C2VA 1JQXA 4MVAA 3MHUA 1H7XA 2DZSA 3LX9A 2PC4A 4LW7A 1S5VA 4AXKA 4UR8A 3PUDA 2QCHA 3GKFA 1MSSA 3QYQA 1UCWA 4RZ5A 1JCYA 1KFCA 5HINA 3GDKA 1ZALA 5LNUA 1I2OA 3W1PA 3SY5A 4M7TA 2BTMA 3M5YA 5EBUA 1THFD 5EYWA 3F1QA 3CWOX 3VFLA 4HSNA 3UZ5A 3OVRA 3UXDA 1YADA 3CC1A 5DCDA 5K2ZA 2A1YA 4AVFA 5F4SA 5AN7A 2WOQA 1LRNA 1EWDA 1DV7A 1GPWA 3OVQA 1LLZA 1KM4A 1IIHA 1O95A 4IXHA 4JTEA 5LHFA 1AK5A 1M5WA 1HTIA 4JN6A 4JTFA 1SZEA 2HS6A 1H5YA 5AYXA 1KFLA 1DQWA 5L6UA 2W0UA 5EA9A 5I3FA 3FKRA 2VENA 2ZZ3A 3KVKA 3IIPA 4QSHA 4HNUA 4UFHA 1YDOA 1X8FA 5HR7A 2JKPA 3W1RA 3R5EA 3W7KA 3W72A 1SW0A 1XUUA 4AH7A 1P5BA 2A7NA 1OX4A 1YPFA 3TV8A 3VKJA 2Z6IA 2QUVA 3S8HA 3PS7A 6ALDA 1R47A 5D38A 3CEUA 4HNVA 3STGA 2QCEA 2DZUA 1DKWA 1GEQA 4MJMA 3HG5A 4YCOA 1FX6A 3FEMA 4IPJA 4UMBA 2ZZ2A 1L6WA 1TV8A 1AL8A 1C29A 3CIXA 4OE7A 2NV2A 1OX5A 1ZAHA 4JTJA 1LM1A 2R14A 4ZL1A 4MFEA 2E1DA 3MI6A 1KBJA 2FPVA 2CLKA 3F4WA 1JUEA 5EKYA 1BKSA 3EWZA 4UFLA 3CM4A 3EB2A 2VEPA 2FPTA 3DENA 3PULA 5DCEA 4JNMA 3W74A 2QDHA 3BLIA 3L66A 3TE9A 3MYPA 4H6KA 1QPQA 2O7SA 3N9RA 4D2JA 2YCEA 4N02A 3ABOA 3V1PA 1PCWA 1IXQA 4N6EA 3SI9A 2CLHA 1SO4A 2ATSA 4E38A 4O50A 4WZHA 3W7GA 3PY2A 1X7FA 3BK0A 3EWYA 4POCA 5KITA 4OV4A 2YXGA 1K8XA 1J5TA 4K8EA 1M7PA 3TJXA 1XBYA 2D73A 3HBLA 1MZHA 3N34A 3PB0A 4O15A 4Q33A 3H53A 2WSYA
chains in the Genus database with same CATH superfamily
4D6JA 2FPYA 4W8BA 3D3FA 3UWQA 1UKQA 2BGNE 3NFUA 3LHYA 2XIJA 2CBVA 1MXDA 3M0KA 1W1ZA 3VGEA 4DO5A 2DZVA 2VUNA 4HJWA 5CBBA 3CHDA 2F9RA 4ILSA 3WQOA 4O13A 1UOKA 3BLPX 4K36A 1P6BA 1AQHA 4LFYA 5KMYA 3GFYA 5IOBA 3MMDA 4FNSA 3LPGA 3EEZA 5AYYA 1VH7A 3KVLA 1U30A 3QSTA 2DP3A 2X1SA 3N12A 1QHZA 4HIBA 3GIQA 5G4EA 1TTIA 1NU5A 1OF6A 3MS8A 5F7UA 1NSJA 4AFYA 1HXJA 1IZJA 1W3LA 1NDYA 4WD0A 2WVSA 1QI0A 3PM6A 2W5FA 4J5NA 3L4UA 2QDDA 4GC3A 3M7WA 1L6YA 1BWLA 3WEZA 4U28A 2HE5A 4ES4A 1Q6DA 4W85A 1C9WA 3U2OA 4PCFA 3VABA 2QMKA 1UH3A 1XIDA 4Q8MA 3T07A 3B4YA 4GJJA 5EU9A 3V18A 1YBQB 3WL0A 3W3OA 5TIMA 4V15A 2AL2B 5J5RA 4DNHA 1V6TA 4X3ZA 5A95A 3CTLA 2OO0A 3GRIA 2INFA 3MV01 1VP5A 2C1GA 1PKYA 3G2GA 2PDYA 3NZGA 2IQDA 1TZ7A 3I7SA 3M0LA 4MWAE 4UTUA 3D47A 5HUOA 3CZGA 4M6VA 3AIRA 3AMGA 3SAZA 4CD5A 1OIFA 2CWNA 2D2JA 2QCGA 2BXVA 3WJWA 3WY1A 1UP2A 4IQLA 1R30A 1LLWA 3BAWA 1L6FA 5HPOA 2FHFA 3FS2A 3S6TA 2X0SA 3IJDA 1QNSA 3BV7A 1H1ZA 3HA1A 4MY9A 1VFOA 2P5NA 3WYZA 1DWGM 3B9EA 2CBUA 4QGCA 3CYVA 2QDEA 1KXQA 3DGRA 3R25A 3NSXA 2OGYA 4O12A 1UZDA 1R38A 1IGWA 4FXSA 3T4WA 3CT7A 4FPSA 1G67A 4IMAA 5CJNA 1Z41A 4Z42C 4IPIA 3MHGA 3T40A 4KFOA 2VM8A 2IS7A 1WDRA 3CGTA 4V28A 4UOQA 4E2VA 2ZKMX 1B57A 3U0HA 2ZDRA 1D7KA 3JS3A 4HPGA 5HNRA 1Q4NX 1BRLA 1ICSA 2ZWYA 3NOYA 5A6SA 3IK2A 2E6AA 2QUTA 2YDQA 3WBAA 2PGFA 2D0FA 2BSLA 3BG3A 3FHAA 2TPSA 1CDGA 1HP4A 2DSWA 2VMFA 3QV7A 4RXGA 1XF0A 4AX7A 5LNSA 2DQWA 1E6QM 3NPXA 4V27A 4RE4A 3SN1A 3WDRA 4UTWC 4B5NA 1G4EA 4LALA 4PL1A 4G6CA 1Z9AA 2XH2A 2J88A 1XC6A 3NL2A 2JQXA 2PUZA 1PVNA 4XBSA 2RH9A 3GNDA 5CPLA 4JTUA 1XLGA 4JFTA 1KLYA 3GVGA 4QCFA 2E7FA 5F2MA 2VFDA 1TPC1 1I2RA 3VNDA 3G3MA 1YW1A 4NJKA 1PZ1A 5JUVA 3TN4A 1KFEA 3QMSA 2GDQA 3NPUA 3EX4A 1OGSA 3SQLA 4ALDA 3ONCA 3OQ8A 1EZWA 4LT9A 1Q5MA 3CQIA 4M5PA 3ABQA 3N04A 5LIXX 1DL3A 4FLQA 3STCA 3ZVIA 4AG0A 4ADSA 2E5CA 3VIGA 5AC7A 1TWSA 3PTMA 4NXKA 3V35A 4DF0A 4JY9A 3NM3A 3KW3A 3VC5A 2YZRA 1JQVA 4IPNB 4FLRA 3MMWA 5C9UA 3GVWA 3MZ2A 3ZIZA 3VIJA 1O68A 3TOPA 3WK2A 1UUQA 1CXIA 1ADSA 3G8RA 3C2YA 1EC7A 2OEKA 3UJRA 4JYFA 5JXQA 3QM3A 3T0AA 1CW2A 3O6DA 2E4TA 3GKAA 4N7QA 5FEXA 1FWHC 2ZUMA 5HUPA 1ENUA 3W7NA 4IMDA 2PMQA 1J4EA 2G5WA 3L4ZA 1XYFA 3DESA 2E77A 4JTSA 4FAMA 2P88A 5AC6A 1X97A 3KL3A 4JIRA 3KDOA 1RAKA 3AIUA 1SSGA 4BEUA 3BGGA 1B54A 9XIAA 5LNVA 4WY0A 1POJA 1OFPA 2CCRA 3GY1A 2Y24A 3GTFA 3OVPA 1PE1A 3OA3A 3QF0A 4MLRA 3RGTA 3DFQA 1TPDA 1OY0A 4JTIA 1LG1A 3A4XA 1W3HA 3EXSA 5HQLA 4EF8A 2WSQA 5EFDA 2DUXA 2PU1A 3OO2A 4N4QA 5D8WA 5HULA 3UGVA 1DIDA 1X1OA 2Z1WA 2Z1XA 4DHGA 4HK6A 1IR2A 3AMDA 4IGSA 2A0NA 4RW3A 3K30A 4J28A 2I7GA 2ZXBA 4JCLA 1GT8A 1CXHA 3H12A 1L2QA 4L9ZA 2NT0A 1E9ZB 1A80A 1GVSA 3POCA 4WXYA 2OO6A 1FKWA 3TSMA 3AFBA 4O14A 4A22A 2YZ5A 2ALDA 3VD4A 1US2A 3LCLA 4IIFA 4US5A 2A7RA 1R3TA 3BURA 2V2CA 1GORA 1A5UA 5E6YA 1G7UA 5EBAA 4QAIA 3BOFA 1FHLA 2Q8XA 2C7FA 4GH3A 4HMNA 4H19A 2A85A 1DWFM 4HCHA 1KKRA 2Y70A 1XCFA 2F6XA 2OGJA 5A6TC 2NT1A 3GYCA 4PR4A 3S1UA 4QCEA 3I6RA 4UTKA 4ATDA 3GZ3A 1DJWA 1CEOA 1W54A 2CESA 4US6A 3KLKA 3QQ0A 4HCLA 3FCPA 2YW4A 1WO2A 4Q32A 1MZRA 4Z08A 3A3XA 1XS2A 4ZB0A 3ANYA 1JUKA 3LHUA 3GH4A 2GJNA 4IMGA 4E3VA 1RJQA 5EB8A 3Q67A 3WH6A 5G1MA 3W2NA 3CJPA 3PUOA 4JPGA 1R3WA 5GJPA 3KVMA 4HHLA 1JRBA 3G1VA 4FNUA 3ES7A 3MZNA 3NZRA 3VIPA 3ITTA 3UA3A 4ZGYA 4NI8A 4GZJA 4IIGA 4PTWA 4A3UA 1FBAA 1OBAA 3BPWA 4UIOA 1EHNA 1BYAA 1Z89A 2OU4A 1QNQA 7REQB 3V5CA 5KZDA 3KM8A 4M56A 3VDHA 3A64A 3Q58A 1A4LA 1JYWA 1DJHA 1IXOA 4Q4RA 3GU1A 2OODA 4J27A 3E5BA 3RLVA 2W79A 4CUCA 3LHVA 1T40A 3AC0A 4IGMA 4Y90A 4KEMA 3W7RA 5C70A 4GY7A 4WDTA 1GYNA 4IP5A 3HGOA 1K70A 1ZL1A 1KBKA 3U7BA 1FWIC 2Q3OA 2QEZA 5DMNA 1E4IA 2W4XA 3JZUA 4MYAA 4DX3A 2Z2AA 3LCFA 3WJSA 3KCOA 3CZLA 4JTAA 3K13A 1FRBA 2IMRA 2P0OA 3A24A 1FH8A 5HQEA 1MNZA 5CG0A 1TPH1 5CPNA 2RGMA 3CEPA 3O07A 4IIHA 2NLYA 2POZA 5CSRA 3CQ0A 4I8DA 1LUCA 1QI5A 1HQTA 1FY6A 2C19A 4LNCA 4H9ZA 1KM1A 1UC5A 5CZSA 3NEVA 1Q66A 3HZ3A 2XFRA 3IJ6A 2QV4A 1B5TA 4NAEA 1A0CA 1BYCA 4CU8A 4BJHA 2Y7GA 1CLVA 1UOZA 3E0IA 4XO7A 3FGCA 3PBUA 1VJSA 4V2XA 7XIMA 2QCDA 5CPTA 3S3GA 5F1VA 5CGQA 4PBFA 5BXSA 1O1ZA 4FXRA 3V75A 1E72M 4Z0SA 4IZGA 3RLUA 4OUIA 4OVXA 2C14A 3CV2A 1FP8A 1JRCA 1XLIA 3J7HA 3NQAA 3W88A 3H2OA 2WNZA 1P48A 4NF7A 3WF3A 1HJWA 3WUBA 3PNUA 3CMFA 2WNNA 2BY0A 4XG1A 2HZGA 3AO0A 2Q8ZA 2W92A 2PRLA 4DVOA 1KNWA 4CD4A 4Z1AA 1P1XA 3TCEA 3Q4DA 3IRDA 2BS9A 2PD9A 4LS2A 4HHMA 3AXXA 4KRTA 3LY0A 1SZFA 4O1DA 4HD5A 1OFQA 1IHIA 4MF4A 3OBKA 3WDHA 3A5VA 3M16A 2J7EA 5D04C 2WHJA 4XUGA 1V3LA 2J7HA 3KBWA 1O60A 3DU0A 3H2FA 1I6NA 3TJLA 3RIKA 4ZQPA 2PB1A 3TH6A 1XG3A 1YTKA 3ARVA 1KXHA 3P2VA 3L4XA 3WNKA 3MUY1 1TIMA 5BWAA 4PRWA 4GYPC 3LV5A 4UBPC 1KD0A 2QKFA 4H9TA 3GDBA 5FOOA 1N8FA 4UFKA 8XIMA 3A4WA 1FWFC 2YL9A 1ZJAA 1D7FA 1MW0A 3E0VA 5B7ZA 2G97A 1I8JA 2CZ5A 1DVJA 1UBPC 5IBXA 2FGLA 1EOMA 4IFRA 5K4ZA 5D09A 3VDGA 1PWMA 3RM4A 3VOIA 2GVGA 1R85A 1RA5A 3QJAA 3H7VA 3T8LA 3NQMA 4G5DA 4A3YA 3PTKA 1KC7A 2VGFA 1U5JA 1V7AA 2C1IA 3G18A 4WCJA 4G7EB 4JCMA 1GTEA 5I3DA 3HG2A 5FF4A 1E3XA 1FDYA 1S2CA 2D2HA 3UD6A 2FHCA 1EEXA 3MMUA 4DXXA 1D3CA 5LGXA 3P61A 4O52A 1E5NA 3IUHA 1G69A 4GWEA 3W83A 4Z2HA 4O53A 5CAHA 3VGDA 2WZIA 3BARA 3TZNA 3HQNA 3WLPA 1EUNA 1ALDA 1J18A 4C6NA 4A3HA 1MQPA 1L6SA 1HKWA 2QUNA 2XN0A 4NZ3A 1ZNNA 4BY3A 1CGWA 3NSMA 3AIVA 3WH9A 1FP9A 1HKJA 3GDLA 1IZCA 1PX3A 1TUFA 5JBFA 4I3GA 4ADTA 3CQJA 3ZSSA 5M17A 3C0LA 3WKZA 4GO8A 5EMLA 2J79A 3L2LA 3WFAA 1AQMA 1GQJA 4JTQA 3EOUA 3WQVA 2OXNA 1CENA 3DG6A 2WJZA 1I75A 1MYRA 2ZZ7A 1OFBA 4F2BA 4MY8A 3L23A 1C8XA 3V4BA 3EKLA 4O0ZA 4HN4A 3I65A 3VE7A 1RLCL 2YDAA 4ORMA 5LA2A 1XRSA 3VA8A 3DI1A 4W86A 3LXCA 4ZR8A 2FIQA 1TMQA 1J2BA 3VI2A 4KEVA 2GVYA 4AZ6A 1S5NA 4O19A 4HYVA 3QR0A 1BD0A 2RDTA 3PJXA 2VEMA 2EG8A 5HJLA 2VFEA 2ON3A 3CYJA 2IKIA 3FV9A 3M4HA 4PRRA 1BQCA 3TXZA 4HMCA 5E5CA 1I4NA 4DUOA 5HNTA 4J2MA 2XU2A 2EKGA 2Y5EA 1A5CA 3H2MA 4GX9A 3B03A 4HU3A 2YDRA 2NQZA 4RPQA 2OELA 1POKA 3BG5A 4LV4A 2XFWA 3QOMA 3RO6A 1QW8A 3NG3A 3AHTA 4RNIA 3M43A 4NUWA 4F79A 1B9ZA 1VFMA 3NZ1A 2PDBA 2HNHA 3QMTA 1UASA 4FX6M 4DYKA 3UZZA 2VNCA 3EX3A 3FK4A 4GABA 3EA3A 4Z1YA 4PEKA 1X6UA 4S39A 1XIFA 3WO8A 2O9RA 3MANA 3UWYA 4Q22A 4UZUA 2IPFA 1EA9C 2WW5A 3N29A 4J9JA 2H8ZA 3TTOA 9CGTA 1Y0EA 1J01A 3NQBA 2J8FA 5EMUA 4JTDA 3IUDA 2NUXA 3SN4A 3QYSA 2QVNA 1B9BA 3R13A 3QKZA 4ZO6A 1MW3A 4CCEA 3RFAA 3ITLA 3EOEA 2X30A 1ISWA 2GWNA 1TQXA 4NYYA 4DWDA 4TV6A 3H2CA 4J4KA 3MUAA 3AYTA 3NVTA 3GU2A 3C0QA 2IPJA 2OSXA 4O57A 3AZTA 2DUZA 4AHOA 1EHAA 2PTZA 4GQRA 1AL7A 2CXEA 4XZMX 1LRTA 2QCNA 3IVUA 3VOFA 4P8XA 3B04A 4PRTA 1F6YA 1P0KA 3VUPA 3GUGA 5JBDA 3OG2A 4MY1A 4AD3A 2C8NA 3TAOA 2ZE3A 1K6AA 1M41A 4CD7A 1XQLA 3C56A 4R27A 2DSZA 4KBXA 3VGFA 4YTUA 5DQPA 3N6JA 2A7PA 4TO8A 3TZFA 4NHVA 3P0WA 1I9CB 1QXLA 3CT2A 1RR2A 1WZLA 3ZFHA 1LCOA 2CXGA 4O4WA 2BBFA 4FA3A 5BNKA 1VFUA 3UU0A 3M6YA 5A8NA 3W37A 2OQHA 4KWSA 3PZIA 2YLAA 4B2DD 5T9BG 4O11A 2BHUA 3ARZA 4ZQRA 4XISA 3G24A 3TWAA 3WD0A 5F4XA 3QLDA 3LHWA 3FJ6A 2ZBTA 2OMAA 4K38A 2YSWA 5E0FA 5IFTA 1G0CA 2XPKA 1I60A 6XIMA 3TR2A 5C55A 3TTQA 1FUYA 3W4RA 4G7FA 1Q7MA 1UR3M 3TYEA 1PZ2A 3S83A 3UFYA 1SJBA 2PDNA 2PWUA 3QPYA 2Q71A 1I45A 5LIYX 4FLOA 2J7FA 2B0MA 2XSBA 4UQ9A 4KEUA 1EIXA 3SZ8A 4IPPA 3TMLA 3WDQA 2G50A 5DX7A 1F5ZA 4LUTA 1FWDC 1W1B1 1VCFA 4K3ZA 1K03A 1Z32X 1YTEA 8TIMA 3S2CA 4MKNA 5KEZA 2VR2A 1RP8A 3S2JA 4LOCA 4E2BA 1E71M 3MMTA 4OKDA 3NL6A 4EOUA 3JZEA 3NDYA 3P0XA 1D8CA 3W01A 3AS2A 1JDEA 1WUFA 2BXYA 3AZRA 4RJEA 3TN6A 3QTPA 1TWZA 4IGHA 2BHZA 1ZBVA 1RY8A 2HRWA 2IKJA 2HVNA 3GH7A 1P4CA 5BOOA 4HP5A 3R4IA 1PZ0A 1EF2A 3DDMA 3DBPA 4H8HA 3WLIA 4KWUA 4I9TA 1RCXB 1RBAA 2KZHA 5EGRA 1Q6RA 4ZXOA 1M9HA 3EXRA 3RPDA 1JVNA 4NAFA 3HG3A 3VZYA 4H3DA 3AUOA 3UWZA 1ISYA 1FWTA 5DBUA 2WMFA 3U4FA 1YX1A 1E0XA 1QFEA 3W38A 3NPVA 3U2CA 3HN3A 3HV9A 3PANA 2G95A 1REQA 4K8GA 2QJJA 2WBKA 5D33A 4GBUA 1ODZA 3KOWA 1ZTVA 3H8AA 3W6MA 1UWRA 2YXXA 4JL1A 4LAKA 3IAPA 5CLTA 2W61A 1F2JA 2XN1A 1B90A 3PWAA 2P1FA 3LCIA 3T0CA 1VR6A 4GKLA 1GHRA 1S2UA 1U5HA 4UTIA 3SRKA 3LU2A 2YIHA 3B9NA 4UFJA 1XLMA 2BOEX 1KCXA 4NYUA 2DZTA 4IX2A 4S3EA 4QM1A 4P8WA 2MNRA 4D8ZA 1U22A 3ARRA 2Y7DA 3TU9A 1MI3A 1VD6A 4BR1A 5AOUA 3JU2A 4UCGA 2DH3A 3E9AA 2GGEA 2QMJA 1DXIA 3ERPA 4MMWA 5CJ5A 3DKLA 3CHVA 4ASTA 4R53A 1UUOA 2L5HA 1ZJBA 2A2IA 2FFIA 3Q2DA 3GR8A 3NDZA 4BI5A 3VIKA 4W8AA 3TQ0A 4CD8A 3A4AA 5CGMA 5JU6A 1BTMA 3IVTA 3LSBA 3I68A 4DBEA 1V6YA 4LYRA 1CECA 3EAUA 4IGNA 4C1LA 3W6LA 1LP6A 1H0GA 2E25A 1UA7A 1FWJC 3MJMA 1KM6A 1OT1A 4KF1A 4GE8A 4LVFA 5KINA 1OK6A 2VWTA 4JOMA 1LL7A 4K6AA 5I24A 1R7OA 4QISA 3GW0A 3OZPA 3T0DA 1GOIA 3LRLA 5JMUA 3IJ7A 3QPZA 4JZ5A 1TFVA 4E4FA 1PJ9A 4RDVA 3K46A 2GPTA 3CB3A 4UTLA 3VCNA 3N14A 3HIJA 5FCZA 5GVJA 1GGOA 1P1MA 4KCVA 3LHTA 1EP3A 2OZ0A 3WDIA 3LM7A 2PDJA 4DIAA 4AHQA 2X2YA 2NXGA 4MWAD 4A8IA 1EFZA 2ABBA 4X2RA 5IRPA 2ATMA 2WMGA 3ZVHB 1MNSA 4ZE5A 7ODCA 4GINA 1Q6GA 4WX2A 1SM9A 4YS1A 4PMVA 1GOMA 1A0DA 4IJBA 2R6OA 3NO3A 5HJXA 3S1VA 2CBIA 3KE0A 1MFUA 4J3WA 1UIPA 1B30A 3ABZA 3FHQA 3R8GA 5FJIA 3OG3A 4ONVA 1XWYA 1ZSXA 4NT0A 1W5MA 3SCQA 3G5EA 3BJFA 3FVDA 3NNTA 3NQDA 3M7SA 1XIHA 5REQA 1PYFA 2CZFA 3PZTA 4QG8A 1C7SA 4J40A 3ENLA 4LSBA 2FB2A 3AS0A 1LT8A 4ENLA 4W5UA 2IKHA 5HJYA 2X1UA 3V3WA 2J9YA 3O16A 3GH5A 1V3JA 3N3MA 2C0HA 5FL0A 2CWXA 2VJXA 4MTVA 1R87A 1KWGA 4HCDA 1AZ1A 4JTTA 2XVNA 4AIBA 3GAKA 1H3GA 3BXWA 5E9AA 5C2CA 1QNPA 3VOGA 2VX6A 4JFUA 6REQA 4DPPA 1TSIA 1JCTA 3ARUA 2Q6ZA 5I79A 4W87A 3SURA 3K8MA 1M01A 6PTDA 1A53A 1TTQA 2W67A 1LF1A 3C5QA 3GDTA 4A3RA 1GYLA 2VDGA 3PB2A 4BF5A 3R0DA 1PTGA 2Z7GA 2OCZA 2F38A 1GVYA 2GJXB 2NVAA 4TMCA 1D3GA 3H21A 3S2NA 1SFSA 4CNUA 2CETA 3SY8A 3HU7A 2ZX9A 2ZXAA 1V08A 1V51A 3W6YA 5AYBA 1ISXA 1NFGA 1DWIM 4PUNA 3BC9A 2VRKA 2CHOA 3UY8A 5I3GA 4WJXA 1EJTC 4NIRA 4J3ZA 3DKJA 2PP3A 3GVRA 3W27A 1GZGA 3F4CA 1ONRA 3ZR6A 3DFSA 1FQ0A 1M6JA 2GUBA 4GVFA 4FK9A 2XH0A 3C61A 3ORWA 1E1FA 5JBEA 3MT1A 2E6FA 3BLEA 1Q6OA 4P7OA 4HOZA 4UTWA 4D6EA 1OFEA 1NQ6A 3QHNA 1JPDX 1XYMA 1Z7AA 3WLSA 4Z1BA 3P8IA 4W5ZA 1KO0A 4H8VA 4YCPA 3VE9A 3O7UA 4M19A 3RU8X 2V63A 2BY2A 1BHGA 2FZNA 3NAVA 1ISVA 1OFAA 1T96A 1SMDA 4HU4A 3DYPA 3UWUA 4D6CA 1W1YA 4A2RA 3RILA 2C3ZA 3TMQA 2WMHA 1QW7A 4KT2A 4I7UA 4WJ8A 4IMEA 1KCKA 4LV9A 3EOLA 4AZ7A 4LUYA 4C7GA 3C2VA 4MVAA 1C3FA 3UR7A 4IP7A 4X60A 1DJXA 4QE5A 2PC4A 1S5VA 2DSVA 2C79A 1DYSA 2QCHA 3SCPA 3BCJA 5HINA 4LUSA 3F7JA 4L6DA 3EDDA 3SY5A 4Q4PA 3K4DA 2BTMA 3GNXA 2D69A 3M5YA 4BS0A 1BG9A 3OVRA 3UXDA 3CC1A 2OVLA 3IRSA 3FX4A 1NOUA 1EWDA 4ZXLA 3I3BA 3WZ0E 1SMAA 1KM4A 1IIHA 4JTEA 4E2OA 3WQPA 1M5WA 5L6UA 4GJIA 1KQZA 3TTSA 1E3ZA 5FACA 5HA7A 2VEGA 1Q7ZA 2D0GA 2FTWA 3W1RA 2RJGA 3W7KA 2P8BA 2ONEA 1SW0A 1XUUA 1Q13A 1YPFA 4GKTA 4AD4A 3VKJA 2Z6IA 1O7AA 4S3FA 1MW1A 2XIOA 4GYKA 1EOKA 5DRCA 2YL6A 4HNVA 4OOUA 4MWAB 1B3VA 3I6EA 4MJMA 3PZNA 4YCOA 4FSAA 2SFPA 3SUWA 3MDUA 1AL8A 3A12A 3MWCA 4D6FA 4OE7A 4DNMA 2BOFX 4JTJA 2R14A 2J75A 3HJEA 2FPVA 4XZIA 4KIRA 5EKYA 1BKSA 4PCTA 1J5SA 5GNYA 1XP3A 4JFVA 3EB2A 2FPTA 4V1XA 2VVSA 3I3DA 4WDUA 5DCEA 3USZA 3VX1A 4JNMA 3L66A 2OFJA 3T0TA 4X2PA 2O7SA 4D2JA 3WLJA 3MU7A 1TIWA 3P6LA 3SUUA 3ABOA 3V1PA 2CLHA 2VUYA 4WZHA 2VD9A 3BK0A 4ZOEA 3EWYA 4OV4A 3RITA 2YXGA 1J5TA 4AUBA 4LANA 4EPDC 1DJGA 4F2UA 4O15A 1V3KA 3H53A 3BUVA 3E6EA 1YIXA 2H3DA 1AW1A 3BCDA 3RRAA 2QJNA 1Y5WA 3IJIA 3CUGA 4UTJA 1TELA 3QY6A 1IEIA 4KMQA 3BLDA 4K1WA 4L1WA 2YA0A 2CKRA 1KGXA 3DN5A 3HF3A 2QCCA 3PBWA 2P0IA 3B8SA 2J6XA 4DJEC 3VU2A 2UY5A 1JGIA 4AF0B 4R88A 3IJQA 4PMUA 3RLHA 4AU0A 5C9XA 1C90A 2X1RA 5BU9A 3H2NA 1P0NA 1M04A 4F4RA 2I57A 2J25A 4DB7A 2BXZA 3NQCA 4LF2A 1N8WA 4YVPA 2QCLA 4JS3A 3BOLA 1TUXA 1A5SA 1XIJA 2BGSA 1XIGA 5CG7A 4C1NA 1W56A 4PZVA 3A22A 2PWHA 2V2DA 3MQTA 3OIHA 1M53A 3UZYA 1WKDA 2YB1A 3E0LA 2HVMA 4DBUA 1I1XA 1PX8A 4GIEA 4UFIA 1OG0A 1Y7VA 3GS6A 2CIPA 1OM0A 3MUXA 1W5QA 3LOTA 3ZQ9A 3TJIA 4S3GA 1HKVA 3AUJA 2E6YA 1P0EA 1PBGA 1W9XA 4QEHA 2AKZA 3C6CA 3WJZA 1J93A 1F4HA 2WPBA 1J0JA 3DOPA 1AW5A 3TVAA 2DQXA 3D3AA 3HV8A 4NNBA 1XFBA 3OYXA 3VKKA 3B0UX 3DXIA 4UNLA 4QRNA 1FHDA 3TNOA 4YTTA 4CQDA 2ZE0A 5K9CA 3MTWA 3A3WA 3F4VA 3HGRA 3AMKA 3DFYA 2YKKA 3ZWTA 1TVNA 1XW8A 4MZ1A 3M0ZA 2ACRA 4Z0JA 1IEXA 3ITCA 2D3LA 3R10A 1V5XA 4PMDA 4MGGA 4DM1A 1GJUA 2CLFA 1PTAA 1TV7A 4US5D 3V5FA 5G1YA 4AYSA 1QUMA 1SYTA 4AEOA 1XSKA 2H3BA 4ML9A 4ECLA 1LRQA 4GJ1A 4JTRA 3SJ3A 4UZSA 4RZ6A 1JULA 1A3WA 1FXQA 3W2UA 2WCGA 5CCZA 4FX8A 3NCOA 3WQWA 3Q37A 3THAA 1RP9A 2DIEA 3EWUA 3W22A 2E28A 2WVTA 3UT0A 3B0VC 4J2PA 4DN1A 1TQJA 1QJWA 1O94A 4XBKA 4HU8A 3RJXA 1EWEA 1OT2A 4DZHA 3WNPA 1AQ0A 4M80A 2REQA 4XO6A 4LRSA 5A1AA 2GQ3A 4IUGA 3MP3A 4L5ZA 1W1A1 1MDLA 4QJ4B 3PUEA 1V3IA 3MKCA 3T81A 3QVQA 1DHPA 1T0OA 3UJEA 1K9FA 5EFFA 2ZUSA 4O54A 1UKTA 2WWDA 3W7PA 2V5LA 4JN7A 1BGAA 1DIKA 3QR3A 1JDAA 4R9OA 2W63A 5HDRA 1DWHM 1HN1A 3W73A 3HMCA 3VAVA 3BZGA 3KAOA 1J11A 2QAFA 5FJOA 3CWHA 4ORIA 2BB0A 3DUGA 1LDCA 3SQSA 4PULA 2ZZ1A 3R58A 4B90A 4R34A 1YNQA 1ONXA 1OADA 2EAWA 3AAMA 2YYTA 3KBMA 2PDQA 1UMYA 4DEFA 4ZBCA 1ML1A 2R24A 2OJPA 1Q65A 4FX7A 1VB9A 2LLEA 4H8UA 1XKJA 1F9CA 3PZOA 2G3IA 5I06A 1XSJA 3LEPA 4GYPA 1CLXA 4JX4A 3ZYZA 2E6DA 3WLOA 3CXOA 4RKAA 5LNRA 3TROA 2FKPA 2WANA 2AAMA 3MSDA 2YB4A 1B3OA 4YIWA 3FLUA 3KRZA 3OU8A 3IGHX 3ANUA 1OIMA 2WVUA 2J77A 2J9ZA 3BSHA 2O4MA 1S2TA 5A2AA 1WDQA 1RQEA 4MPKA 2CZDA 1G1YA 4HZ7A 3WD1A 2OYLA 3K2GA 3BSMA 3WF0A 1XGDA 2ASHA 4F3HA 4D6HA 3NOEA 1H63A 1MRQA 4HK7A 3KCJA 2NW0A 3D0CA 3G1XA 3LLXA 1JPIA 4DYJA 3DHUA 2YYUA 1QHPA 3CTTA 4WY0B 3TW6A 3YPIA 2W27A 4AX6A 3AIWA 3B0YA 3M1ZA 1NDVA 4OHQA 2OLHA 2EG6A 1HO1A 3EA2A 5IHRA 3O8AA 4KFPA 1L8PA 4H6RA 3TTYA 4P2VA 5D2XA 2AAAA 5I03A 3JR2A 4IUOA 1MFVA 5I7GA 4LYPA 2XDFA 1W5OA 2GDUA 1QU4A 1OYAA 2WHLA 5FKYA 1OYCA 3N25A 4PMJA 4DJFA 1ITQA 2F61A 1E56A 1VAHA 2ZA2A 2WV8A 4Q8TA 2PDUA 5CBIA 4GFSA 2ZIDA 3P5ZA 3VD5A 3AROA 4DAIA 3VK5A 3IV8A 1OB0A 4OWGA 1C9DA 3TFXA 3E49A 3VIHA 3NYZA 3TSBA 4MFDA 4EPKA 2ANUA 1F8MA 2WSPA 4D71A 3QSRA 3UZWA 4JTKA 4LVGA 2HDJA 1WYIA 3DYOA 1SFTA 5C5YA 4IXXA 3TC7A 3MUCA 1J6OA 4L1GA 3PPFA 4NI3A 1KTNA 2PBOA 1F3XA 4GZEA 1KFWA 4NX0A 1GOQA 1OVDA 1PKMA 4ZEPA 1SW3A 3UYIA 1DQUA 1TPWA 2QV5A 4MPQA 3CUIA 2Z26A 2X0HA 1S1PA 2A3AA 5A2CA 3MKVA 4JY8A 4FS9A 1VFLA 4XAGA 4INFA 5E70A 3M0YA 2NSOA 1LL4A 2EBNA 3DG7A 1FCUA 3WNMA 1RBOB 2P3EA 2O0TA 1V77A 2DJXA 2E5DA 3M5ZA 2XUCA 4O1BA 4DZ5A 1H7NA 1DHKA 1TKKA 1BPLB 2VVNA 1XXXA 1S3HA 3VC6A 4KGLA 5A5WA 3QW4B 3BJTA 3DERA 2FMNA 3MHFA 3V1HA 3W7QA 1AUSL 2NQ5A 3E38A 4IFKB 4NSBA 1GCYA 4Q8PA 3EKZA 1JUBA 5C9WA 3NR0A 4L7ZA 4W88A 1SQ7A 4P7RA 2GK1A 3NZQA 5LKYA 1KTCA 4AISA 4WOQA 3VNKA 4B5UA 3T2OA 1CXLA 1LQAA 3ARQA 5D8ZA 2PPGA 3RPTA 1IR1A 3GNOA 1UG6A 5A6MA 1QCWA 3PZGA 1RQBA 1DOSA 1V93A 4DJDC 4H6EA 1MEWA 5ABTA 2VWSA 1P7TB 3BOXA 2H90A 2QCFA 1LZOA 1OINA 3W25A 2BLEA 4WXZA 4GBDA 2FDMA 3ZLFA 2IXUA 3TYDA 4H2HA 4BF9A 2VL4A 2EPLX 1K02A 2AQWA 3CAWA 4JTHA 3QQWA 4MZ8A 3GO2A 1O12A 3PFMA 4GUIA 5FJUA 4NJJA 2ZX6A 4NL1A 3QV6A 2PTWA 3A3HA 4ACZB 1KR1A 1SR9A 4PB4A 2ALRA 3PHAA 1BWKA 1ZJHA 5HNNA 4QG6A 1EDGA 1T5AA 3BQ6A 4MIMA 2C1HA 3SJNA 2YGYA 5FJJA 4I9JA 3G8EA 4EVZA 2B7OA 4MKSA 1WDWA 5DBTA 3GBEA 4Q4KA 4C6JA 4B3ZA 5MKGB 4YNGA 3ICJA 3L5LA 2OLAA 4RLIA 2VT0A 2Z1VA 3MJYA 3LI1A 5FEPA 3SRHA 2VD8A 4PMRA 4TVDA 1LUCB 4XZNX 2XWDA 4HNTA 2GVEA 3PWGA 2UBPC 5LZLA 3BGAA 5A8GA 1W91A 1KKOA 3W53A 5GPRA 4H8NA 1QOQA 4FIQA 3SCTA 2VX7A 1FWEC 3TIMA 4PFHA 4E0CA 2BODX 4X0NA 4YYFA 1H5VA 1V8EA 1J79A 4Y8FA 5I3KA 3G1YA 2QCDB 2VEKA 3GVVA 4F0MA 3F4NA 2WVVB 1R9ZA 5H91A 2PA6A 1YBQA 4N42A 3LXBA 3AXKA 4UTTC 1MVYA 2VR5A 4DY1A 2AL2A 2GOUA 1N55A 4GVHA 2EKCA 3R12A 4DO6A 3TYZA 3APYA 2D0HA 4AC1X 5MF5A 4AIEA 2QS8A 3UY7A 3HURA 1OCQA 4LVAA 3MDWA 5LYRA 3UNTA 4HNNA 2GUYA 1V03A 3LGGA 4GI8A 3IANA 3IVSA 2CNCA 3AXIA 3URNA 4HU0A 2OSWA 1NOWA 4UQAA 3P7YA 3NQEA 4AWUA 4PCNA 2BP1A 4HHPA 2B7QA 4I6KA 3G1FA 3BG9A 2J8TA 4I5UA 1C8YA 5M1TA 1B31A 4JIHA 1G5AA 4H9UA 1Q6FA 4QSFA 1VLIA 5HAOA 4PBGA 3ME3A 1TWIA 4BI6A 2OB3A 1K7XA 1VYRA 5LSMA 4U2YA 4FR6A 1TJRA 2ZX7A 2UY4A 1MUMA 3L4VA 2X42A 1XPYA 3FXGA 1I2PA 2E0PA 4A8NA 5BOFA 2EPHA 3ABXA 4HNLA 3CZKA 4XAZA 3M47A 5CJMA 3TQVA 2FJUB 4B5XA 2WNQA 5BRBA 3C2EA 3H7UA 1TX0A 5C8BB 3M46A 1Q6EA 4GYJA 3LPPA 2A4AA 3A6OA 3ONBA 3WLKX 3HFYA 1UWUA 4LAMA 3C4UA 5IDZA 5CPMA 4W93A 2OLSA 3K4AA 4QNEA 3QGKC 4QROA 1SU5A 4OU1A 4C90A 1A5AA 3UG5A 4FHAA 1DWAM 3RYSA 4H4IA 2DUAA 3W2LA 1BF2A 2CLEA 2PU0A 7ENLA 1KWKA 3EGJA 3QY8A 4I5XA 2JALA 4FI4A 3NVDA 4C6DA 3L7RA 4FNQA 4RCXA 3ALGA 1R3RA 3U9IA 4LY4A 5K9XA 2ISWA 1UD5A 1VEPA 1B2YA 4DLFA 1L0PA 2PWFA 3PUGA 5DRIA 1J6PA 1QNRA 3NDOA 3ABRA 1RUSA 3RR4A 1E6NA 3UJSA 1E4NA 3VNJA 3DFOA 4WGXA 2DVUA 6TAAA 1MO0A 3WG6A 3WLRA 2WYSA 4JN8A 2C18A 1Q2RA 1NF7A 3CLWA 3MA8A 2X05A 1JEZA 1UR2A 1VHCA 1OZQA 2VEIA 3S5SA 3MUIA 1XIMA 3LLFA 4C6PA 3W70A 1VS1A 1SO6A 1E9LA 4WF7A 4R3UA 1UWSA 3N17A 4D1JA 4NXSA 2C15A 5U4NA 1XX1A 2V3GA 3N6HA 1UD4A 2XWEA 4NP7A 4ZOAA 3UZXA 2JEPA 4TIMA 4FF7A 4G1KA 4F40A 2WWCA 2OZ3A 1KM3A 3P8JA 4D1IA 4Y6GA 3F2CA 3DHDA 4XZBA 1J9YA 1LQ2A 3GC4A 5C54A 1EP1A 1Z3NA 2JE8A 2WC7A 5KZMA 3CUJA 3ABSA 2TYSA 4UB9A 1PHQA 3EPMA 2VZUA 4YXGA 2AKMA 1EYEA 3M0VA 4A6GA 1OCNA 1TE1A 3W7MA 3T1GA 3LPFA 1WOBA 2DDXA 1WQ5A 1FWAC 3TC6A 1Q85A 1DJYA 1QI3A 1KM0A 1LWHA 3QHOA 1Z6KA 4M6PA 2PDCA 3TXVA 4ZO7A 3S6DA 1S1RA 2ZYFA 1D8WA 4OT7A 5I0DA 2DU2A 2Y0FA 5D2VA 3T2QA 1Q8JA 3SBFA 4FNRA 1R3YA 1LJYA 4KCWA 1W2VA 2GGIA 3ARYA 3UWEA 1UKSA 3INPA 4Z2GA 1R8LA 5LIUX 3NL3A 2I16A 2BZNA 3K4WA 1RVKA 4M82A 2ISSA 5BXTA 3H26A 2XGIA 1C7TA 2OG9A 1VPYA 3CV7A 4K39A 1V3MA 3AWNA 4JHZA 3W9ZA 4K7YA 3KDNA 1KBLA 1AA1B 4BWLC 5FA5A 3NO5A 4PUJA 3PJTA 4UQDA 5H8PA 1A4MA 1TPVA 1OWQA 4DYEA 3ZT6A 3HPXA 2Q8LA 1UH4A 1LBMA 2HK0A 1MXGA 4RNHA 5D9NA 3RAOA 3VNMA 4KIEA 2Y8VA 1DPMA 3LCGA 1FHVA 1W3JA 2PRHA 3TLLA 2PLCA 4Y7EA 1KRCC 4RZBA 3AIBA 3NSNA 3GB6A 3IEBA 5CEWA 1ME7A 4G56A 1A5MC 1U2YA 4IG2B 4HMEA 4YU1A 4B91A 4EAYA 4IIBA 1RV8A 3C8NA 3F5LA 2R1LA 3CO8A 3DHPA 3PNZA 3TJ4A 3WH8A 1OX4B 2ZICA 4N9DA 2VFFA 3BH4A 3OODA 3W1NA 2CKSA 4XAYA 4MJ2A 3U5YA 2XGBA 3W23A 3CHFA 5AYIA 5BOEA 5M2FX 2XVKA 3EX2A 3T2PA 4B3KA 3LLDA 4ZTYA 1ME8A 2I5QA 4N6FA 2YJQA 3ISIX 1NJJA 1MMFA 3QR1A 1E1EA 1KFKA 3TUUA 1CI1A 3F03K 4CNNA 3N15A 1MEIA 1VBHA 5E09A 3SECA 1UP3A 2QJHA 5JIWA 3UXKA 4D6GA 3MYOA 2PF8A 5FL1A 3KVJA 1F3EA 3OZYA 3QXBA 3L2IA 1O5RA 2Y7EA 4PSRA 1GG1A 1PZ3A 4J7RA 1QO5A 1EPVA 2CLOA 7REQA 3IS4A 1I2QA 2CHNA 3UR5A 2E09A 3W02A 4FMVA 4HZ8A 1WX0A 1ME9A 4XAPA 2XSAA 4Q8NA 4AZCA 2FZ8A 5F2IA 1JG9A 3GG8A 4BEQA 3KBVA 3CPUA 4N9BA 4MLJA 4O28A 3PTQA 4CNTA 2Y6ZA 4JBRA 2HXTA 1GK8A 2WMIB 4BQ5A 4ERAA 4RL3A 3UNDA 2NUWA 3M6DA 1JZ5A 1OC7A 1HKMA 3HM7A 4LCRA 2X7WA 4P7LA 1US3A 2XH7A 2Q09A 3N13A 3C2RA 1X96A 4IL0A 4BQ2A 1CGUA 4L4MA 2Z1KA 5K7JA 1YRRA 1XL9A 3EPOA 2NVCA 2WZHA 2QHAA 4ICCX 5G2WA 3S2LA 3FEQA 1REQB 1HF6A 2D23A 3LENA 4PYSA 5I23A 3L4WA 2J78A 3GC2A 3FA5A 4IP4A 5G4WA 1AMKA 1DIOA 4ZOCA 2P3ZA 1JD9A 5U7SA 5CC6A 1W3TA 4A8LA 2IUZA 3SCSA 5E9XA 5DMLA 4D6DA 1XG4A 4DWSB 4DXKA 1UWAA 1DXEA 4LB4A 2NXHA 3G1DA 3MP4A 1MQQA 4ZFMA 2QR6A 2XM2A 3O6YX 3FYYA 3RM8A 1F3WA 2VCAA 2YBVA 3SCNA 3B8DA 4W9TA 6XIAA 4ADUA 2QJMA 2QPUA 3UPWA 7PTDA 2PODA 3UG3A 3N6QA 2VX4A 1KGWA 5HQMA 2ZUNA 3GTNA 3UVIA 4QDMA 5K3VA 1ZPTA 3CAKA 5B80A 3KBSA 1TV5A 3NM1A 2AQOA 1E40A 3URQA 3O06A 5CBJA 3ZWSA 2GQ8A 5D03A 3N4FA 1EP2A 1XLJA 4CNSA 2V69A 2V82A 1XISA 3CQKA 1EYWA 3N9SA 4QLKA 4HYRA 3GG7A 1WUEA 2A21A 2JK2A 3CHEA 2ISFA 4DXVA 1US0A 3EMCA 5DMMA 3GHTA 4IICA 3EA1A 4DO4A 4QE4A 1Q4WA 3G3DA 4UNIA 2ACUA 4DJEA 2ESCA 3G22A 3FXYA 3IGXA 1LTDA 3OEXA 3PFRA 2WZEA 4HTBA 2PGWA 1JYVA 3B06A 3MSYA 5AYZA 1LWJA 1QBAA 1VBGA 3H4GA 3OZOA 4S3JA 3QQ1A 2CC0A 3CMJA 3RMJA 2DZXA 3C52A 4WSHA 2CZEA 3ELFA 4LAUA 4H2CA 2WJFA 5C7HA 1QASA 4JQ2A 1JDFA 4DBSA 2NLIA 5I6SA 4QLLA 4C6MA 5IM51 1TPFA 1N7KA 4LB3A 4NRSA 5FJPA 4G7EA 3S1GA 2XIQA 3GU9A 1UQYA 2VZVA 4CD6A 4WVXA 1FFQA 2V67A 3AZSA 3BL3A 2X40A 1BGGA 1J96A 5AHIA 1OK4A 4FP1A 2ZCGA 3OW1A 3D46A 5JVLA 5HWMA 3LB0A 1B3WA 2FGBA 2TRSA 3GE7A 4WRHA 2ZRZA 4IHCA 3RR1A 4JQAA 2HS8A 1E1CB 1EUAA 1OJXA 3VMPA 2DZWA 3NXLA 4GVIA 1ZCOA 1JF5A 1J2WA 3L68A 2Y89A 1UZ4A 1VFFA 4AVOA 4WSJA 1CB2A 1U5VA 3P62A 4I9MA 4RV8A 2WCAA 3BAJA 2POTA 1YYAA 3H2EA 5BRPA 4NZFA 4WY0F 3KUMA 2QJGA 1HG3A 2NQ9A 4GGHA 1MUCA 3ITGA 2QNEA 1YE6A 1AH4A 4GMEA 1TWWA 1PIIA 3PAJA 1VGAA 1S2WA 1BYBA 2WSKA 3A4JA 3DFHA 4OBSA 1OSEA 2CZVA 1QPOA 4O18A 1XHGA 4RK8A 4MZYA 4ZOBA 5KSWA 1XD0A 1G7VA 2BNJA 4XSLA 4HTYA 1QWKA 1FCVA 5HWNA 3FFSA 4X63A 1RHCA 4ICNA 5G4HC 1AQFA 1V02A 7TAAA 1RBLA 1OFRA 3THUA 1TRDA 4DF2A 3OGRA 3L0GA 4AHPA 4UR9A 3MWAA 4TOQA 3W75A 5FEZA 2H6RA 3CU2A 1AG1O 3DI0A 1K6WA 1E0WA 5EMMA 2FYMA 3VVGA 3T08A 5T8GA 4A2SA 1BF6A 1JPKA 2TSYA 3U8GA 1B1YA 1R9XA 2BHYA 3KOYA 1HT6A 4GQGA 1AD1A 3ITYA 4Y96A 4UMAA 1ICPA 4F66A 2YDSA 4PMXA 3BAXA 4ZO8A 1M7OA 3UQNA 4L4OA 4IF2A 4I90A 1E0VA 3H55A 3QN3A 1GUVA 4GVGA 4GIRA 3AJ7A 1QNVA 1JDDA 2FH8A 3B3DA 3FDKA 3E2VA 5H1WA 4ATLA 3UXLA 1JZ7A 3G1HA 1MEHA 2I5IA 1TO3A 2RKXA 4U5KA 2CW6A 1ITCA 3GUWA 1QOPA 4PUUA 3SGZA 3IWPA 1HKIA 1O5QA 3HQPA 5CC7A 3NXFA 1IQ8A 2FHBA 2X2GA 4HGXA 3M0MA 3MSRA 2R1KA 4QJ5B 1IT7A 4M1BA 2EO7A 3R43A 3BWWA 3KZSA 3ZOAA 2E8YA 1FWBC 3PUDA 5GJNA 2D24A 3GKFA 3QYQA 3FSUA 1JCYA 3GDKA 2NV9A 3TYCA 4TXEA 1IT8A 2VC5A 5EBUA 1JAKA 1THFD 5EYWA 3F1QA 3MB9A 3UZ5A 2KAUC 1YADA 2A1YA 2IXVA 5F4SA 4AVFA 4Q8UA 3BTNA 4D72A 1GPFA 1GPWA 3RPMA 4ML4A 4W7VA 3S9ZA 3OVQA 1O95A 4G2DA 3PZVA 5LHFA 1HTIA 4JN6A 4JTFA 1SZEA 5AYXA 1KFLA 2Z00A 2W0UA 4XZWA 3FKRA 4AY7A 4HNUA 1YDOA 3KHDA 4ACYA 2G4JA 2JKPA 3QV9A 2A7NA 4AZ5A 1YDYA 3GG1A 3TV8A 2PDWA 4HA3A 2FZBA 1PDZA 6ENLA 4TTUA 4PTXA 1EJ7L 1PWLA 3S8HA 2PTDA 3LYEA 4RE2A 1F8IA 3STGA 2QCEA 1X38A 1DKWA 1CWYA 1S39A 2O4QA 3PK7A 1GEQA 3MVIA 3SRFA 4UMBA 1L6WA 1TV8A 1NARA 4IJCA 2OOGA 3F5KA 1Q7QA 1VPQA 4B5TA 1AH0A 1W1VA 2NV2A 3OGSA 1OX5A 3EDKA 5ABFB 4ZL1A 1RJRA 4MFEA 3V0SA 2RUSA 2HV5A 2VZTA 1GOOA 1V02E 1V3HA 4UFLA 3VGBA 4C6QA 1CLKA 1UR1A 3S4TA 2VEPA 3ARXA 2VCBA 3PULA 2J7GA 2GOKA 2QDHA 3FJ4A 5E0CA 4R9XA 3MYPA 4H6KA 2QPSA 3N9RA 4XV0A 3C0SA 1Z8AA 4N02A 1PCWA 1SO4A 4KCTA 1UQZA 2VR4A 3SO7A 3W7GA 3PY2A 4GY1A 5KITA 1K8XA 2W91A 4K8EA 4C6IA 1VBJA 1M7PA 5AVHA 4B4FA 1MZHA 3N34A 4Q33A 3CV6A 3KS5A 4Z2JA 2WSYA 4XK2A 5ABGA 2QGYA 2XZ7A 1M1BA 1Q3NA 3LBOA 3VD9A 5I77A 4KWVA 1TTPA 3TOYA 4DUXA 2HISA 4PGLA 2EXOA 3GIYA 3PF3A 1KV8A 2XH4A 1V6UA 3FN9A 3HMJG 1LBLA 5ENLA 1ZAIA 5DT7A 2BVWA 3ZMRA 1HZYA 1FCQA 3CZ8A 1BXBA 4ZVJA 1W3NA 1VYSX 1GOKA 4ZB5A 2R1NA 4OJYA 3LZ3A 5D37A 2XTKA 3UEQA 4PMOA 4C5YA 3REQA 4A29A 1T6MA 4Y9MA 3WJYA 1UD2A 1QPKA 4LCSA 1JZ4A 4H04A 4IMCA 4AWSA 3QLLA 1IEWA 3VGHA 2ZC8A 3BCFA 3TKFA 2GGGA 8CGTA 3M0XA 2Z25A 3O6AA 2PDFA 4CQBA 1TV4A 3LQLA 1KQYA 4D8AA 2E5BA 3G0XA 4BKNA 3DHFA 2X09A 3NGJA 4HKPA 4GGBA 4C1NB 3W7DA 3BLKA 1NAL1 1IWAA 4MJZA 2QGHA 4RNFA 1R0MA 2OT0A 4OBRA 4M1RA 2XIBA 5FF2A 2ZDSA 3GXTA 4S3DA 2B4GA 1WDPA 5BMWA 5ABHA 3H22A 3NQ8A 3AIEA 4GPNA 3B9DA 2PDKA 4DUVA 2CEQA 4CCDA 1UYQA 2PDLA 5DY3A 4IFOA 1RH9A 1Y65A 2J27A 4LY8A 5LXXA 1ZUAX 4DJDA 1SSDA 4XD4A 1EJRC 4AQLA 1DBTA 3I10A 2E9BA 2GSJA 3DC8A 3TFCA 2G3NA 1CXKA 5I3HA 2PTYA 4LC6A 4EWJA 5BW6A 3W81A 1TVPA 1SO3A 3FA3A 1EZ2A 3LPOA 3OB8A 1AJZA 3WMLA 3VFCA 2WC3A 1PEZA 2DIJA 4HA0A 1RD5A 1WXJA 3B0PA 1SJCA 1VYPX 1LWIA 3L21A 2Y5JA 1YPIA 2JF6A 3FJLA 3LG3A 1DP0A 2ZFAA 2GSHA 3T7VA 3B9AA 3WD2A 4CVWA 3M0IA 4EANA 1OQFA 1GG0A 5DN1A 3GDRA 4E6MA 3DG3A 2OWWA 1VJZA 2B81A 3H7RA 1IF2A 1K4HA 2BVYA 2QYGA 4PB3A 4GCAA 1JZ2A 1W3IA 3B8UA 3UR8A 3OJGA 1GEHA 3L4TA 3TWBA 1GJWA 4WEVX 1LROA 3WK0A 1Q8AA 3CL7A 1GHSA 1KBIA 4CCCA 3NIYA 1DJIA 2V5DA 2BVTA 3BZJA 3P74A 1YE4A 1CBGA 2XGZA 2Z1BA 4L4PA 3ZVHA 1VHNA 5K9DA 4L9YA 2AGTA 4G9PA 5KZEA 3LQGA 2X1TA 3KZPA 4LAZA 3W0KA 3SUTA 4GXPA 4NILA 2REQB 4QDWA 3THQA 3M41A 4S3AA 1JZ8A 2YLLA 3O6CA 2WNWA 3EKGA 4J1OA 3M07A 1OZMA 4YPJA 4WKHA 5HWJA 3DFPA 4UTTA 3P14A 4MM1A 4B9ZA 4DBDA 2EHHA 4AEEA 1EA0A 3UA4A 1J0HA 1MXSA 1R2TA 9RUBA 1JAEA 1K9TA 4KRUA 4YHEA 3TONA 4YTRA 2RAGA 4U3CA 4UTFA 3GFXA 6A3HA 1BLIA 1G4SA 3CLMA 2AMXA 3SM0A 3CMGA 3MY9A 3N11A 3POHA 4TX8A 1T8QA 4WOZA 3LA4A 3THDA 5KETA 3VKBA 3JUGA 3W7JA 4GQQA 2XZ9A 1EO5A 3OLEA 8RUCA 3MO7A 1QNOA 4DJFC 1XLHA 9XIMA 2QIIA 3O1NA 3UW6A 1D2KA 1WOAA 2GJXA 4PCPA 1EX1A 3WMBA 5D4YA 2MUCA 4LXFA 4PTDA 5AHEA 5FJTA 2NQLA 4LUJA 4RPPA 2Z2BA 3ZS4A 1JCNA 3B4UA 1HO4A 3S6OA 3QGVA 3EEGA 4H9XA 4OQVA 1PIGA 1W2PA 4LU0A 5FEWA 1AZ2A 1YQ2A 1C92A 3F2BA 3STPA 4O1FA 1Z48A 3GD6A 3BE7A 1CX9A 2PC8A 3ITXA 1UROA 4O0QA 3WEOA 1IEVA 3L0NA 2VC7A 1NP2A 1V0KA 3G77A 1H0IA 1XH0A 3MUZ1 1FWWA 1TMLA 3WMCA 2NQHA 1XDLA 3QW3A 4UWMA 3AHZA 3SCVA 1HKKA 1WBJA 4YN5A 4IJRA 3PG9A 3WH5A 3N18A 3NQVA 1TJ1A 2XFFA 4B9YA 1PHWA 3VIIA 3PJWA 1TA3A 3K5XA 1NDWA 3W76A 4S3KA 5CXPA 3PP7A 1MWOA 5D9PA 5HMSA 4F0LA 1YPXA 4WKAA 2FGZA 1ODUA 1EC9A 2QUMA 4RX0A 4ZODA 1X6NA 1XD1A 5G1TA 3DAQA 4CQ8A 3APTA 1VRDA 4IQDA 1KR0A 1V0LA 3L2MA 1ZGDA 5FESA 3R94A 1XIIA 3HQ1A 3MCNA 4XX6A 5AZ0A 1V0MA 3CAVA 4JIEA 3VNLA 4CNPA 1WV2A 5C71A 3WNLA 4JQ3A 3SGGA 3T4CA 3A9IA 2E68A 4M29A 2VDIA 3EDFA 4H6QA 1YMYA 4JYEA 3NL5A 3AYRA 1XH2A 3VMOA 1GNXA 4YWSA 3U48A 3VCCA 4H00A 3F2DA 4M8UA 1QPRA 5B7YA 1G4TA 3SCWA 3ARWA 2YBUA 3W26A 1XRVA 4KKXA 5I3JA 4B15A 4B5WA 5AC5A 3OYZA 1XDMA 1NFPA 1ZHAA 4EAMA 5E6ZA 4XZHA 3ZT5A 3WQDA 2J8GA 1UPMB 1NDZA 3FA4A 3RK8A 3AHVA 1PYMA 3MC5A 4XZ9A 4O4VA 4RDZA 1OX6A 5CPQA 2BWGA 2NSXA 2VFIA 3OA5A 2YOCA 1RPXA 1TZ9A 2WO5A 1XI3A 1RY0A 4HSHA 3W1LA 4WQ6A 1JXKA 4JTCA 3PZQA 2G37A 5E1QA 3KBNA 1J12A 3WX7A 1M03A 3C8FA 3O15A 1W8GA 1JCXA 2OT1A 3UF9A 5DXXA 3IIVA 3DC0A 2YCLA 1QW9A 5G5IA 1G94A 2WLYA 2H8XA 3M64A 3RX4A 1Y5XA 3DFNA 3LDVA 3VIOA 3IARA 2ZOXA 3EB3A 1XICA 2BFGA 2VDHA 4QXIA 5AHFA 3A5FA 4Q3MA 3WQ5A 4DWSC 2UZ9A 4G8TA 2Y1HA 3JW7A 4Q8WA 3UZJA 1TB3A 2A3LA 4MUZA 4QIUA 1PV8A 5DLCA 3O0KA 1FFRA 1A47A 2JFEX 2C6QA 1J0YA 3TSDA 3EWBX 1GVQA 3W87A 3E0WA 3SUVA 1SUXA 3GTHA 1CCWB 4S2BA 3WIJA 3EWCA 4KPLA 4PTVA 3AXMA 4MB1A 2WMKA 1VIZA 4NJGA 3RHGA 3CWNA 3W00A 3BW3A 2QJIA 5FJRA 1XGEA 1Q2SA 4AZHA 2OR2A 1VEOA 1X7IA 3LXAA 3S9IA 3DGBA 5AVNA 1IT0A 3SB0A 4UR7A 4AW7A 1RD6A 2VFGA 4BWLA 3H23A 1L9WA 2DSUA 1ICQA 2OSYA 1UR0A 3A21A 3VUSA 5PTDA 1KM2A 2R94A 2C13A 4FOUA 3HFTA 2O7QA 4N9EA 3F5JA 2EPNA 1DE5A 1PTDA 5DF0A 3KRUA 2Z7KA 4PMQA 3EWWA 1EJXC 5LNWA 4C91A 5DCBA 3EDJA 1IV8A 4J3SA 4AF0A 1GVIA 4Z2LA 1VC4A 1F7BA 1VFTA 1JI2A 2NVDA 1O66A 2JBMA 3R89A 2YA2A 1IWPA 4XD3A 1IYXA 4S23A 5E0KA 4AWTA 5LA0A 4C5ZA 3G1AA 5E93A 5D05A 5LIWX 3AS3A 4HN8A 2GFTA 4KS0A 2QF8A 1QO2A 3FW6A 3W2KA 3VYLA 3WLNA 3CAQA 4XD5A 4CNOA 4MNKA 1S5MA 3PSVA 1BYDA 3I7QA 3EOSA 3UVAA 2ZRVA 4PUMA 1UR9A 1WNOA 3K8LA 4LPCA 4RW5A 3LMZA 1CIUA 3P5YA 3ZJ6A 5KZ6A 4E5TA 4ICMA 3G0SA 2RHGA 5F2GA 2YFOA 2VQUA 2XISA 1F3TA 1G01A 1ELSA 3RX3A 4OZOA 4CCZA 1XH1A 1EJSC 1XLCA 2DVXA 3DYMA 2KX9A 4FNPA 1B4EA 3II1A 1CPUA 2NWSA 3VMNA 3EZ4A 2A3CA 5H8UA 3SW6A 4QS5A 3S1XA 4QLJA 2DW6A 1WPCA 2VO5A 3W71A 1UWIA 1ZCCA 4C6BA 2OQLA 1ITUA 3SSZA 4NZJA 3BSGA 1UPPA 1MRAA 1HL9A 1W37A 3GNNA 4QG9A 1QAPA 4GG9A 3WNOA 4A05A 2ZQ0A 3SSJA 3BICA 2VOMA 1F6KA 3WLLA 1Q6CA 1ZFJA 4NJHA 3HOJA 5BWFA 4GNKB 3STFA