4N6EA

Crystal structure of amycolatopsis orientalis bexx/cyso complex
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
244
structure length
244
Chain Sequence
DEPWLKIGAREFRSRILVGIEQYDSVPLVRDVLNAAGADVFITTVDPDNRRSSLLLMDLADELPLDDFTWIGTTSFARTKESALRSARILRDSLGIEILKLDVRGDDNTPDNAGTVEAARELRAEGMELLPFILPDLATARALEEAGCAALRVMASPVASGRGIANPAAIRELIEQIGIPVVVEGGIGSARHVAEAMELGASATLVNTALVRAESPLLMAAAMRQAALAGLLSYESGPMPEVAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative thiosugar synthase
publication title Co-opting sulphur-carrier proteins from primary metabolic pathways for 2-thiosugar biosynthesis.
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Lyase/biosynthetic protein
total genus 80
structure length 244
sequence length 244
ec nomenclature
pdb deposition date 2013-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05690 ThiG Thiazole biosynthesis protein ThiG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4n6eA00
1ADOA 1QAPA 1O5XA 3CTLA 2VEKA 1KM2A 2QCNA 4JD4A 5EYWA 1IXQA 1Q3NA 3SZ8A 2A0NA 1SZGA 3FJLA 2GQ9A 5LZLA 3NQDA 1ALDA 5AHMA 2A5HA 1FDYA 3C6CA 3GZ3A 4UUIA 4WOZA 1ZY9A 4ICNA 4JTKA 3NM3A 3B0UX 2DZXA 2VEIA 3TAKA 1K7EA 4HIBA 3B06A 4RZ4A 4GNJA 4LV4A 5U7SA 1Q6LA 4K36A 1J4EA 1WX0A 3LCLA 4E2DA 1SFJA 1EP3A 3PS7A 4JX6A 5AYYA 2NUYA 4NNBA 3DAQA 2ABBA 1G4TA 1OVDA 1XUUA 1DHPA 1W31A 1HG3A 5K9XA 1X6UA 1LLZA 3INPA 4FIRA 4JTHA 3LGEA 3QQ1A 1NF7A 2VELA 3JS3A 3I7SA 3TMQA 3L66A 4J9JA 1GEQA 4MZ1A 3HB9A 3EX2A 4WD0A 4HKPA 2DZPA 1ZNNA 5TIMA 2ZZ1A 1LTDA 3WJXA 1RV8A 4EF8A 4FIQA 4O57A 1LM1A 3P5ZA 5K3VA 4YLWA 3I65A 3TH6A 4AAJA 1B4EA 5F4XA 4O15A 5K4XA 5DBTA 1TTJA 1ZAHA 2ISSA 1TRDA 3DFQA 3UWVA 1VH7A 4KFPA 4JTUA 1UJPA 1U5JA 2FLIA 1WDWA 3MYPA 1DL3A 4Z0SA 5EPDA 2FB3A 1Q45A 4AEOA 1TPEA 1AG1O 1LBLA 1H7WA 4KFOA 2H8ZA 5BMXA 1FCQA 3QSRA 3NQ8A 3F4NA 5I3FA 3W83A 3C2EA 2DZVA 1JULA 1K8ZA 3V1PA 4N02A 3MYOA 4RX0A 2DJLA 3HPZA 2QF7A 4AWSA 3DKJA 4UIOA 1VCVA 3TC6A 3P60A 5BNKA 5AYXA 3O1NA 4ADUA 2YSWA 2EAWA 3ZS4A 1RR2A 5FF7A 5G2HA 3S1XA 1FWSA 3LRMA 2Y70A 4Z1DA 4YL2A 3UXDA 1QPQA 4ML9A 1KFLA 5F2MA 3W7IA 3EXRA 4O19A 1NEYA 2C13A 3DHDA 3G8EA 2NV2A 2QCMA 1B3OA 2ATMA 4A22A 1OFDA 3ZR4A 3NQ2A 4IXHA 1Q6OA 4CNOA 3L0KA 1KBJA 4WQ6A 3C4UA 1YTKA 2Q3OA 1WOBA 1A50A 3LLDA 4A3UA 4N6FA 3F03K 3ATZA 4X3ZA 3T44A 1OYCA 3E12A 3LB0A 1PCWA 1SSDA 4O50A 1P0NA 3ABQA 1LRQA 2FQIA 4KWWA 1OJXA 2R8WA 3G22A 1F6KA 3O6DA 4C1KA 3ATYA 2GQAA 3PULA 2YPIA 1UB3A 1VLIA 2NXIA 2FPTA 4DXVA 2ZFAA 5DN1A 1FCVA 2OT0A 1KTBA 2TSYA 4WY0A 4FEZA 2E6DA 2ZZ4A 2A7RA 3TSMA 5D02A 3GNDA 1GTHA 4O1AA 1ME7A 1PL9A 3TW6A 4ZL1A 2O7QA 4JICA 3MBFA 4JNMA 3FJ6A 1ICQA 4TO8A 3CIXA 3N73A 2J24A 2DJXA 1GVOA 4IGHA 3W86A 1H61A 4LVGA 1VLWA 1H7RA 1TV5A 1KLYA 1SW3A 1SO4A 2CLEA 5EBUA 4Y96A 2C19A 1X8FA 4AH7A 3DKLA 4RJEA 2IQTA 4LVDA 3HPXA 4UC5A 2DU2A 3L2IA 4IPJA 2P10A 1CW2A 1LOLA 1T96A 4WZHA 5FESA 3DHFA 2C3ZA 5CSRA 2A7NA 3W2UA 3MBDA 4C1LA 4K8EA 2ISWA 3HG4A 1ZFJA 4EIVA 3O6YX 1G67A 3WJSA 4LRSA 2G95A 3A5VA 3VFLA 5LNRA 3T78A 3NQGA 2OCZA 5E0KA 5LGXA 1IGSA 2PURA 4TIMA 2ZYFA 3BVJA 2FTPA 1HTIA 4IMEA 3HGSA 4I9AA 3QQ0A 2YYTA 5BMWA 1SW7A 4FX6M 3TW7A 4JX4A 4O0ZA 4MLRA 3GYEA 3SGUA 4BWLC 2GVLA 3RNDA 3LXCA 3LDVA 3T4CA 1YXYA 3W1NA 3N9SA 1EB3A 1OFBA 3BARA 3W7CA 1SO3A 5D2VA 4RV8A 1L6WA 4QNWA 3EX3A 3Q2DA 4POCA 1F5ZA 1SQ7A 3D0CA 1OYBA 1YDNA 3TQVA 3FLUA 3PR2A 3NQFA 1ONRA 1VYSX 2ZRZA 4NNCA 1D9EA 1G4EA 4A2SA 5E1QA 4UFIA 3L5LA 3G8RA 1C9DA 4Q33A 4Z08A 1F6PA 4DF1A 4O1BA 4EOUA 3M41A 2G97A 1THFD 2NWSA 3EWZA 3PAJA 4K38A 3O63A 1GVFA 1U83A 1RQHA 4BWLA 3K30A 2ZQ0A 2QAFA 2A7PA 4CNPA 3W7KA 1O60A 4K37A 1QO2A 5I3KA 2YR1A 1QNVA 3NQ7A 1JUBA 2Y7DA 1H7NA 2W0UA 3HF3A 3TQKA 3L68A 3M5VA 2WV8A 4AHOA 1JQVA 1H62A 2A6LA 3W7MA 1SPQA 1NF0A 1IIGA 3CEPA 4WUIA 5K2ZA 1Y0EA 1GWJA 3BLFA 3LLFA 3SFKA 4S2CA 3HG5A 4M7TA 1H7PA 1OABA 3NPWA 1DJNA 3DXIA 1GVRA 4S2BA 1OF6A 1TMHA 1KV5A 2E6AA 1YLVA 3HMJG 2QCEA 4DBEA 5HWNA 1L6YA 1KM4A 1XC4A 3C52A 2CLHA 1PIIA 3G1SA 3TXVA 4LU0A 4CCEA 1TO3A 4M6VA 1TPC1 4WX2A 4WXZA 3VE7A 4WJEA 2DZWA 1GZGA 5EL1A 1K03A 4MFDA 2AGKA 1G4PA 2GPTA 4JTLA 1X1ZA 3SY5A 1AW5A 3KXQA 3NOEA 1NSJA 1SZNA 4RZ5A 5FEPA 3STCA 4LRTA 3SSJA 2NZLA 4K7YA 4IMFA 2BWGA 1YTDA 1K8XA 3QPYA 2F84A 1LZOA 1GT8A 2CLMA 1DJQA 4JY8A 1ZENA 4A2RA 5I3JA 3E9AA 4NXSA 1C8VA 3G0SA 2C6QA 2JBMA 2QCLA 4CCCA 2RDUA 4Q32A 2G96A 3CB8A 4LWWA 3BGGA 1TPH1 2E77A 2JKPA 1FWRA 3ABOA 3LX9A 2YDAA 3OEXA 3E02A 5G5IA 2YFOA 1UASA 4FNQA 1QR7A 4K7VA 3G1FA 3LHYA 2PC4A 3TKFA 4O0KA 2QCCA 4LUIA 4UFKA 4CLMA 3TCEA 3NR0A 3UNDA 4UTTC 3KVJA 1LRNA 4FXRA 4OV4A 5LHEA 1TPWA 3OA3A 4LVBA 4FNSA 2DZUA 3HOJA 3PSWA 2J9ZA 2BLEA 1OX4A 1GYLA 1N55A 4OQVA 1XUZA 4MY8A 4OV9A 4O4WA 2Z6IA 1AW1A 3FIGA 4GE8A 4UTWC 1RD5A 2QUVA 4JTFA 5I3GA 3P8JA 4JIQA 3LTPA 1RQEA 3I7RA 2ZZ6A 4FF7A 4AF0A 5F4WA 2GQ8A 3Q58A 5IBXC 4RXGA 3UQNA 2FPVA 3STGA 4UTTA 4NNAA 5ABTA 2V0TA 4N9DA 3W7RA 2E6FA 1AK5A 3JR2A 3VKJA 3W7HA 4ADSA 5KSWA 4NZFA 3G0XA 5C6MA 3P67A 4MUZA 5K9DA 3Q37A 5H2ZA 3PY2A 3O16A 2WPBA 1O4UA 3B04A 4QISA 2EF9A 2V2HA 1BEUA 1EX5A 1SZEA 5LNSA 4M6PA 1W3NA 2G5WA 3AO0A 2Y7GA 2V9DA 5FEWA 3P62A 5D04C 1OX4B 4UTWA 3LHWA 4DQWA 2C14A 5KZMA 2BZNA 1A53A 1ZAJA 2CZFA 2V2CA 3NL5A 3S1VA 1O95A 5IBXA 2FDSA 2J27A 4MIMA 5D37A 3G1DA 3QPZA 5FF3A 3EXSA 4GUHA 2C18A 4ALDA 2E5CA 3W71A 1VCFA 2NUXA 3ZFHA 1FXQA 1HFBA 5L9FA 5FI8A 4GJ1A 4PODA 5T26A 2E5DA 1H51A 3EWWA 3IVUA 2NX9A 2WKJA 1EEPA 2ATSA 4MYXA 4EWND 2TYSA 5HINA 3LTSA 5HJLA 1R47A 1W1ZA 2V82A 4TR9A 1K02A 5E93A 1A5SA 3CWNA 5F2LA 3W2NA 3W7DA 1EA0A 1IXPA 4YCPA 4K6AA 1KM3A 3YPIA 1SZFA 4CNNA 2CU0A 3QRHA 2CLLA 2E5BA 1L9WA 3G3MA 4S1FA 1GTEA 2H8XA 1LOSA 4R34A 3LHZA 3HG2A 1JJKA 4XBKA 4DO4A 1VPXA 1JVNA 2JKAA 3WK2A 2QCFA 3HQ1A 1E51A 4MFEA 3UWYA 3MI2A 3M1ZA 2GVJA 5LKYA 3UYCA 4O53A 1YDOA 3MW7A 3GDRA 5BRBA 1TB3A 3STFA 4DBDA 3IGXA 3LTYA 3T7VA 4QIUA 3PB0A 3W1PA 1DQWA 1PV8A 1QPRA 4HT3A 5DLCA 4TMBA 3GAKA 3O15A 4LY8A 2QDHA 5HUOA 5CPNA 5FF4A 4JXCA 4JS3A 5LNVA 4FXSA 3LXAA 4IOTA 3S1WA 4Z1AA 1Z48A 2Z2UA 2HTMA 3W2KA 5CG7A 5F1VA 3P74A 4NJJA 2CFFA 4GUGA 4IX0A 2ZRWA 2CZ5A 4LC8A 2YXGA 4LS2A 4ZQNA 1QPOA 3C2VA 2C16A 3LRLA 1TIMA 1TQJA 3W84A 4BI6A 1LYXA 4QNEA 5D2YA 3E0IA 1CX9A 2ZTKA 4Q4KA 4E2BA 4EVZA 1R30A 2ZZ2A 5DCEA 2QDGA 5DCBA 3W1AA 5D38A 2J9YA 3LV6A 1F2JA 1HUVA 3W75A 3W73A 5DXYA 4K39A 4O1DA 2W6RA 1RQBA 1EWDA 3S0CA 2W79A 1K7XA 3GX9A 3F1QA 1OFAA 1FUYA 1OFPA 2Y89A 4IMGA 3HG3A 3EKLA 5DCDA 3MJYA 1SO6A 3M0ZA 3L0NA 3PSVA 3CLMA 4A29A 3CEUA 4MJMA 2NWRA 3LERA 1TCDA 2VC6A 2HMCA 1OHLA 1S5VA 3GDKA 3N9RA 4RXFA 5D2XA 2TPSA 3W7LA 2QJIA 4UTLA 4NT0A 4UMAA 4LS1A 2VFGA 3S6DA 1KBIA 4AWUA 3DFNA 1N7KA 3NQEA 1TQXA 4O28A 4CCDA 5C54A 1XDLA 3BLIA 1LBFA 1DBTA 1XXXA 1GG1A 3EWBX 3LI0A 2QCGA 4JR5A 4IJBA 1T99A 3CWOX 4PFMA 3NA8A 3G1XA 2X1UA 5CZTA 1JUEA 2C0AA 2CLFA 4KWVA 1ME8A 4M7SA 3DFPA 3W3OA 3W1LA 4BK9A 3VI2A 1FWNA 1T0OA 4DF0A 6ALDA 1TYGA 5MHBA 3GK0A 3RK8A 2V5BA 3MWAA 1QO5A 3LBMA 2NUWA 2GJNA 1LP6A 1UUOA 3M5XA 3QEZA 1OFQA 3MP5A 3OVQA 3A5FA 3W88A 1J5TA 4JDYA 3QMRA 3NL6A 3QFEA 1KFEA 3DFOA 4CQ8A 2OX1A 1FWWA 1A5CA 2EKCA 4N9EA 2DZSA 4G1KA 3NPUA 3HO8A 3PBUA 5AHNA 4NXKA 3S5YA 4CQ9A 4UFMA 3OIXA 3UZ5A 1TTPA 3PUEA 3N14A 4QSHA 3GDLA 3PBVA 3NDOA 5GVJA 3NQCA 1SO5A 4DPPA 1EUAA 2H3BA 5LSMA 1OFRA 2B7QA 4O11A 3FYPA 4B5NA 1P1XA 3S8HA 4H6KA 4NZJA 3STEA 3QF0A 4FNPA 3P82A 3L5MA 4NVTA 4E38A 3EEGA 5CGQA 1NAL1 3TROA 5TQLA 5DELA 4NJGA 1TPUA 4MYAA 1SSGA 1YXDA 3W7OA 2J88A 3LCWA 2WNNA 3L21A 2VFIA 3UPWA 1H50A 3NL2A 3BV4A 1KLZA 5SWUA 2QUTA 1WBHA 1W3TA 4IX2A 2LLEA 3GNNA 4Y9AA 1I2OA 4MZYA 4P61A 1EP2A 3BGJA 3B4UA 2RFGA 2V81A 3G1HA 4DPQA 2NLIA 3EWYA 2GOUA 4FB7A 3IV3A 3M7WA 1Q6RA 2C15A 3DGRA 4RR4A 1KM5A 1KM0A 1H63A 1GQNA 5HQEA 3HGRA 4DELA 4E0CA 4UR7A 5K9CA 4JTSA 3VNDA 2Y63A 3FYOA 4NX0A 2ZA3A 4ZMGA 3MMTA 6TIMA 4KFNA 3B0VC 2VFFA 2WNQA 5D2WA 1KFJA 5KTLA 3CC1A 2Q3RA 1RPXA 1FCUA 2QAPA 5AHIA 3W7JA 4MOZA 3C56A 1F74A 1VRDA 1WA3A 3C61A 1KM6A 3NM1A 2X1TA 4IQLA 2YYUA 5D32A 3C3NA 5BW6A 3NQ6A 5HR6A 3T40A 1LRTA 2A85A 5D05A 2YFNA 1I2RA 2BTMA 5K4ZA 4KKXA 3DFTA 1IF2A 4ZVJA 2YX0A 1JR1A 1F76A 4JTIA 4O54A 2RHGA 4UTMA 1UUMA 1FWTA 1MZHA 5FF0A 1BTMA 1W37A 2YCEA 4MLJA 2XN0A 1HO1A 3PWAA 3M43A 3R12A 1L6SA 1C29A 3NQAA 2A4AA 4HNVA 1HL2A 3LCGA 1EIXA 4ADTA 2P0OA 5HNRA 3NO5A 5G4WA 4ZQPA 4PTNA 1JCMP 1DV7A 3SI9A 1PHQA 4XQ6A 3HJZA 3LCHA 3HGJA 2GVGA 3RLUA 2A6NA 2JK2A 5I3IA 3KVMA 4N4PA 1D3HA 3TAOA 4HPJA 5G1YA 3WJZA 3G1AA 3NZRA 4BF9A 5G2IA 3EX6A 4DEFA 1R2TA 4TU1A 1JCLA 4LNYA 2FJKA 5A5WA 3PC0A 1QFEA 3UY8A 4LT9A 3KVLA 3EX1A 1NFBA 5CKSA 3SJ3A 2CWNA 3DZ1A 2WNZA 4OGZA 3RLVA 5DBUA 3DU0A 3OHIA 5H91A 4LC6A 3THQA 3WK3A 1W54A 2R94A 1PCKA 3S5OA 3W1RA 4NUWA 1ME9A 4UTIA 1SR9A 3B03A 1VS1A 1GVSA 2CW6A 5HR7A 1CI1A 3M16A 5KMYA 1GYNA 1KFCA 2HSAA 2ABAA 2Y6ZA 3GKAA 2ZRXA 3S5NA 2QKFA 1MEWA 2ZTJA 3BG5A 1F7BA 1OK6A 3LV5A 4I7UA 4YWIA 1KV8A 1M6JA 4OU1A 5C2XA 3DI0A 4XKYA 3RU6A 1F73A 1G4SA 2X1SA 4O18A 3TV8A 3TK7A 4PCFA 2Y88A 3EXTA 1O94A 1VQTA 3CHVA 1ZALA 2VEMA 3S42A 1SFLA 4FX8A 2AQWA 4MZ8A 5EY5A 3U2OA 2GJLA 3MHFA 3BK0A 3LCIA 3TFXA 5KZDA 5DY2A 4NJIA 1Q6QA 1BKSA 3QMSA 1W0MA 3FKKA 3W70A 2ZRUA 3IGSA 4R7JA 4CQAA 1BWKA 1PVNA 3CU2A 3IIPA 8TIMA 2QCDB 3P8IA 3KRZA 1XFBA 3UZJA 3S9YA 4LOCA 3AJXA 3N3MA 3TJLA 5J5DA 1FDZA 1TPFA 1KFKA 1DQXA 3NQVA 1JRCA 4XKYB 2H6RA 3BPWA 1GJPA 2B0MA 4L4LA 3PG8A 1WV2A 3F4WA 1LDCA 2ZCGA 3WFAA 4ZQCA 4JX5A 1TSIA 1W5OA 3ELFA 1DOSA 3E49A 3PBWA 2QEZA 1MEHA 1O5KA 2TRSA 3GIYA 4JIPA 1KM1A 3QJAA 2QJHA 3QYQA 5F1UA 3IIVA 1X1OA 4O8RA 1OK4A 1VCGA 2E68A 2QCHA 2PRHA 2ZRVA 2OT1A 1A5AA 4UNKA 2ZBTA 3RFAA 2BXVA 4BI7A 3W2JA 3CM4A 3TSBA 5BOOA 3W1QA 3CIWA 4FX7A 5U4NA 5G4EA 3C0JA 1JCJA 3L9CA 4N2YA 1IIHA 1WOAA 2VFHA 5CSSA 4ONVA 3LRKA 1GG0A 2CZEA 3W74A 1OFEA 5C55A 4QM1A 3W7GA 2ZZ5A 2V8ZA 3MHGA 3P61A 3L5AA 1VHNA 2CLOA 3NYZA 3TNOA 4UNLA 5CPLA 4JDBA 4NQ1A 3MUXA 1B57A 4NU7A 1HO4A 1G6CA 4OBTA 3I6RA 5CZJA 3M47A 3G1YA 3A22A 2VEPA 4Z1BA 2Z1BA 3L65A 4X2RA 3LBCA 1VYPX 3BG3A 2Z6JA 2OMAA 4RKAA 3W85A 1M5WA 2VOMA 5A8GA 2WSQA 5HWMA 4M6QA 2FPYA 3C8FA 3U6WA 2JGYA 3ABRA 1H1YA 4O12A 3BO9A 1S3HA 3W7NA 3R5EA 3W1UA 3WK0A 4IUOA 3IRDA 3FEMA 1TV8A 4MY1A 3TSDA 2YW4A 3UD6A 4O10A 1W3IA 1ICSA 3MP3A 3P81A 4Z0JA 4IWWA 1KW1A 1VGAA 4M19A 2RDWA 3OVRA 3KX6A 3UPBA 3W23A 2Z0IA 1EUNA 3G3DA 4UCGA 2VFDA 3O07A 3GXPA 3O05A 3SR7A 4PH6A 3O6CA 2VFEA 1R46A 5AC8A 4R53A 3M5YA 3TC7A 3USBA 3DH7A 2Q8ZA 4UFJA 2V30A 2F7FA 3S5ZA 3MHUA 3W7PA 2EPHA 1MO0A 1ZHAA 1G7VA 1YYAA 2WO5A 2DP3A 3NVTA 5D2TA 5F2IA 1WXJA 1P0KA 5AFDA 3T55A 2B7NA 3TX9A 3MI6A 3KVKA 5F2GA 4UTJA 3MO7A 3W7EA 4BR1A 4MKNA 4O16A 1M7OA 2NXHA 3OG3A 4HNUA 5D33A 2NV1A 3O06A 3KAOA 3GKFA 1OX6A 5EA9A 2ZRYA 2X30A 4FNTA 3THAA 4ORIA 1LOQA 3P7YA 3V75A 2FFCA 3WJYA 3NQMA 2XFWA 3LHTA 3GR7A 3HPSA 4JTGA 4AHQA 1GOXA 4XBSA 1TPVA 4JTEA 1S5TA 3W7QA 5LGZA 4QITA 4JYEA 4QJ1A 3H55A 4HPXA 3A9IA 4PL1A 3W76A 4WXYA 4FO4A 5AN7A 2PRMA 4Y90A 2A2IA 1RZMA 1R2RA 4JN6A 5HWJA 3TDFA 3PM6A 4WOQA 3HIJA 1TTIA 3N2XA 3TA6A 1H5YA 3W22A 2E1DA 2KZHA 1XBVA 5K7JA 1I8JA 3W87A 4GBUA 1H7XA 2ISVA 1OYAA 3NEVA 3H53A 1K3UA 2Y7FA 1FQ0A 2QR6A 3PB2A 1EP1A 4YCOA 4TMCA 1JQXA 1OX5A 2H3DA 3CT7A 3N19B 3ZWSA 2PRLA 1FCBA 3B05A 2WSRA 3PUDA 3R2GA 3TR2A 3UY7A 3UWUA 4O13A 4AXKA 4QAIA 1I2NA 3W1XA 4LW7A 2VXNA 3IGUA 3O8AA 2UV8G 1XBZA 4UFLA 4GRSA 5AC6A 1MXSA 1J2WA 4PEKA 3G0UA 7TIMA 3QW4B 4IXXA 2BSLA 1I2QA 1XM3A 3TQ0A 3ANYA 1TTQA 4BI5A 3QZEA 1YDVA 4O4VA 3LCXA 4LTSA 1VYRA 4UMCA 3CQ0A 3E96A 4L4MA 4UTKA 4K8HA 4RK8A 3W07A 1OFOA 4GWEA 3TXZA 1N8FA 1QDSA 1DKWA 2V5LA 3BLEA 3NG3A 1TV7A 3IEBA 3QMTA 4H3DA 4AB4A 1QMLA 3NNTA 3ABSA 1G7UA 3P84A 3M5ZA 3R13A 3TU9A 4DO5A 1X7FA 1WYIA 4I7VA 3KRSA 2XN1A 3FOKA 5HMSA 1WQ5A 4RLIA 3LHUA 1G69A 1H60A 1XL9A 4GUFA 4HSOA 3FKRA 5G2WA 1I45A 3UWZA 4LVAA 4Y8FA 3EWXA 3U8GA 3VE9A 1LCOA 3GAYA 3TMLA 3UWQA 5IM51 2JGQA 1QCWA 4FHAA 1NVMA 2GUUA 2J6XA 2RKXA 3UWWA 1V7YA 1QOQA 3TJXA 3IVTA 1VJIA 5LNUA 1LORA 3LCFA 4OWGA 4Y6GA 1GVQA 1ZAIA 1W5QA 1KFBA 3IIOA 2I9EA 1V5XA 2VENA 3C2OA 3QC3A 4AWTA 4ZQRA 2EGZA 4GC4A 1JCYA 1Z42A 1VHCA 1TPDA 3TIMA 1P5BA 4P2VA 4AVFA 1FY6A 1UBSA 3NL3A 1H1ZA 3EKZA 2C1HA 5AHFA 2ZDRA 3EWUA 1FXPA 3W2MA 2J9XA 5C5YA 3I7QA 3B0PA 4TX9A 4JGDA 4WY0B 3NGJA 4UTHA 2ZZ3A 1OG0A 5D30A 1QPNA 3N2MA 4LV9A 3QSTA 2VKZG 3FFSA 1TRIA 2CZDA 5EMUA 2R91A 3KRUA 4R33A 2Y62A 2HS8A 2AAMA 5HULA 2YGYA 4MVAA 3BG9A 1K8YA 3W2LA 2OZ0A 3L0GA 4RZ6A 1W5MA 2PE4A 2ALDA 3C2FA 1KTCA 1EPXA 1ICPA 1SU5A 3SIZA 5KINA 1AW2A 2X1RA 3BW4A 3A23A 3DFSA 1XI3A 1PHWA 2E09A 2HS6A 3G18A 4ZZ9A 2Y61A 4UR8A 1SW0A 3VCRA 3R89A 1LBMA 1YPFA 4MJZA 3H54A 5CPOA 1XKYA 4IPIA 4X9SA 3GXTA 3CPRA 2B7PA 3W72A 4XTIA 4AMAA 5EKYA 2V2DA 1A5BA 1K7FA 3QM3A 4N4QA 3LM7A 5AHLA 5LHFA 4O14A 1LLWA 4U28A 5HUPA 4ZQMA 3NXFA 3M6YA 2FB2A 3PVFA 4FNUA 1QWGA 4M5PA 3LXBA 3N34A 4NJHA 3LOTA 5AHEA 5L6UA 3ZWTA 2I14A 3P80A 1QOPA 2DZTA 1R2SA 1JUKA 4PL2A 4ORMA 3Q94A 1SUXA 3G24A 3GB6A 2A21A 3MI3A 3PF3A 1XCFA 3GLCA 5D03A 5D09A 2NX3A 5CZ0A 2X2GA 4JTJA 3UXAA 1GPWA 4U4MA 4N6EA 4FNRA 1PS9A 4X22A 2RDTA 4I7WA 4JYFA 5FEXA 1UCWA 3QW3A 5AC7A 5CPMA 4HHPA 4O52A 1TJRA 2ZZ7A 3JRKA 5CZSA 4DO6A 3NZ1A 5DY3A 3GDTA 2XN2A 2ZA2A 3BW2A 2QUUA 2JKEA 1AMKA 1AL7A 5F4SA 4HNNA 3NPVA 1T8XA 5LNWA 3MP4A 1WAUA 4OHQA 3DBPA 4IMDA 1YXCA 2QCDA 1ZJIA 4O17A 1RVGA 3A24A 1H7OA 3DI1A 4HSNA 3W6YA 5FF2A 1TREA 2CLIA 3RMJA 2P1FA 2NX1A 1OF8A 2QJGA 3HGOA 2WOQA 1W5PA 1XBYA 1W5NA 1TJPA 3IIXA 1Z44A 2A1YA 3LI1A 2WQPA 3EX4A 4A21A 5J5RA 1FBAA 4JYDA 1IXOA 4GUJA 2B7OA 4GUIA 1B9BA 1JRBA 4XZ9A 4PC8A 1MEIA 5AYZA 3BW3A 4N9CA 2PCQA 1JCNA 1YPIA 1D3GA 1VC4A 3SECA 3OBKA 1KTNA 3W1TA 2D73A 1MSSA 4QQ3A 1KA9F 3PG9A 4GXMA 4AHPA 1ML1A 2CLKA 4XUGA 3GXNA 3M9YA 4HNTA 3A21A 3KFTA 4HN4A 2DORA 3L67A 4Z1CA 4OE7A 1VR6A 5KITA 1ZCOA 1IXNA 2R14A 1DORA 3IIZA 4UFHA 4W9TA 2ZA1A 2B4GA 4ZQOA 4XWUA 1I4NA 3IVSA 4UXDA 3P5YA 1DVJA 4N9BA 2X16A 3TE9A 1S5WA 2FIQA 2E6YA 1WBJA 5KZEA 1PE1A 1B4KA 3I68A 1BWLA 2WSYA 4XTDA 1YTEA 5I3HA 3GVGA 3SW6A 5AOUA 2YW3A 4NX5A 3GR8A 3PUOA 1Z41A 5TBOA 4JTTA 3R8RA 4PA8A 1W8SA 3OVPA 2I1OA 4UMBA 4BFAA 3FA5A 2NXGA 2O7SA 2TMDA 5AB3A 4NJKA 4MPQA 1L2UA 4LVFA 3WJWA 1F05A 1EWEA 4JEQA 1XBXA 1VZWA 3W9ZA 3EB2A 1JCXA 2YZRA 3M44A 4LUJA 4OT7A 2EHHA 1XDMA 5G1TA 1FDJA 5FEZA 2Y7EA 3FS2A 4YXGA 1W56A 4UTUA 4DF2A 1AL8A 1I2PA 2H90A 3TUUA 3QH2A 4D2JA 3DENA 3LHVA 1YADA 4YMZA 1TPB1 4WY0F 4JY9A 3NPXA 3WK1A 1FX6A 1LROA 4GFSA 4AF0B 3PBYA 3S1UA 2Q8LA 3KOFA 4IMCA 3NAVA 4O1CA 4RCXA 3G1VA 2WJZA 2BX7A 3GDMA 2RH9A 3TFCA 1P4CA 1M7PA 3HBLA 3SGZA 4EF9A 3C2RA 4LS0A 3RF9A 4MY9A 3KHJA 3B8DA 2Y85A 3W1MA 2OJPA 4H4IA 5DXXA
chains in the Genus database with same CATH superfamily
1JIBA 4U3AA 1O5XA 1KKOA 4GVHA 3C0QA 2WHMA 4IICA 5HPCA 2GQ9A 1JZ5A 3NQDA 4XIAA 3ME3A 1H5VA 4UUIA 4WOZA 3URNA 3FA3A 7REQA 4ICNA 2V5KA 2VEIA 2J8FA 3H22A 1NFPA 1UZDA 5D9NA 5LIWX 4GNJA 4LV4A 1GYMA 1O12A 4K36A 7A3HA 4OFCA 1X6LA 3GM8A 3QQWA 1EP3A 3VDBA 5AYYA 4ILSA 5FL0A 4F48A 2DPEA 2VOTA 1DHPA 3MMDA 1X6UA 3INPA 4L7ZA 4QEHA 2RDXA 5C9ZA 3AWNA 3PZOA 1IEQA 4J9JA 2ODOA 1GEQA 5H8PA 1WB0A 3MSGA 2DZPA 4PMXA 3ALFA 3ARQA 4JIRA 4XD4A 3GSMA 2WMJA 3W38A 5HXMA 3FN9A 1CXFA 5DMMA 7REQB 3WLJA 4F2BA 1UMYA 3G5EA 5K4XA 3V7PA 1TRDA 1VFLA 3AXHA 1U5JA 4LAKA 2FLIA 2FB3A 4JTRA 1TPEA 4C6JA 3LN3A 5BMXA 1FCQA 3B8SA 5I3FA 2R1MA 2VJXA 4KEZA 2R1LA 1S46A 1K8ZA 2PZ0A 1ZQ5A 4N02A 1ONWA 4RX0A 4X60A 1GW1A 2PDWA 2V6AA 5JBEA 5BNKA 3ITYA 1Z9AA 2EAWA 5FF7A 1FWSA 3LRMA 1V03A 3UXDA 1FP8A 1KFLA 1EGMA 2Q01A 1NEYA 4QEEA 4X9YA 4W84A 4LH8A 1FRBA 1SM9A 4B5UA 2GJXB 4PSPA 4DUVA 3UETA 4XSLA 2ALRA 3EYPA 1RAKA 2PSNA 3LLDA 4HGXA 3TONA 4X3ZA 1OYCA 3LB0A 1IZJA 1GUVA 3BC9A 3VIHA 2FVLA 4O50A 1GHRA 3GH5A 4KWWA 1OJXA 1E0VA 2GQAA 4MSSA 1WPCA 3GXDA 4MAVA 2BS9A 2HVMA 2ZFAA 5DN1A 1VAHA 2QVNA 4I5RA 1YX1A 1KTBA 2TSYA 5IDZA 4WY0A 4XO6A 1HZYA 1JFXA 2WSPA 1GTHA 3WMBA 1XRFA 5A8OA 1XJBA 3R0KA 7ENLA 4TO8A 5DT5A 5I5RA 1EXBA 1EJWC 4HQVA 4Q7BA 4DJDC 2J8GA 2WANA 2PWDA 2PDBA 4JOMA 1FWAC 1EJ7L 2OQYA 4HHLA 3W86A 1B30A 2AMGA 4Z2LA 1KLYA 1SW3A 2GUYA 3RDKA 2CLEA 4YPJA 2C19A 4GYPC 3DKLA 4NIRA 4QDWA 1RK5A 3HPXA 4QQUA 3QV6A 3L2IA 4UC5A 3QGVA 2W92A 5CPTA 1T96A 4HPHA 4V27A 2WMHA 4GYFA 3WBWA 2ISWA 1XIIA 1ZFJA 5EGRA 3CUFA 3TOYA 3CV2A 4DN1A 2WMKA 1Z3NA 1KD0A 3A5VA 3NQGA 2OCZA 5E0KA 4TIMA 1F9CA 4MLRA 4BWLC 3SCQA 3LDVA 4Z2JA 3W7CA 4JFVA 5D2VA 4RV8A 1G94A 3EX3A 3GZAA 3EOSA 1OYBA 2HBVA 3MKVA 2WHKA 1OZQA 4JTAA 1XH1A 2PA6A 4BEQA 1VYSX 5TNVA 4NNCA 3QFWA 5E1QA 3WQOA 2ACRA 4UNIA 4Q33A 3WD0A 5FKYA 3C2YA 3M41A 3SRFA 2NWSA 2FDMA 2BVDA 1IT7A 3PAJA 4K38A 3O63A 3BANA 1UPMB 1O5RA 3W7KA 4K37A 3ICJA 1QNVA 5CPSA 1JUBA 4GX8A 1PKYA 3L68A 3M5VA 3CAKA 1AH4A 1JQVA 3W7MA 4WJ8A 3UYIA 1NF0A 1H09A 3KS6A 1JYVA 2JF7A 2Y5JA 1KGXA 2CCRA 4LYQA 1GGOA 3WCZA 1UYQA 1QI3A 3ZOAA 5FAJA 4DWSC 4IPPA 4YTQA 2J62A 7TAAA 3HMJG 1Z7AA 4DBEA 1L6YA 3L4UA 1WZMA 1XC4A 5HMFA 1IE7C 3LGGA 1TO3A 4M6VA 1QI2A 2P8CA 2XHYA 4WJEA 4US5A 2V5JA 1CECA 3VM5A 3RILA 1GKQA 4M51A 4JTLA 3N11A 1O6IA 3TNBA 4GIYA 1NSJA 4S39A 1ZLPA 3SSJA 4HOZA 4IMFA 1YTDA 1XSJA 3MU7A 3PAOA 1P6WA 1GT8A 2CLMA 3ARYA 1HN1A 2VQUA 1BXNA 7XIMA 1C8VA 1GQIA 4C6FA 4HZMA 3R43A 4Q4PA 4CCCA 4V15A 4M1BA 3CASA 3CB8A 4IF2A 3LX9A 2FGZA 1OADA 1CEOA 5DMLA 2NT0A 2FGLA 2YFOA 1R86A 3TKFA 3LHYA 3HN3A 4QR6A 4O0KA 1RALA 3CUJA 4UFKA 1NP2A 2OEKA 4CLMA 3TCEA 1FWGC 1RPKA 3AHTA 3DEQA 3KVJA 1LRNA 5FJUA 5LHEA 3OA3A 2JALA 2YB4A 4LVBA 5D9PA 4FNSA 3RM4A 4PUMA 2PFHA 3PSWA 3PK7A 2BLEA 4OQVA 4LGXA 8CGTA 3RPTA 4R7OA 2PDFA 4GE8A 4UTWC 2WLZA 1HJWA 1QI0A 3WDIA 4J3ZA 4JTFA 1FH8A 3N12A 1RQEA 4X0NA 3L12A 1POKA 4HJFA 1I1WA 3G6MA 4UTTA 1LWJA 4N9DA 2CITA 1XISA 2PWHA 4ADSA 5KSWA 1GNXA 3WLTA 3G0XA 2NSXA 3PY2A 3O16A 1O4UA 3B04A 4QISA 3GE7A 2V2HA 5LNSA 1EX5A 1SZEA 5CLWA 4ZTXA 2RGMA 3EOUA 4Q4QA 2GJPA 3P62A 2BVTA 2B31A 3H23A 3KBWA 4DQWA 4DJDD 2C14A 3MSRA 3RLGA 3WQ4A 1BG4A 4CEXC 2BVWA 3MSDA 1R3RA 3NL5A 4QG8A 1WE5A 1RK6A 3A4XA 3NVDA 3M7SA 4MIMA 3NDYA 5D37A 4QJ4B 3EXSA 3U2ZA 1XCXA 4YYFA 2E5CA 1L0PA 1UC5A 5HQMA 3W71A 1VCFA 2NUXA 4PMOA 1XIMA 1BGGA 1MVYA 3CZJA 3LS9A 3Q45A 3KDOA 2DY3A 4LUYA 4LCRA 3N4AA 4CU8A 2XGZA 5HINA 4D72A 2D1ZA 1J0IA 2V82A 3GU9A 2AQOA 3IJDA 3CZLA 5IFPA 3AS3A 1A5SA 4G7FA 4XX6A 1IXPA 4ZFCA 4YCPA 4K6AA 1KM3A 1XLBA 3FAWA 1WKYA 1AH0A 4M56A 4AZCB 2CU0A 3RCYA 1Q65A 2CXEA 3G3MA 3VDGA 4ASTA 3KDNA 4L6DA 2HRWA 2JKAA 3TTYA 3WK2A 4D6HA 3WYZA 3F5KA 3MI2A 3ZLHA 3M1ZA 4P8VA 3L4VA 4FZIA 2R1NA 5REQB 1TB3A 4DBDA 3LM3A 3LTYA 5DFAA 5I09A 3PB0A 3O15A 4J40A 4LX4A 5LNVA 2A3BA 3PJWA 4FXSA 4IOTA 2POZA 2E8ZA 1YPXA 4KT2A 3S1WA 3KCLA 3TLLA 3TYDA 1Z48A 2Z2UA 3L4YA 2YCKX 2A3AA 1FHUA 1XGDA 1QPOA 3A47A 2C16A 3LRLA 3VC6A 4KIEA 1TQJA 3B0YA 3AYRA 4IPNB 4DWSD 5D2YA 3E0IA 1JXJA 1R30A 4OOZA 2QDGA 2J9YA 4C6OA 4ZSUA 3D46A 4PRRA 4UQCA 4C65A 4O1DA 3WH8A 3WQPA 2VCBA 2G50A 1T6MA 1MWOA 1LF1A 1IZCA 1XLHA 4CD4A 3ZJ6A 1QWKA 2J4GA 4LUSA 3C0LA 3POCA 2WMIA 2OTDA 1K4GA 4AFYA 4S3FA 4MJMA 2NWRA 3LERA 3MT1A 1TJ0A 2HMCA 1TVLA 4NT0A 4LS1A 4B5VA 4IQDA 3S6DA 1D7FA 3B9EA 1N7KA 4EP8C 4O28A 5C54A 3UZXA 2VCCA 4AZIA 1PXGA 1ZTVA 2ZOXA 2RGLA 4JR5A 1XIEA 2PDHA 3CWOX 3NA8A 5HQLA 3JZUA 4PMZA 3K46A 2Z7KA 4U2YA 4H8VA 2BDQA 3DFPA 4B4FA 1V3LA 2ZUNA 3GO2A 3BDKA 2QGHA 3A13A 4IP7A 2NQLA 2UY5A 1LUCB 4KF1A 3XISA 3SQLA 2BHUA 3MWAA 4JCLA 3WH7A 3CUGA 1UUOA 2WHJA 4Q8OA 1QNPA 3MP5A 3E74A 2XUCA 1R9ZA 4NHVA 1U22A 2PMQA 2PAJA 3AXKA 1K6WA 1UD5A 1ISYA 1OZMA 4CQ8A 1EJUC 3CGTA 7PTDA 1O1ZA 1XR2A 1TV3A 4ENLA 1ADSA 4CQ9A 1CGWA 4CNTA 1Y5WA 3PUEA 4L9XA 4AW7A 3K8KA 1SO5A 4DX3A 5LSMA 4FOUA 3LQLA 3S8HA 1HVXA 2FGBA 2CYGA 3MCMA 1PX3A 4CCZA 3L4ZA 3EEGA 2WC7A 5HNTA 4AWEA 4JHZA 1TPUA 4MYAA 2TODA 1SSGA 5FJJA 3PFRA 1K8CA 3L21A 3UPWA 2HVOA 1V02E 4JFWA 4DJDA 3BZJA 1WBHA 1W3TA 2LLEA 1KC7A 1A49A 4Y9AA 4P61A 1EP2A 1L2QA 3G1HA 4DPQA 2NLIA 3EWYA 3R8HA 3LZ3A 4FB7A 3E3HA 1Q6RA 3IARA 3UR8A 3ZSTA 1KM5A 1KM0A 1W9BM 4E0CA 4MUPA 3APTA 5HJXA 4J2MA 4UR7A 4LEFA 5K9CA 2E0PA 1GEHA 4JTSA 3LPGA 2Y63A 4L64A 1RBOB 3ONBA 3PTKA 3TTEA 3EB3A 2QAPA 1FCUA 1QATA 3W27A 4ACYA 3W7JA 4MOZA 3UA4A 3GY1A 1F74A 2I9UA 3SGGA 5D32A 4CNSA 1I1XA 1M1BA 4WSJA 1LRTA 1WKEA 1GQLA 4BF7A 3DN5A 3DFTA 4LCQA 4JL1A 1MZHA 4GQBA 1ITXA 2YCEA 4MLJA 3VGHA 1KCXA 3HQOA 4DUOA 1GOMA 3T81A 1YIXA 4HNVA 5EFDA 3AUJA 2P0OA 4PMJA 1E1FA 1E3ZA 2VRKA 3SQSA 3WD3A 4IGSA 1IHIA 3DYOA 2DZBA 3QV9A 4K2SA 2WVTA 4PMVA 1BD0A 4DXKA 3VIMA 5I3DA 5HANA 2JK2A 3KVMA 3GYCA 4XZHA 1TR1A 1IEXA 3OZMA 1EC9A 3G1AA 1JDCA 4UZSA 4I8YA 4PR4A 2ZC1A 4EAMA 2FJKA 2I57A 4AG0A 5A5WA 3PC0A 4PTDA 4LT9A 5CGTA 1BYBA 1NFBA 1DEDA 3BMVA 3LNPA 2WNZA 4HNOA 4JFSA 3DU0A 4Q7IA 3LK6A 4MKSA 3HQNA 4LC6A 3AC0A 3I3BA 1D3CA 1FWIC 3WKZA 4O1FA 1PCKA 1DYSA 1TKKA 1ME9A 1CI1A 3AHYA 3M16A 2VD9A 1O7AA 2HSAA 2ABAA 2Y6ZA 1PDZA 3S3GA 3S5NA 2QKFA 2ZTJA 3LPPA 4F79A 1F7BA 2GUBA 3LV5A 4I7UA 1M6JA 4R88A 1UMLA 1G4SA 2X1SA 4LYKA 3TV8A 1E0WA 1V6XA 2QIWA 4HU3A 4DAFA 4GINA 4LUTA 1UA3A 1VQTA 3CHVA 1ZALA 2VEMA 3S42A 1SFLA 2AQWA 3U4AA 3FXYA 4A3QA 4ZXLA 1P7TA 3H2EA 3BK0A 1UIOA 4UB9A 5KZDA 4HOXA 1TZ7A 4NJIA 2YL5A 3QMSA 3AYVA 2QXWA 4BEUA 4TV5A 5CJ5A 2PWFA 3A4WA 4R7JA 1PVNA 3V5OA 2GDVA 3FY1A 3UZJA 1OC7A 1C7TA 4LOCA 3N3MA 2E40A 4QE4A 4UOQA 3UFYA 5J5DA 2XISA 1TPFA 1KFKA 2H6RA 1A5MC 1VIZA 2F2HA 2ZX7A 3THDA 1KR0A 3WFAA 1SVDA 1ZJBA 3HTWA 1REQA 3E49A 3PBWA 2QEZA 6CGTA 1MEHA 1O5KA 4FALA 1PDYA 3QJAA 2QJHA 1R3YA 4IFKA 1X1OA 3COTA 1HJXA 3R4IA 4CD8A 6REQB 2OT1A 4MB5A 2OO6A 2ZBTA 3IUHA 2BXVA 4BI7A 5BOOA 1C9WA 1TE1A 2PDLA 4MTVA 5U4NA 3OGRA 3L9CA 5C7HA 3ITOA 3WQFA 1XYMA 4N2YA 4AX6A 1BYCA 1CLVA 1WOAA 4J27A 2G41A 1OFEA 5F7UA 5EFFA 1NDYA 3VMOA 2CLOA 2BMBA 3UR5A 1B57A 1REQB 1HO4A 1WZKA 3NQBA 4JNZA 1G6CA 2GQ3A 1XLCA 3AU6A 1EXPA 4X2RA 1VYPX 1U2YA 4RKAA 3UXLA 1PB0A 3POHA 4F0RA 5A8GA 1TZZA 2MNRA 4M6QA 5CCZA 2FPYA 3C8FA 5BXSA 3U6WA 1DJIA 2JGYA 1FFRA 1S3HA 3WK0A 3UD6A 4O10A 1G0CA 3MJMA 4KRTA 4ROQA 4REQA 4IWWA 1JPMA 2RDWA 2DVTA 3UPBA 2PTWA 2OWCA 4UCGA 4Q8MA 1M01A 1CXLA 2WMGA 3O07A 1A47A 3SR7A 2VFEA 3DC0A 3I10A 1S2CA 1R46A 3IJQA 1US3A 4F9DA 1FA2A 3USBA 1EHAA 2OPJA 2V30A 3OU8A 5IHSA 3CAVA 3ZJ7A 2F7FA 3W7PA 4RZBA 2EPHA 4R9XA 1DHKA 3KEHA 5E09A 1NQKA 1ZHAA 5CBIA 1XYZA 1M3UA 2A79A 5AFDA 3ARUA 3M4HA 1TV2A 2J8TA 2FVMA 3AHVA 4UTJA 2ZXBA 3OZYA 3VM7A 3W7EA 1DJGA 3M0HA 3BWWA 4O16A 4QLKA 2NXHA 3OG3A 2WVVA 1CB7B 3PPFA 4HNUA 4PZVA 2WJFA 3AICA 1OX6A 2ZRYA 4J3SA 1M04A 5CLTA 4ORIA 3TYZA 3TLQA 2XFWA 4Q8PA 1R7OA 4EKJA 3MV01 4XBSA 4JZ5A 1X7IA 4C1NA 1QU4A 2A2IA 3KLLA 1RZMA 1DJWA 1R2RA 5HWJA 1NH6A 3HIJA 3QTPA 1PIGA 1VB9A 3T0CA 1TTIA 2IPWA 3W22A 4AC7C 3UG4A 4MJ2A 4GBUA 2PCEA 4YJ5A 3K1DA 4K1WA 1X39A 3B97A 1WZAA 4LANA 1K3UA 3MUIA 2E9BA 2Y7FA 1R7AA 5AZ0A 2QR6A 4GYKA 3AROA 1EJVC 4D6JA 1JYWA 4Q8VA 3N19B 4PBFA 3B05A 3IJIA 2WSRA 3PUDA 3PZGA 3PZ9A 3W1XA 4LW7A 5MF5A 4U5IA 5CQ1A 4NI3A 5AC6A 1MXSA 3GVRA 3VNZA 2BSLA 2XJ7A 1TTQA 3M46A 3QYSA 1A3HA 1L6GA 2VX5A 5TD4A 1ENUA 3BUVA 4GWEA 4AIBA 3BE7A 1QDSA 1DKWA 4ZODA 2VUNA 3M0IA 3H2MA 4HK7A 3NNTA 4XZWA 1JCTA 1DIOA 3M5ZA 1ZBWA 3TU9A 3M0YA 3HQPA 4I7VA 1E9YB 3KRSA 3H8AA 3FOKA 4FAMA 1G69A 3ALGA 4ZB5A 3KOWA 1E15A 3OBEA 4QS5A 3ZR6A 2BY2A 1A5UA 4B5TA 4QXIA 3DCPA 2JGQA 1NVMA 4NSBA 3S6OA 4C5ZA 3RPMA 1TV4A 1PWMA 1V7YA 4FK9A 3TJXA 3IVTA 4C6QA 2PDPA 5AC4A 3LCFA 3JU2A 4OWGA 4Y6GA 3O9NA 3IIOA 2I9EA 4NILA 5DMNA 1V5XA 2VENA 2E3ZA 3VYLA 1XKJA 4PB3A 4KRUA 4AVNA 4HA3A 1RJRA 1JDEA 1VHCA 2V3FA 1U1HA 1TPDA 1O5QA 4AVFA 1UBSA 1XYBA 3NL3A 4X63A 2C1HA 4S3DA 4X0VA 1MI3A 4M81A 3B0PA 4OECA 3W24A 1HKIA 3MMWA 2ZZ3A 1OG0A 1QPNA 1PYFA 4LV9A 3QSTA 3SCSA 3FFSA 2CZDA 5EMUA 4GD0A 3KRUA 4NP7A 2ZVIA 2HS8A 3NIYA 5HULA 4MVAA 5BWFA 4AD0A 1K8YA 2W66A 4RZ6A 4PMNA 3UXKA 1I0BA 3C2FA 3N6JA 3O3RA 4P7LA 4E2VA 3BW4A 3DFSA 4U31A 2HS6A 3N29A 4ZZ9A 1H11A 1JZ3A 2Y61A 1XGZA 3R89A 1IEWA 3QR0A 3B9AA 3FDKA 5CPOA 3VD5A 3VC5A 4IPIA 3GXTA 4AMAA 2J7BA 1ZU8A 3FHQA 5EKYA 4PEEA 1QW9A 2V2DA 4HYRA 4TX6A 5A8PA 1UW9A 5HUPA 3LSBA 1W32A 3VCCA 3WO8A 3F5JA 3FGCA 4FNUA 1QWGA 3LXBA 3N34A 1UQYA 3P80A 2CNCA 1R2SA 1DWIM 1JUKA 2IXUA 4PL2A 1W2VA 4W8BA 3GVVA 2NX3A 2BGSA 3UJRA 2X2GA 3E38A 1YE6A 1PS9A 3I4KA 4I7WA 1PZ1A 5CPMA 4HHPA 3RXZA 1WZLA 5CZSA 3MO4A 4FOKA 2ACUA 3WD1A 2JFEX 3BW2A 2JKEA 1AMKA 3N18A 3CV7A 4W4QA 4IIFA 4HNNA 3EZ4A 5LNWA 3GTXA 2UY3A 1ZJIA 4H8UA 1RVGA 3A24A 1H7OA 3DI1A 4HSNA 5FF2A 4JQ1A 4JBRA 3WF0A 2QJGA 1DIEA 4DI9A 1UWAA 2WOQA 1W5NA 3LBOA 3LI1A 3ORWA 5J5RA 4W89A 1UP3A 4GUIA 1BSLA 4XZ9A 5AYZA 5B80A 2WZHA 1KWKA 3AS0A 5I24A 2FZ8A 3SECA 4WSKA 4V2XA 1VJSA 3EMZA 4QCEA 2D73A 3B8VA 4RE4A 2CLKA 4XUGA 5A3HA 2ZUSA 4GXPA 4HN4A 2O4QA 2DORA 4OE7A 1XW8A 1UJQA 3V5CA 4UFHA 4XAZA 5LIUX 4W9TA 1W1YA 4ZQOA 4XWUA 1AJ2A 1E5JA 3IVSA 2ICSA 1SZRA 4Z2GA 1EFZA 1XYLA 2X16A 3TE9A 3SAZA 2FIQA 2E6YA 3S2JA 5KZEA 4XTDA 2YDRA 2DH3A 3GVGA 1C3FA 4TOQA 1JPHA 4NX5A 3GR8A 2Z29A 1OD8A 1W8SA 4XUYA 4UMBA 5JUVA 1ONXA 2NXGA 3HURA 1JDAA 4S3JA 4D8AA 1MUWA 1PZ2A 4NJKA 2AL1A 2IKIA 3SCOA 2FZ9A 1CWYA 2YL6A 1MQQA 4H2HA 1R85A 3W9ZA 3UP8A 3EB2A 3SN0A 1P0DA 1XDMA 3VTRA 3DERA 3FS2A 4DUWA 2UY2A 1WXZA 1AQ0A 4D2JA 3LHVA 1EIBA 4PULA 4IG2A 2GWGA 2ANUA 1WDSA 3AHXA 2DIKA 4P8UA 4AF0B 3PBYA 3S1UA 5ECUA 3KOXA 3NAVA 2R6OA 2OO0A 4RCXA 3G1VA 5A69A 2BX7A 3GDMA 2QF8A 1M7PA 1HL8A 3SGZA 4EF9A 1DQUA 3RF9A 3PBGA 1UZHA 2X1IA 2NVCA 3B9DA 3CV1A 5CAKA 2OOFA 1BVNP 4XVEA 2P76A 3OIHA 1KBLA 1PJ9A 1ADOA 1MUMA 2NSOA 3ES8A 2EXOA 5EYWA 3SZ8A 1SZGA 2YZ5A 1L8NA 3C6CA 2PEVA 1TELA 3NSMA 2DZXA 3TAKA 4IG2B 1K7EA 3WBAA 3W6LA 4RZ4A 1G5AA 4QG6A 1Q6LA 4Q7NA 4H8NA 1WX0A 2G4FA 1NDZA 3BLPX 1JL8A 4NNBA 1Y5XA 1G4TA 1OVDA 1W31A 2FYMA 1G9HA 1NF7A 3KZSA 5AYBA 5GNYA 1AODA 1RLDA 5AKQA 3FVMA 3VD7A 4Y2WA 1HKJA 3LSCA 3HB9A 3MDUA 1UA7A 2XFRA 5TIMA 1ZNNA 2ZZ1A 3UCDA 4RNFA 1QTWA 3WJXA 1UZ4A 1UD3A 1RV8A 4EF8A 4O57A 5JH2A 1LM1A 3P5ZA 4WJXA 2A3EA 5K3VA 3TH6A 1E1CA 4AAJA 1DXEA 5F4XA 2HBXA 1TTJA 1ZAHA 1VH7A 4KFPA 1H0IA 1Q45A 3RUBL 4BJHA 5CSUA 5LA1A 1DJZA 2CKSA 2H8ZA 3K1GA 3CZKA 3EEZA 5E5CA 2ZDSA 3WBXA 1P43A 3ZXWA 3PZIA 1JULA 2VM8A 3PNZA 4PCSA 3O6AA 1J2BA 4LYRA 1Q7ZA 4MWAB 2DJLA 3HPZA 3URQA 1VCVA 3CMGA 2WAGA 1WAWA 5AYXA 5GNZA 1E1CB 3ZS4A 3AU2A 5G2HA 2VL4A 5A6LA 1PSCA 3DG7A 5MKGA 5C71A 3W7IA 2AOSA 1I9CB 2NV2A 2QCMA 2ATMA 2FHCA 1R8LA 3ZR4A 1B90A 3PN8A 2V69A 5CJMA 4CNOA 3RAOA 3L0KA 3A9BA 4I5UA 5E9XA 3C4UA 3BAJA 5BXRA 1WOBA 4L56A 4A3UA 3WSUA 5M3WA 1E5NA 4A4AA 5A8QA 3E12A 3CL7A 4PUNA 2HK0A 1PCWA 1P0NA 1LRQA 3T9PA 3G22A 5A94A 4YNGA 4C1KA 3WEZA 3PULA 2QZRA 4N0RA 1RP9A 1CNVA 5ABEA 2FPTA 5FJIA 2Z1KA 4FEZA 4ZGYA 2BHZA 5AZ1A 1BQGA 4DUXA 5HJYA 5BXTA 3MBFA 2ZX6A 3ZYZA 3VOFA 4D6DA 1GHSA 1OINA 1S2VA 3S2MA 3CIXA 1XIGA 1YNYA 6A3HA 2J24A 3SN4A 3TYEA 3DESA 2DJXA 3LNMA 4PFHA 3C5QA 1EYWA 3RR4A 1VLWA 1H7RA 4H7CA 5C0QA 4WVXA 1SO4A 1SJBA 3A6OA 4GQRA 2IXVA 1XD0A 4BCEA 4AUBA 1X8CA 2WJEA 4JQ3A 4LVDA 4YYCA 3W25A 4JFUA 4IPJA 2P10A 1LQ0A 1CW2A 1TIWA 5JBDA 1JAEA 2FKPA 5CSRA 3MBDA 4KMQA 1F3TA 4CQDA 1XLLA 2G3NA 3UPMA 3B8UA 3O6YX 1V79A 2DFAA 1Z32X 2G95A 5LNRA 2W62A 4RNJA 1F61A 2R24A 1IGSA 5LGXA 1EOKA 3BVJA 4H9XA 4GJIA 2FTPA 3QQ0A 2YYTA 4HU4A 3B8WA 4QE5A 3R10A 3GYEA 1ZBKA 3RNDA 3G2GA 1YXYA 3T4CA 4BF5A 3W1NA 3N9SA 3V0UA 1EB3A 3QOMA 3BARA 1SO3A 1IT8A 1L6WA 5DT7A 3F4VA 4O0QA 4G7EA 3IJ9A 3D0CA 1YDNA 3TQVA 3WNMA 2PI6A 3FLUA 3VU2A 1V3MA 3NQFA 4WDXA 4GVFA 1XSKA 3RM9A 1RH9A 1G4EA 3EA1A 1UPPA 2WVSA 1JAKA 3G8RA 1C9DA 1HJUA 3QR3A 2G97A 3OYXA 2XM2A 4DNMA 2YXOA 1E4NA 1TA3A 3OLDA 3P0XA 4CN1A 1TMQA 2ZQ0A 2A7PA 2P3ZA 4CNPA 2W9MA 1O60A 3VGBA 2Y7DA 1IZKA 1KBBA 2C0HA 3HF3A 3PP7A 3QHNA 3VDAA 2WV8A 3WDQA 4AHOA 2AGTA 1J0KA 3CEPA 3S2CA 4KGLA 3SFKA 2OYKA 4AMCA 3KOYA 4UTFA 1DJNA 4F0KA 1OF6A 1KV5A 1YLVA 1C91A 3GHUA 5HWNA 4KWOA 3GXMA 4Y8EA 2O55A 2Z25A 1GVEA 4KW2A 2CLHA 1W3JA 4H1ZA 3TXVA 1QHPA 1ODZA 2FJUB 4TXEA 2Z26A 4EPEC 4WXZA 2PWGA 5DMYA 3S9ZA 3GW3A 2D20A 1MDLA 3VNLA 2NQHA 4Q4OA 3THCA 2H9AA 4XBJA 3SY5A 3SCTA 2AL2A 2XGIA 1SZNA 2Z27A 3NOEA 4RZ5A 4LRTA 4NAEB 2WPGA 1K8XA 1JG9A 1LZOA 3ARZA 1DJQA 2FZBA 1ZENA 5BYWA 4A2RA 5EMMA 5IRPA 3AIBA 2C6QA 2P5NA 3CNYA 4LB3A 4PCNA 2RDUA 4F2TA 4Q32A 3F5LA 2G96A 4D9PA 1HT6A 1Q6FA 3NSNA 2BNJA 3K5XA 1FWRA 3IAQA 5G5IA 4AIOA 1QR7A 2R1PA 1K9DA 2PC4A 3WNKA 3GBEA 1AQFA 3TTQA 3CJPA 3NR0A 3UNDA 4W86A 4OV4A 2YDSA 3WNNA 1TPWA 3VIOA 4A8IA 2XZ9A 2IMRA 3VGEA 2VNCA 2D22A 1JF5A 2GLKA 3OBAA 4UQEA 3QZAA 4MY8A 3B8TA 2VTFA 4O4WA 1CB2A 1AW1A 1GJUA 1KQZA 4H00A 5JH1A 4HPNA 2VGFA 1CGVA 3TJ4A 5I3GA 3CL6A 3LTPA 4KCTA 1ELSA 2ZZ6A 5AY7A 2BY3A 1KCKA 4RXGA 3GHSA 2FPVA 3STGA 3ZLGA 2V0TA 1DXFA 3ITTA 1NDWA 3P67A 4MUZA 1Q7QA 2XVLA 3A4AA 1W1IE 3BOXA 3TN5A 2G5WA 2VCAA 3CZ8A 2V9DA 3TC3A 5JQ9A 1GORA 1WCGA 4DVOA 2ZWZA 1RBAA 1UH4A 4CUCA 1A53A 1ZAJA 1X1NA 4KQNA 1QBAA 4GCXA 2CZFA 3V4BA 3PWGA 4JQ4A 3WLKX 1IWAA 5IBXA 2FDSA 2J27A 4MB3A 3P6LA 4F9JA 4PE8A 1KXVA 3MDWA 5FF3A 3E1F1 3WH9A 4AIEA 1FXQA 1HFBA 5L9FA 2OX4A 1HP5A 4YVXA 4PODA 3ITLA 4UOZA 3EWWA 4PN2A 4JHOA 2WB5A 3BQ6A 1PZ0A 3LTSA 3EAUA 1W1ZA 4NF7A 1UG6A 1RY0A 4B2DD 4MWAC 4US6A 5E93A 3CWNA 1VFTA 2INZA 5F2LA 3W2NA 4OJYA 1E43A 5T8GA 2Z00A 4OUIA 4H9YA 4MJ4A 4CNNA 2E5BA 1GTEA 3R94A 5BOEA 4LFYA 2EG7A 3LHZA 1UD8A 4KESA 4DO4A 1VPXA 1XLEA 1JVNA 3ZMRA 1KFWA 2QCFA 1WKDA 3HU7A 1VPQA 2W63A 4NRSA 3UR2A 5LKYA 3UYCA 1YDOA 3GDRA 2DIEA 1UD4A 2DUAA 1BHGA 4QIUA 1OG6A 4HT3A 4JIIX 5CPNA 4QJ5B 4JXCA 1EQPA 4YTRA 3EBVA 3VGDA 3RX2A 3GH7A 1XLAA 1W9XA 3W00A 3VNYA 2HTMA 2CFFA 1LG1A 2O4MA 3UT0A 5C7VA 2ZRWA 4MNLA 4ATLA 2YXGA 4ZQNA 3KTXA 3OTRA 3TP4A 5BWAA 5CBJA 1J96A 3BMWA 3GTIA 4QNEA 2DEPA 1JZ7A 4UZUA 1XS2A 4Q4KA 2FH8A 4CN6A 3OYZA 1KGWA 3WNPA 3WH6A 2BBFA 3OQ8A 1EJXC 3S2LA 2EG6A 5CC7A 3AMDA 4QS6A 5DXYA 5I77A 1Q6GA 2P50A 4GPNA 2W79A 4L4PA 5BRPA 2Y89A 4IMGA 1OEPA 2HPMA 1TE6A 3EKLA 1OCQA 3MJYA 1SO6A 5I6SA 4EXQA 1V8EA 2ZX9A 3WDJA 3H2AA 1LWHA 2Y8UA 5LXEA 4CD6A 3OZPA 3EA3A 5JIPA 1S5VA 4GIAA 2QJIA 4UTLA 3BLDA 3TYAA 1KBIA 2E8YA 4AWUA 5FIPA 3DFNA 1KXHA 1TJ2A 4WK9A 4QAWA 3T09A 3GU2A 3FSTA 4DJFC 1XXXA 3GQYA 1UWUA 2V68A 4IJBA 4PFMA 2C0AA 1ME8A 3LY0A 2ZE0A 4BK9A 3W3OA 1V0KA 1DIDA 2ZUTA 1C93A 6ALDA 1TYGA 5MHBA 2V3DA 2V5BA 1QO5A 3BICA 2NUWA 1LP6A 4GY7A 2YA0A 3W88A 1ZGDA 5GJNA 1XRSA 3TN4A 4KCVA 2YIHA 4JDYA 3QMRA 3NL6A 4HD5A 4Z2IA 1KFEA 3SFWA 3IK2A 1CBGA 1BLIA 2OX1A 3B8IA 3PBUA 5AHNA 3K8MA 4NXKA 4MADA 3BSGA 3OIXA 3UZ5A 4ZB2A 3AUOA 3NQCA 1HKVA 4DPPA 2B7QA 3FYPA 4LPCA 4YVVA 4RE3A 4XVDA 1E71M 2VEFA 3VXGA 3STEA 3CQIA 1AMYA 3L5MA 4E38A 3V1HA 4XZMX 1O66A 3R25A 1UWTA 2VR2A 4NJGA 1YXDA 4C6EA 4B91A 3LCWA 2WNNA 2PGWA 4UR9A 1IQ8A 4URIA 3BV4A 4XZLX 2QUTA 3W0KA 1I2OA 4V33A 1KXTA 4MZYA 3BGJA 2RFGA 2PBGA 3H2CA 2V81A 4PRWA 1YHTA 4TX8A 5A95A 1V4YA 4DAIA 4MKVA 3DECA 3M7WA 1ZS2A 2C15A 4RR4A 4C6KA 1H63A 4NYUA 3HGRA 3EGJA 2CIPA 1KCLA 2YJQA 1FWDC 2PD5A 3UU0A 4NX0A 2I16A 2ZA3A 3BOLA 4ZMGA 3MMTA 4B3LA 6TIMA 7CGTA 2EPNA 3B0VC 1QASA 4YTTA 2WNQA 5D2WA 2HPIA 1J18A 2Q3RA 5CPQA 1AZ1A 5CBBA 4TVDA 3NUKA 1V93A 1ISVA 1DIKA 2IW0A 1VRDA 4MWAD 3JVAA 2E1WA 4IIGA 2PTZA 4IQLA 2YYUA 5E0FA 3MANA 2XG9A 3C3NA 1FWHC 4B5XA 2HVNA 5BW6A 4HU8A 2L5HA 3AQUA 5D05A 1A5LC 2YFNA 1J8VA 4H01A 4ZVJA 2OKTA 1JR1A 4UTMA 1UUMA 3SRKA 1BTMA 3IANA 1W37A 5FCZA 3VD9A 5I07A 3PWAA 3M43A 1L6SA 4NZCA 3NQAA 2QUMA 2A4AA 4H9TA 5I03A 2J13A 4IJRA 4YN5A 5I2UA 2HCVA 2VI0A 3NZGA 4HYWA 4KETA 1VBHA 1EIXA 4ADTA 1KCZA 4TUFA 4ES4A 4ZQPA 4DXXA 1HGYA 6ENLA 4B92A 2FZNA 3LCHA 2J6VA 2RJGA 4J5NA 3CS2A 4S3KA 4C6IA 2QJMA 3SB0A 3NZRA 4BF9A 4BY3A 3QTGA 2YBTA 5G2IA 3EX6A 1R2TA 3UZWA 4TU1A 4RNIA 2G3JA 3TQPA 1S3TC 3KVLA 1Y5VA 3GUWA 3SJ3A 2CWNA 3DZ1A 2O9RA 3CAWA 1W3LA 4OGZA 3WQ6A 3EDDA 3QKEA 4IP5A 5A6JA 3WK3A 1W54A 2R1KA 1ZP4A 4OIFA 4XAPA 4NUWA 5EMYA 3B03A 1VS1A 2CW6A 5HR7A 1BGAA 3TEVA 4DJED 5KMYA 4ACZB 2ZRXA 3BG5A 4ZO9A 1OK6A 5HNNA 3LMZA 3REQB 3C3UA 1F73A 2FH6A 3TK7A 4KGJA 2Y88A 5FOOA 3EXTA 1J01A 4DLFA 4MZ8A 3MVTA 3FNDA 3GUGA 3TR9A 3S47A 5T9BG 3TFXA 5DY2A 1BKSA 4DJFD 3WDPP 4F0HA 4LNCA 3FKKA 4Z2HA 3W70A 2ZRUA 3DFHA 4HK5A 2F6UA 2X7VA 3IIPA 3Q4DA 8TIMA 2QCDB 1JZ6A 4XSMA 2O9TA 1VF8A 4FS9A 5FSDC 4JTCA 1QW7A 3WF2A 2YDQA 1VEPA 1GJPA 3JW7A 5ENLA 3T0DA 2Z1XA 3PG8A 1WV2A 3LU2A 1SYTA 3WX7A 2ZCGA 2EBNA 3PBMA 4V28A 3CHDA 3PJXA 2TRSA 2CLPA 1XIFA 1U33A 3QYQA 1K9EA 1UWQA 3R6IA 2VVNA 3USZA 3P0WA 3IIVA 4LAUA 1OK4A 5GNXA 2E68A 5GJPA 4UNKA 2Y8VA 1CT5A 3CIWA 1KWGA 2REQA 3TCSA 2JIEA 2UWFA 5G4EA 4XZIA 3VOIA 3ZIZA 3JUGA 4LXFA 4R85A 3SM0A 1AD4A 1GOIA 4M80A 3W74A 2CZEA 1A0CA 3AMCA 2F6XA 5C55A 3W7GA 3WDRA 2BASA 3MHGA 1VHNA 1EC7A 1US0A 2E28A 4EXBA 3TNOA 5CPLA 1E6NA 1E0XA 4AZBA 4NQ1A 3QPEA 5TAOA 4NU7A 3DYMA 4W7VA 1WDPA 4S3AA 4OBTA 4G9PA 3G1YA 3A22A 4MWAE 3L65A 1SJAA 2WVUA 3BG3A 5B7ZA 2OMAA 3SUUA 3NJ3A 3EOEA 2QT3A 2REQB 1H1YA 5A8NA 3W7NA 3WLNA 4MY1A 1YNQA 2YW4A 3RRXA 3VOCA 3F2CA 3MP3A 3P81A 2QVHA 3CHFA 4H6RA 3OVRA 4XV0A 2RUSA 3I6TA 3KX6A 2XH2A 2NW0A 2EJ1A 3CTTA 4ZFMA 3AIVA 5HPOA 4AZ5A 3T2QA 4DIAA 4Q4MA 3FXGA 3BAKA 2INEA 2QIIA 2WO5A 2VO5A 1BXBA 4JN7A 4GGBA 4AISA 3T55A 5LYRA 3KVKA 4GO8A 3PPHA 3MO7A 3I4EA 4V1YA 3QHMA 1L8PA 1TJ1A 4D8ZA 1E4IA 1RY8A 1YEYA 1M7OA 1XD1A 3K8LA 3H4GA 1UOZA 5A6BD 4UBPC 5I06A 4JCMA 3M6DA 3KAOA 3HV8A 1SGJA 3K4AA 4G5DA 3P7YA 2PLMA 2GSHA 2PD9A 3WJYA 5EMLA 3EPMA 4HCHA 3GR7A 1PX8A 2PC8A 1TPVA 2J7FA 4JTEA 4ZE4A 4HMCA 4JYEA 4HPXA 4E4PA 1XP3A 1BQCA 3F4CA 4PL1A 4WXYA 3W76A 4FO4A 1QXLA 3TDFA 4H2CA 2I56A 4N7QA 1H5YA 3WLHA 3FCPA 1AZ2A 2Y1HA 3W87A 1H7XA 2ISVA 3WFZA 4EWJA 4IMAA 2OSYA 3NEVA 2DQXA 2QV4A 1FQ0A 1BYDA 1XH0A 4DBUA 4EPDC 1DWHM 2X05A 1OX5A 2BY1A 2ACSA 3CT7A 3V0SA 3ZWSA 2PRLA 2AKMA 1GZJA 1I6NA 1FCBA 2O56A 2HISA 4DJEA 4FI4A 4HNCA 3UY7A 2J47A 3VVGA 1I2NA 2VXNA 3IGUA 3O8AA 3CT2A 1E6QM 3KBVA 2D69A 4KEUA 4BQ3A 1J2WA 3GVQA 7TIMA 3QW4B 5LIYX 1IT0A 3TQ0A 3WUFA 3ID7A 4HNLA 3KRBA 4BI5A 1YDVA 1XICA 3ES7A 1S2AA 3OLEA 4Q8UA 3NZQA 2OB3A 1GKRA 4HZ8A 1LL4A 3CQ0A 2ZXQA 4P8WA 4RK8A 2F61A 3BLEA 1TV7A 1QMLA 1CLXA 3ABSA 3P84A 3R13A 3SY1A 3F4DA 3L4XA 3N2OA 2XN1A 1EDTA 2VRJA 5HMSA 3LHUA 4A8LA 4GCAA 2Q09A 3VKCA 1KO0A 4HSOA 1LLOA 2J25A 1Q5MA 1I45A 4D1IA 3VE9A 3M07A 3AMGA 2UBPC 1IR1A 1QCWA 3N6QA 2GUUA 5A2BA 3TZNA 5H6HA 3ZM8A 5LNUA 1LORA 4R3UA 5HMEA 3ISIX 3MZ2A 4AZ7A 1XPYA 4DM2A 5HMDA 2NQZA 3VO0A 3C2OA 3VMNA 1ECEA 4GC4A 4A8NA 2XH0A 4ZSTA 4P2VA 1FY6A 1XRVA 3C86A 4P7QA 2YLLA 4H9UA 1FXPA 4C6NA 1JD7A 3CMFA 2J9XA 4C90A 1W9PA 2O9OA 4TX9A 4Y7EA 3SCWA 4WY0B 4UTHA 1UZ1A 4XIMA 4GI9A 3N2MA 2PDMA 2PDQA 1A4MA 1NOWA 4HB7A 2R91A 1WUFA 1PAMA 2FFIA 3QLDA 4P7OA 5I79A 2BODX 1A80A 4PTVA 1X98A 1UWIA 1S5MA 1EHNA 1FHLA 4PRTA 2PE4A 3IUIA 2HXTA 3M0LA 2BB0A 4GI8A 1V0MA 1V6VA 1EPXA 4NASA 3U5YA 2X1RA 1E70M 2FMOA 3FW6A 3VZXA 3G18A 5AVNA 5D8ZA 3IUDA 1CYGA 3EDJA 4UR8A 1SW0A 2D2GA 1OGGA 2VC7A 1LBMA 4MJZA 4E8DA 1K70A 4GX9A 1XKYA 4V1XA 2CBVA 4U5KA 3VIJA 4N4QA 3BAYA 4O14A 2X0SA 4U28A 1R3QA 3T05A 4ZQMA 3AMKA 3NXFA 1C8QA 4U33A 3NOYA 1V3HA 3AXMA 3WUBA 3RPDA 3U7VA 4M5PA 1T8QA 2WBKA 4NJHA 3LOTA 1VBGA 2C71A 1JXKA 2IUZA 1BVZA 3CYJA 2ZUVA 1QOPA 1TR9A 4ORMA 3I3EA 3Q94A 1SUXA 3NZPA 4NAFA 3VMPA 1W8GA 1XCFA 5D03A 2QS8A 3PNUA 5D09A 5CZ0A 1B3VA 4MB1A 3RN6A 3E5BA 4JTJA 3RITA 4C7GA 3GG8A 1GPWA 1OC6A 4U4MA 3ZJ8A 4X22A 1QT1A 4JYFA 1CGYA 1ZPTA 2VD8A 3U48A 2WQDA 3EMQA 2ZZ7A 1EA9C 1E1EA 4FLRA 2ZA2A 4WKHA 3PWIA 2VR4A 1FHDA 3L4TA 1VFSA 3T07A 3GHRA 1W6TA 2PDNA 4IMDA 1YXCA 2WBGA 3CHCA 3RIKA 2Y2WA 2CLIA 3RMJA 5EB8A 4S3BA 3UCCA 4F0SA 3HGOA 4BHYA 3M0VA 3CO8A 3IIXA 2A1YA 4Y9MA 1UIPA 2WQPA 3PTQA 4JYDA 3K13A 1KR1A 2BFGA 1IXOA 4B90A 2DSWA 1JRBA 4ML4A 1MEIA 2WNWA 3BW3A 5JMUA 3ARSA 3NTYA 3WUGA 1YPIA 1KRMA 3OBKA 3CH0A 4IJCA 3PFMA 3PG9A 1J0JA 2HNHA 3T2OA 1XLIA 4OBRA 2PGFA 3U0HA 4AVOA 3EA2A 4HJWA 4NL1A 4I90A 4ZO7A 3H4WA 3WFLA 1ZCOA 2DZAA 3IJ7A 3PJTA 1E4MM 2R14A 3J7HA 1DORA 3IIZA 3N2BA 4LCSA 4IHCA 1ZSXA 3Q67A 1UR1A 2HJPA 5HDRA 1W9UA 2ZWYA 3II1A 4BS0A 4I8DA 2VRQA 1EDGA 1S5WA 4ICMA 2O0TA 1FTXA 3TTOA 1WBJA 1AVAA 3EDEA 1BWLA 2WSYA 3MCNA 3OODA 5I3HA 2YW3A 3D5HA 2J75A 5TBOA 1PX4A 4PA8A 1NJJA 1XDJA 3OVPA 4BFAA 1N82A 2TMDA 4HTYA 3HZ3A 5M1TA 3WNLA 1E0UA 2KX9A 1CDGA 3E0WA 1OGBA 1EWEA 1AA1B 4RV3A 1XBXA 3B9OA 4PMDA 1JCXA 5G1TA 5FEZA 1VIWA 1EZ2A 3TYUA 3DENA 3MUCA 5M2FX 3R11A 2W4XA 2G37A 4AU0A 1TPB1 3GG1A 1LL6A 1ZUAX 1RCXB 4UQBA 1QI4A 3NPXA 1J0ZA 1J6OA 1UR0A 2EPKX 3KOFA 4O1CA 4Z1YA 2VUYA 3QKZA 3TFCA 2RH9A 3UF9A 1P4CA 3KP0A 3C2RA 3B4YA 2VC9A 3KHJA 2Z2AA 3DDMA 1LQAA 4BQ5A 4H4IA 1XHGA 1VEMA 3CTLA 3VA8A 4XO7A 2VEKA 1KM2A 3HJEA 4JD4A 1Q3NA 3FJLA 2GSEA 5I7GA 1NWRA 1ALDA 4PUDA 1K4HA 1BF6A 4U10A 3D3FA 1FDYA 2FZMA 1ZY9A 4JTKA 1PIFA 2FHBA 1EZWA 3B0UX 3CLWA 4GFIA 4AYGA 1DWJM 3W37A 1M03A 4O8AA 1BRLA 1J4EA 3LCLA 4E2DA 4F2UA 4CKQA 3DAQA 1VKFA 1JEZA 3AZSA 3E2QA 5K9XA 1LLZA 4FIRA 4JTHA 2J7EA 2VELA 4FMVA 3JS3A 3I7SA 3TMQA 3L66A 4BQ4A 1F6YA 4XISA 1VP5A 2V3EA 4HKPA 2GGJA 1LTDA 3SN1A 4FIQA 3N13A 1HJQA 3SIMA 4TQTA 4YLWA 3GNRA 1B4EA 2DT0A 1LWIA 5DBTA 3OJGA 1R9YA 2ISSA 3DFQA 6XIMA 4JTUA 1WDWA 3MYPA 5JVLA 4OBSA 3VOGA 4MGGA 4GVIA 4X61A 1AG1O 1LBLA 1H7WA 4KFOA 3WQDA 3N6HA 1PKLA 3SUTA 4L9YA 3VGGA 1WO2A 2I5QA 3LPOA 4QFUA 4CU7A 1CGUA 3C2EA 3V35A 4PGLA 2Z4GA 4NZ5A 2EO7A 3GG0A 1KRBC 2EKGA 3EMCA 4CD5A 2ZX5A 4KCWA 2QF7A 4AWSA 2PU1A 1T41A 1ZCCA 4UIOA 1EBGA 3WDHA 4DLMA 5J04A 3TC6A 3P60A 3V36A 1F4HA 2WHLA 2YSWA 1XYAA 2YBUA 2QMJA 4IIEA 2VX6A 1K6AA 1NIUA 3NO3A 3H21A 1QPQA 3SRHA 3W29A 5F2MA 1UKQA 2HE8A 5IHRA 4O19A 2GK1A 5C70A 1YE4A 1B3OA 4H6EA 2VHLA 1BXCA 1OFDA 2BP1A 1WNOA 4IXHA 1Q6OA 1SJDA 1KBJA 2Q3OA 2IPJA 3OW1A 4N6FA 2VZVA 3KL5A 3ATZA 1C8YA 3ENLA 1Z8AA 1SSDA 1J0YA 3TWBA 3ABQA 4DB7A 2R8WA 1RP8A 3O6DA 3ATYA 1MRAA 4LUSB 2PLCA 2W67A 2WMIB 1VLIA 4QROA 2NXIA 4DXVA 1B0IA 1FCVA 2OT0A 5DF0A 3R8GA 4WDTA 1ECQA 2E6DA 2ZZ4A 2A7RA 3V3WA 5D02A 1F8IA 1MMFA 1AJZA 1OM0A 3VUPA 4LBSA 4O1AA 1PL9A 4WKFA 3TW6A 4ZL1A 1W1TA 3FJ6A 1EF2A 1IEVA 3GBDA 3LZ5A 4PB5A 2WZIA 3KOZA 4AQLA 3N73A 3BCJA 2Q71A 1GVOA 3SUWA 3W6MA 1XG4A 6TAAA 5JU6A 5EBUA 3N4FA 5DEZA 1X8FA 4AH7A 2QJJA 4XK2A 1W91A 2CWXA 2DU2A 5D4YA 3VZYA 1CXHA 2F8QA 3VD3A 1LOLA 5FESA 3BAIA 1GOQA 4QSFA 3T42A 3ITVA 4J28A 3N2TA 3V5FA 4C1LA 3B9NA 1B3YA 3LG3A 1G67A 1VEOA 1AQMA 3AIUA 1UR4A 2O9PA 4LRSA 3BXWA 3NXLA 3VFLA 1YW1A 2Y5SA 1NWTA 1HTIA 1FKXA 3BL3A 5BMWA 3FHAA 4CVUA 5EU9A 1SW7A 2MANA 3CPUA 4L80A 3TW7A 4GYPA 1M68A 3SGUA 2GVLA 4GH1A 4WGXA 1I0DA 2BOGX 1QOXA 3CPGA 4YS1A 2XWDA 3CH9A 1OFBA 3KTSA 4E4FA 3U5UA 1GQKA 1JGMA 2C1GA 5FA5A 1IGWA 1F5ZA 3GC2A 4H7ZA 2PDJA 1A3XA 4U3CA 4XKMA 5PTDA 1MXGA 2ZVRA 2WCGA 1D9EA 4A2SA 1A3WA 1UKPA 5CJNA 3AOFA 1PBGA 3KWXA 1F6PA 1HKWA 2PDGA 4O1BA 3HMCA 3ZLFA 4KRZA 3U2CA 1V02A 3RO8A 1GVFA 5HAOA 1RQHA 4BWLA 3K30A 3OZOA 1DJXA 5I3KA 1DTUA 3NQ7A 2WC4A 1H7NA 3LUTA 4JNYA 1UH3A 1XLGA 3TQKA 3LYEA 1BFNA 1H62A 2A6LA 1SPQA 3VCNA 3UZYA 3AALA 4AIUA 4WUIA 1Y0EA 3LLFA 2OGYA 4W88A 4S2CA 4YVPA 5ABFA 2ADAA 3SCUA 3HG5A 1YNPA 3NPWA 4S38A 1Q2SA 4S2BA 1TMHA 1IEIA 2VZUA 4TTUA 2ACQA 4PUUA 1YRRA 3C52A 3G1SA 4LU0A 4FPSA 1OCJA 1TPC1 3VE7A 3QY6A 2DZWA 3LGDA 1GZGA 1K03A 1PUDA 2AGKA 1G4PA 1CGXA 1OY0A 2BVYA 2V3GA 2D0HA 4PTXA 4D71A 1AW5A 9XIAA 2J66A 1OSEA 2RAGA 4K7YA 3VIKA 2BWGA 3QPYA 2F84A 2HK1A 4GGHA 4JY8A 4DWSA 1XF0A 5I3JA 1Q2RA 3E9AA 1B9ZA 1US2A 1UOKA 3AYSA 2PDYA 3G0SA 1M9HA 2BOFX 3R58A 4F40A 1XRTA 2PGRA 4IISA 3BGGA 1K9TA 3ABOA 3NCOA 2YDAA 3E02A 3BLLA 1UR2A 4GY0A 5ABGA 4FNQA 3IPWA 4K7VA 3G1FA 1P48A 2OODA 2QCCA 3H7RA 2CESA 4RDYA 4UTTC 2XH7A 4FXRA 3ZR5A 2CKRA 2XFYA 3GRIA 2V67A 2DZUA 4P7NA 2J9ZA 1OX4A 1N55A 4HPGA 4DWSB 1XUZA 1E9ZB 4HZ6A 2ZXAA 3IRSA 4FLSA 4A3HA 4NZ1A 5DQPA 3RU8X 1CENA 2Z6IA 3FIGA 2QUVA 1J0HA 4F0LA 3MB9A 4FA3A 4JIQA 4EPBC 3WLRA 1EKOA 1NOFA 2WYSA 3IS4A 4FF7A 3T8LA 5A6AA 1UR3M 3WQEA 2VWSA 3W7RA 3QN3A 2E6FA 4UOJA 5AVHA 1AK5A 4LUTB 1VFUA 3APYA 1CZ1A 3LENA 5C6MA 2CHRA 2VX4A 5K9DA 4IL0A 2IPGA 2OZ3A 3UG5A 1P7TB 5CC6A 3CIVA 1BEUA 1W3NA 3AO0A 3H7UA 4W7WA 2Y7GA 4G6CA 5AC5A 2D2JA 1OX4B 1Q4NX 3DYPA 4UTWA 4D8LA 3XIMA 3LHWA 4AC1X 5KZMA 1S1PA 3CZGA 2WK2A 3CMJA 3S1VA 1O95A 3OG2A 1X97A 2W3ZA 3DG3A 1Q6DA 3KCOA 4INFA 1QI5A 3G1DA 4B9ZA 3QPZA 3RCMA 1V3KA 3CHEA 4ALDA 1R38A 3OHMB 3DBNA 4GJ1A 3CQJA 1W9VA 1GZ1A 3TZFA 1NARA 1H51A 3ANVA 3N2CA 1XIJA 3IVUA 3KBMA 4Q8QA 3TVAA 2ATSA 2XSXA 3N17A 4IFKB 4F8XA 5C8BB 4E2OA 1HGWA 5XIMA 1P0BA 2TYSA 3KW3A 5HJLA 1R47A 2GWNA 3ZT6A 2FTWA 4QJ3B 3W7DA 3QHOA 3YPIA 4A3RA 4E4UA 4L6HA 1SZFA 3WQGA 1MW3A 4MDOA 3T6CA 3QRHA 2CLLA 2Z7GA 3P3BA 3WQWA 1JPKA 4S1FA 4L61A 4O1EA 5JXQA 4R34A 3NGFA 3UW6A 3HG2A 1JJKA 2WC3A 5FD0A 5IFTA 3ITXA 2OLHA 3HQ1A 3MMUA 4MFEA 1LT8A 3UWYA 3W81A 4DRSA 3DC8A 2ZADA 1M7JA 4FLOA 2GVJA 3OOQA 2DT1A 2OGJA 3CZEA 4O53A 3UJSA 3PZQA 4UQAA 3F7JA 3STFA 1A5OC 5BROA 3OLGA 3SCVA 3T7VA 4MG4A 5HA7A 3W1PA 1DQWA 1PV8A 1QPRA 5DLCA 3SBFA 3GAKA 4AD1A 2OWXA 2OR2A 4LY8A 2QDHA 3KP1A 5HUOA 5FF4A 4GYJA 4JS3A 3AI0A 1B54A 4JQAA 3NSXA 1VFHA 1S1RA 1E55A 4US5D 4Z1AA 1MDRA 1W2PA 3P74A 1EX1A 2POTA 4GUGA 5XINA 2JEPA 4REQB 2CZ5A 4LC8A 3UBPC 1GCYA 1FWEC 3C2VA 5CEWA 3S6TA 1TIMA 3W84A 2D3NA 4ZEPA 4BI6A 1XLJA 3N4EA 2GJXA 2ZTKA 4EVZA 3AIQA 3VIFA 5DCBA 2CXGA 1F2JA 5BXPA 4K39A 1W9DM 1RQBA 1EWDA 3S0CA 3GTHA 3WG6A 1K7XA 1JPDX 3JZEA 1JZ8A 3F1QA 3EDFA 1OFPA 2CC0A 5DCDA 3M0ZA 4LJ3A 3M0KA 3L0NA 4YTUA 1ESWA 4EAYA 1OCBA 4DY1A 3CLMA 3CEUA 2YA1A 1TCDA 2VC6A 3GDKA 5D2XA 1OT1A 3W7LA 4RE2A 2VFGA 2PP0A 2WVVB 5B7YA 2OSXA 3NQEA 2PS2A 3BLIA 5BZAA 4EE9A 3VAVA 3RRAA 3AYTA 2X1UA 1JUEA 2CLFA 4KWVA 1TUFA 4M7SA 3VI2A 1FWNA 1T0OA 3WZ0E 4C1NB 2NLYA 4XB3A 4AXNA 3KL3A 4G2DA 3GK0A 2WM0A 4L4OA 2OVLA 2NQJA 2WCSA 3IJ6A 3LBMA 3GXFA 4ZOBA 3QEZA 1OFQA 5E70A 1CGTA 4RL3A 1J5TA 3MKCA 2P0IA 3UA3A 4ZCWA 3S2NA 1FWFC 3DFOA 3L23A 2QPUA 4LAOA 1OGSA 2DZSA 4F3HA 3HO8A 3MSYA 3RO6A 5FL1A 3S5YA 4GIRA 2VDGA 1TTPA 3CB3A 3N14A 4QSHA 3PBVA 3EWDA 3LQGA 2TAAA 4HVXA 2H3BA 4Z2KA 4O11A 1P1XA 4H6KA 3QF0A 3BSMA 4JIHA 3ARRA 3ZT7A 1MQRA