4N6EA

Crystal structure of amycolatopsis orientalis bexx/cyso complex
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
244
structure length
244
Chain Sequence
b'DEPWLKIGAREFRSRILVGIEQYDSVPLVRDVLNAAGADVFITTVDPDNRRSSLLLMDLADELPLDDFTWIGTTSFARTKESALRSARILRDSLGIEILKLDVRGDDNTPDNAGTVEAARELRAEGMELLPFILPDLATARALEEAGCAALRVMASPVASGRGIANPAAIRELIEQIGIPVVVEGGIGSARHVAEAMELGASATLVNTALVRAESPLLMAAAMRQAALAGLLSYESGPMPEVAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative thiosugar synthase
publication title Co-opting sulphur-carrier proteins from primary metabolic pathways for 2-thiosugar biosynthesis.
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Lyase/biosynthetic protein
total genus 80
structure length 244
sequence length 244
ec nomenclature
pdb deposition date 2013-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05690 ThiG Thiazole biosynthesis protein ThiG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4n6eA00
5CSRA 1O4UA 4OQVA 4IMCA 3N19B 2RDTA 1TO3A 3NZ1A 3LGEA 5F4WA 5L9FA 2C6QA 5KZEA 4O16A 1PV8A 1W31A 2FPTA 5EL1A 3WK0A 1SO3A 2WNNA 3P61A 4ZQNA 4UTIA 3JR2A 3EXTA 5KZDA 3NQ2A 3U6WA 5G1TA 4DPQA 1IIGA 3IGSA 2CWNA 4C1LA 1BEUA 4GRSA 3LRKA 2OT1A 1VCGA 3A5FA 2YCEA 4XBKA 4JTJA 3F1QA 4GUGA 1AW2A 3Q37A 1NSJA 1WA3A 2XN1A 3C56A 2UV8G 3LI0A 3P5YA 3RU6A 4FB7A 3F4WA 3FKKA 2NV1A 2QR6A 4YL2A 3NQCA 4KKXA 5DCEA 2WOQA 1XBZA 1RR2A 4AVFA 5CPOA 1LLWA 4LVDA 1XUUA 4ONVA 3IGXA 3M1ZA 1YTEA 4K6AA 4O50A 2A4AA 4PFMA 3P60A 5DBTA 1GVOA 1LLZA 3NQFA 1FQ0A 4O4WA 1TV8A 5FEXA 1FWRA 2A7NA 2ZA3A 3LCWA 2QEZA 3EXSA 3TSMA 5BOOA 4UTWC 4AF0B 5AOUA 3W76A 1KM0A 4EF9A 5HWNA 1QPNA 5CPLA 3TE9A 1NVMA 2ALDA 4CQAA 4MFEA 4LVGA 4WZHA 4I9AA 1JCXA 3W7OA 4WD0A 3BGGA 4FEZA 4LVFA 4H6KA 1ME9A 1VPXA 1F5ZA 1L6WA 1EP1A 4HNUA 2VFHA 3W88A 3LRMA 2EAWA 3P81A 3PWAA 4MYXA 4O0KA 1KV8A 2QDGA 1B57A 5LNVA 5DLCA 1XL9A 3KRZA 2WNZA 1I4NA 4UTMA 4DBDA 1OF6A 3DU0A 2J6XA 3UQNA 1E51A 3BV4A 4BK9A 3TXVA 1GG0A 3G1YA 3NEVA 5BW6A 1DL3A 2PRLA 3FKRA 2QUTA 1H7OA 3ATYA 3QFEA 3TFXA 3S8HA 1VCFA 5IBXA 1SQ7A 4AWSA 3QQ0A 5DY2A 3FA5A 4XBSA 1VLIA 1A53A 4IMFA 5EBUA 4DO5A 3O07A 4A2RA 3O6DA 4GUJA 2ZZ4A 5LHEA 1O60A 3TSBA 4O57A 2I1OA 4AWTA 3CB8A 3BW4A 5K4XA 2QF7A 2OJPA 5HMSA 4XKYB 4WOZA 3A24A 4IWWA 1QMLA 4CNOA 1KA9F 5H91A 5K9CA 1V7YA 3DI0A 5SWUA 4HNVA 5AYXA 1Q6OA 3F4NA 2VKZG 3W75A 2JK2A 2O7QA 5U4NA 4E0CA 3LXAA 3WJWA 1W5PA 2IQTA 2VEKA 3W1RA 2QUVA 2RKXA 2ABBA 1D3HA 3HB9A 3KVLA 4X2RA 4M7SA 3VFLA 5ABTA 1TQJA 5FF4A 1PCKA 2ZCGA 2V2CA 1R2SA 2B7QA 2Y7GA 1W5NA 4ORMA 2X2GA 3W1QA 3NQ6A 3PBYA 3UNDA 1YDOA 5FF7A 2Y62A 3TC6A 3QMRA 4DXVA 3IVUA 2NWRA 3VCRA 3A23A 4LUJA 1N8FA 3MBDA 5AHFA 3R8RA 3MJYA 4DF1A 3NQ8A 1XCFA 1VS1A 4UTTC 2GVJA 4FIQA 4L4LA 2YFNA 3GVGA 2C14A 2CU0A 3PF3A 1K02A 3TMQA 1G69A 4XQ6A 3TSDA 4Z1DA 4WXYA 4GUHA 3DI1A 4H3DA 3W2MA 3HG3A 1SR9A 4A21A 3NA8A 2ZRZA 3O06A 1H7XA 3MHFA 3NQGA 3T78A 1ZCOA 2WSRA 1I2PA 5DY3A 3HG4A 4FF7A 3B4UA 1PCWA 1NF0A 2OMAA 1QR7A 3W22A 1OK4A 1QFEA 4WJEA 4BI6A 2WPBA 1GEQA 3HGRA 4MVAA 3INPA 1T99A 4JD4A 5C6MA 2J9YA 3VNDA 1DV7A 1XM3A 1Q6LA 1SZEA 1I45A 3O63A 3PY2A 3HQ1A 5D2VA 3EWBX 5E1QA 3GDMA 1HFBA 1NAL1 3UZJA 3N9SA 1Z48A 3E49A 3QW4B 5K2ZA 1M6JA 3JRKA 1KFCA 1GVQA 3QC3A 5HNRA 4CCCA 1H1YA 1QDSA 2LLEA 1MEHA 2PURA 4O54A 3WJZA 2RDUA 5BMXA 3P84A 3W87A 5AHEA 2CZ5A 3GXTA 3PS7A 3LCFA 4NJIA 1AW5A 3FYPA 4O15A 3TROA 3SIZA 3W72A 3MW7A 4Z08A 4ML9A 3LB0A 1KM5A 1G4TA 8TIMA 3B04A 2AQWA 4TMCA 2B0MA 2G96A 1QO5A 3N73A 2OT0A 4O12A 4JTFA 3TW7A 3KXQA 3IIPA 3LOTA 1H1ZA 4DELA 2ZFAA 2CLKA 1TPC1 5U7SA 1ML1A 4RR4A 3FOKA 1JCJA 3PUDA 4HNTA 3C2VA 5MHBA 5AHIA 5F2MA 4BWLA 1OX5A 1K7FA 1W5OA 3W7RA 4UFMA 4IMGA 3B06A 5CZ0A 2V9DA 1PHQA 1RD5A 3OHIA 2CW6A 5F2LA 4NXKA 3NZRA 4W9TA 4MKNA 1GWJA 3NL6A 4NNAA 1B4EA 2EKCA 3EKLA 4LC8A 3S5YA 2A7RA 4MZ1A 4RXGA 4B5NA 2VC6A 1UUOA 2JGYA 3I6RA 4XTIA 3QW3A 3SR7A 4LU0A 4N9DA 1K7XA 1EIXA 3GIYA 4MY1A 1WOAA 3G24A 3G1HA 2ZZ6A 1FWTA 5AC7A 3QEZA 3SGUA 3TKFA 2E1DA 1ME8A 1J2WA 3DHDA 4LS0A 3SECA 3W7HA 1HO4A 1LOSA 4JX5A 2Q3RA 3O05A 3M44A 4E2DA 3M9YA 5DXXA 3NO5A 2E6YA 2ZA2A 1XXXA 1OX4B 5D2XA 4GUIA 2FLIA 1F05A 1KTNA 1OYBA 1H7PA 2QCCA 3IGUA 3R5EA 3Q58A 2V8ZA 4MLRA 4UTWA 5DELA 4LUIA 5A8GA 2VEIA 1W37A 3BW2A 1W56A 4JIPA 4EWND 1SFJA 3GKAA 3NM3A 2P0OA 2VENA 3GK0A 5LGXA 1LORA 3LHYA 2A5HA 3DHFA 2C19A 1S5WA 4RCXA 4QISA 1A5BA 4Y90A 5KITA 1A5SA 4MFDA 1FUYA 1UB3A 1C8VA 5T26A 3DENA 1W5MA 2ZZ2A 4QAIA 2Z0IA 5G4EA 2YYUA 2PCQA 5KINA 4M5PA 2EPHA 5IM51 1KTCA 5KSWA 3AO0A 3GXNA 4MY9A 1TJRA 4HT3A 4JTHA 1JUEA 4YXGA 4TIMA 1EUNA 4DF2A 3PULA 2OZ0A 3S5OA 4O18A 2GVGA 4DEFA 1TV7A 3LBCA 1GTHA 4UFLA 2GQ8A 4JEQA 2V2HA 1S3HA 3WJYA 2R94A 2QCDB 5FESA 2H8ZA 3NDOA 3PB2A 4O11A 1M7OA 1XDMA 1VJIA 3LTSA 3MBFA 1NEYA 4IGHA 5C54A 3KRSA 1B4KA 5HR7A 4UTLA 3UD6A 5GVJA 4GWEA 1EEPA 2BLEA 1LBLA 1TTPA 2JKAA 4NU7A 3W7GA 3GDKA 3HPZA 1F6KA 1ADOA 4IQLA 3NAVA 5HQEA 2QKFA 4K38A 2Z2UA 2PRMA 3EWZA 1C29A 2YZRA 5D38A 4ZQMA 3W2LA 4E2BA 2BZNA 1TTIA 4O14A 1PS9A 2TMDA 4RV8A 1W8SA 2A21A 1KBIA 1H62A 2A85A 2ZBTA 5D30A 4TO8A 3G1SA 1YXDA 4LWWA 4UC5A 1G4EA 1KBJA 4X22A 1UBSA 4FX8A 4HHPA 1GZGA 1Q6QA 3IEBA 4RLIA 5LSMA 1P0NA 2DJLA 4R7JA 4AF0A 4UNKA 2VOMA 3O15A 3W7NA 1HTIA 1QWGA 3TW6A 2J88A 3TH6A 1D9EA 2EF9A 2GJNA 3C61A 1FWWA 2A6LA 3UPWA 3B0UX 2FIQA 4DO4A 2ZQ0A 5AHLA 4Z1AA 4AMAA 1THFD 4UTTA 3CIWA 3L5MA 3IV3A 2X1SA 3NNTA 4Q32A 3P82A 3EX3A 3UWZA 1TPB1 4A22A 4EOUA 4NX0A 1R30A 1XC4A 3TXZA 2C0AA 3W7QA 1PVNA 1UCWA 2V0TA 3BARA 3KX6A 1QOPA 4QJ1A 4BR1A 3LM7A 4CCEA 2JKEA 2E77A 3UYCA 7TIMA 5LNUA 3GKFA 5TQLA 2HTMA 3NQDA 3F03K 3O6YX 3NPVA 5I3FA 5LKYA 1DQWA 1TQXA 1MEIA 3TC7A 3TUUA 1GJPA 4HNNA 2CLIA 5E93A 3P5ZA 4O53A 5D05A 5L6UA 2E5CA 2R91A 4Q33A 1ONRA 3G8EA 1FCBA 1LOQA 4JYFA 3UXDA 1VHNA 3DH7A 1ZAIA 2DZXA 1WXJA 3L66A 4Z0JA 1OFPA 1H51A 2NUWA 3Q94A 4XKYA 2WSQA 4NZJA 4DPPA 3PG8A 1LZOA 4O19A 3ZFHA 1JCYA 2DU2A 2DZUA 3S5NA 1LROA 1RV8A 4ORIA 3W85A 3DFSA 4JX4A 5LHFA 1GG1A 1EA0A 1KFLA 2FFCA 4ZMGA 3TFCA 4RJEA 3V75A 3NPWA 4AB4A 3QZEA 2ZRUA 3CQ0A 3TV8A 2F84A 4Y6GA 1IXQA 3KAOA 3CT7A 1GVRA 4LT9A 4IMEA 2TPSA 3RK8A 2GVLA 5CZSA 4UTUA 4MZYA 3RF9A 5CPNA 1S5TA 2X1TA 4NJKA 2Q3OA 2A7PA 3RMJA 4JTGA 5I3IA 3HGJA 2QCHA 4AAJA 4YMZA 2Q8LA 2VELA 1TPDA 4X3ZA 2FPVA 2Y7DA 1TYGA 3SSJA 3NGJA 5K4ZA 3GAKA 1XBVA 1R47A 2CLHA 2DORA 3R2GA 3W7EA 5FEWA 4Q4KA 3M5YA 4EIVA 3LI1A 3QSTA 3W1AA 3SGZA 1LBMA 2EHHA 1YADA 1JCMP 2BX7A 1VQTA 1F74A 4N2YA 3UWQA 3E12A 1O5KA 1TMHA 1UJPA 1L9WA 3PBUA 4I7UA 3STGA 1FCVA 3KVJA 1Q3NA 1GVSA 5EA9A 2G5WA 3UXAA 3MWAA 4IX2A 4NJJA 2DZTA 3IVSA 5DN1A 5HWMA 2FQIA 1S5VA 3NQAA 4KFOA 1XUZA 1KM2A 5I3HA 3BPWA 2I9EA 4LS1A 3ELFA 3CIXA 3LTPA 1GYLA 1TPH1 4LTSA 4MYAA 3OEXA 3M6YA 1IF2A 3E0IA 3NQVA 5G4WA 2YW3A 2QAPA 3M41A 1SW7A 5D33A 3OA3A 5D37A 1FX6A 3LCHA 3USBA 1U83A 4GBUA 1TTQA 4UFHA 4DBEA 2TSYA 3PR2A 3W7JA 2FB3A 3L5AA 1PE1A 3P62A 2E6DA 4M6VA 1H7NA 5FI8A 1U5JA 2VFGA 3PC0A 1EUAA 1WDWA 2Y7EA 2ZDRA 1SO6A 3M5ZA 3S1UA 3FLUA 1H50A 1FXQA 3I7SA 3GDTA 4MUZA 4QNWA 2RDWA 1YYAA 2CLEA 1OFOA 2ZZ5A 3TCEA 3MI6A 4O1DA 2GJLA 5TBOA 3U8GA 1TB3A 1X8FA 5FEPA 2ZZ3A 4HKPA 3TA6A 3H54A 3DKLA 3PUEA 2NV2A 4ADTA 2WKJA 3W1MA 2RHGA 1W3NA 3TJLA 3DZ1A 3ABOA 4A3UA 4K8EA 1FY6A 3AJXA 4OU1A 3DXIA 2C3ZA 4CLMA 2E6AA 4O52A 4O4VA 1TREA 1IXOA 3H53A 4RK8A 3W1LA 3M16A 3EWXA 2B4GA 1F6PA 2X1RA 2BWGA 3CU2A 1ALDA 1A5AA 1ICSA 2H6RA 3R89A 2NX3A 1QAPA 1X7FA 1JVNA 3DBPA 3QPZA 3NQEA 4JTLA 1ICPA 4NT0A 2QUUA 4FNUA 4O1BA 1T96A 1LDCA 1VYRA 3GDLA 1AK5A 3IIOA 3G3MA 3I7QA 2XN2A 2YW4A 1CW2A 1RVGA 5G2HA 4OT7A 4WY0B 3WK3A 3TU9A 1HL2A 1TCDA 3EX2A 4XTDA 4LNYA 4MZ8A 4RZ4A 1QPRA 2E09A 4NJGA 1FWNA 3BW3A 2HS6A 1F76A 4JICA 4XZ9A 2H90A 1W0MA 5C2XA 5KMYA 1QOQA 3CTLA 4RZ5A 4ALDA 1DJQA 1NFBA 3NPXA 2B7OA 2Z6IA 3MYOA 4ADSA 4JTUA 3G18A 4UFIA 1SFLA 4A2SA 1W54A 2GUUA 5CKSA 4IMDA 2V2DA 4K39A 4K8HA 1DBTA 2WQPA 3CPRA 4GE8A 3GXPA 4PC8A 3S9YA 2F7FA 3LCGA 2A6NA 1F7BA 4YCOA 3W23A 1BWKA 4HSOA 4NJHA 1WBHA 4FNTA 2GQ9A 1X1OA 5I3GA 1IGSA 3VKJA 3CLMA 2PC4A 1I8JA 3GYEA 3S0CA 1RQHA 1K7EA 3ZWTA 4LY8A 1K03A 2B7PA 3MP3A 5AC6A 4FNQA 1EP2A 1NF7A 3SJ3A 2HMCA 4JY9A 3CHVA 4M19A 2V82A 1YTKA 3NL5A 4N9EA 6TIMA 2Y88A 1R2TA 3W71A 4UUIA 2VXNA 3L5LA 3LCIA 3PG9A 2W0UA 3W1TA 4JTKA 3W84A 4O1AA 3QF0A 1T8XA 5CPMA 4M7TA 1UUMA 3B0VC 1JRBA 3W74A 1N55A 3QRHA 4AHOA 2GPTA 3TQKA 1X1ZA 3W73A 4JS3A 3BG3A 3U2OA 1YXCA 2QCDA 3GX9A 1HO1A 4UTJA 4EF8A 4NUWA 3SW6A 2QDHA 3KHJA 1ZJIA 3LTYA 1JUBA 2PE4A 3PBVA 1SZGA 4GJ1A 1RPXA 4P2VA 2DZSA 3MI3A 3BLIA 3DFQA 1PHWA 5CG7A 1H5YA 2ISVA 3GLCA 3P74A 3LHUA 2Y89A 2VEPA 2QCLA 4FXRA 1FCUA 3TIMA 2DJXA 2B7NA 1FDZA 3N14A 1T0OA 4LRSA 3WJSA 3E9AA 2NLIA 1P1XA 4YWIA 3QH2A 3PSVA 1W3TA 3LV5A 4AWUA 4QNEA 1VR6A 3S5ZA 1IXNA 5AFDA 1O95A 3A9IA 4QSHA 4OV4A 4GFSA 4DQWA 4PA8A 1KLZA 5AYYA 4WQ6A 2QJHA 4FIRA 3MHGA 5F4XA 3W1UA 1JR1A 3MUXA 4TX9A 4LRTA 3UWUA 3UWYA 2A2IA 3IRDA 3T40A 1YDVA 2ZA1A 4CNPA 2TYSA 3M5XA 5D09A 5F2GA 3GNDA 4HN4A 2WV8A 4G1KA 1SUXA 2GQAA 2ISWA 3W83A 1K3UA 2AAMA 4GXMA 1EP3A 3FYOA 2A0NA 3HO8A 1TPEA 4AEOA 3T55A 1X6UA 1H7RA 1TIMA 3QM3A 3D0CA 4JGDA 1ME7A 3W86A 1JQVA 3ZWSA 1BTMA 1H7WA 3M5VA 3OVQA 1JUKA 1Z44A 3DFTA 3W7KA 3LBMA 1FDJA 5AC8A 3TDFA 3M47A 4MPQA 4Z1BA 5D2TA 1O94A 5DBUA 3MMTA 3GNNA 4LVBA 3IVTA 3LXCA 5J5RA 3UWVA 3WK1A 1LBFA 4IPIA 4AHPA 1TPWA 4Z1CA 3NR0A 4UMCA 3GR7A 4WUIA 3GAYA 4ZQPA 3OBKA 1TRDA 3PSWA 3DFPA 3LX9A 3EXRA 3C2FA 2ATSA 2CZFA 1OFDA 4UMBA 3L21A 5D2WA 1R2RA 1FBAA 1M7PA 3GDRA 1I2QA 2YYTA 3QSRA 4JTSA 1CI1A 1MXSA 4GNJA 1KM1A 4RKAA 4MOZA 3L68A 1I2RA 1LP6A 4A29A 3RLVA 3NG3A 3W7DA 3T4CA 4UCGA 3G1DA 4AHQA 3W9ZA 1EX5A 2R14A 3B05A 4LV9A 3TQVA 2FTPA 3WFAA 2R8WA 1Q6RA 4JDBA 4O17A 1GT8A 1VGAA 1G6CA 1VYSX 2YDAA 2NWSA 1V5XA 4K37A 4O1CA 4PEKA 4O8RA 4OBTA 2ZZ7A 3C2OA 5HULA 2D73A 2JBMA 3DKJA 4CQ8A 1TTJA 3ABSA 3BVJA 1A5CA 4H4IA 1RQBA 4ZZ9A 5DXYA 3L9CA 2Q8ZA 1LOLA 2V5LA 3CWOX 3N3MA 1DVJA 1OFAA 1SW3A 4LV4A 5EYWA 1K8YA 2BSLA 3L0NA 3NQ7A 4P61A 4O13A 1WQ5A 4MY8A 5AB3A 2DP3A 3DFNA 3W2UA 5AN7A 1I2OA 1VRDA 2ATMA 1ZALA 3G0UA 3MO7A 3RLUA 2H8XA 1K8XA 2NZLA 1ZAHA 1N7KA 1OG0A 3L0KA 1TPFA 2FJKA 1FCQA 1OX6A 5K9XA 4PH6A 2HS8A 2Y6ZA 2X1UA 3NM1A 4NXSA 1TRIA 4PCFA 1G4PA 3PM6A 1L2UA 4JX6A 2WNQA 3UPBA 3FJ6A 2C18A 2C1HA 3ZS4A 3W6YA 1BWLA 3SZ8A 4R34A 1L6SA 1ZY9A 3L0GA 3NL3A 3LV6A 1Z41A 3P80A 3EWWA 1EB3A 5A5WA 2ZRXA 3G0SA 3UZ5A 3N2XA 4FHAA 2WO5A 3QMSA 1DQXA 4IJBA 4JY8A 3STCA 3LRLA 2QJGA 4IXXA 1JJKA 1B9BA 1GVFA 3CM4A 4POCA 3G1AA 2NUYA 3H55A 1G67A 3I65A 3M7WA 2Z1BA 3BLEA 4X9SA 3O6CA 1KM3A 1WV2A 3LERA 3M0ZA 3EEGA 2DZWA 3P7YA 4UTHA 1MO0A 4UTKA 3C2RA 1SPQA 2ZRWA 3G22A 1M5WA 1WBJA 3UY7A 1PIIA 2C16A 4Z0SA 4CNNA 4TMBA 3THQA 3S6DA 2E5BA 1VH7A 3QMTA 1EWDA 1YXYA 4S2CA 3STEA 5EY5A 1K8ZA 4Y96A 2CFFA 2NUXA 2CZEA 2Y85A 1MEWA 5HJLA 4C1KA 4JR5A 3HOJA 2DZPA 2FB2A 4S1FA 2O7SA 5F4SA 5J5DA 5G5IA 3S42A 2E6FA 4LS2A 3B8DA 1GPWA 1ICQA 4FNSA 3S1XA 3G1XA 1OFEA 3FIGA 3KVMA 2YSWA 2ISSA 2FDSA 1H61A 3TAOA 1XBYA 3LCLA 4UR8A 1HG3A 1F73A 4UXDA 4FNPA 4CCDA 4N02A 3W2KA 1VZWA 2VEMA 2ZYFA 3K30A 4IUOA 2BXVA 1AL8A 1W1ZA 4IX0A 1QNVA 2CLLA 3TR2A 1VLWA 4OV9A 3MYPA 4EVZA 3P67A 1L6YA 4JYEA 1MSSA 2VFDA 1LRQA 1ZNNA 5BMWA 3B03A 2AGKA 2FPYA 3EX6A 3R13A 4JDYA 1WYIA 4OE7A 3G0XA 4N4PA 3A21A 3W1NA 4RX0A 4WY0A 2ZZ1A 4K7VA 3LHZA 2CLOA 5BNKA 6ALDA 3BO9A 1O5XA 4N9BA 3NVTA 4QM1A 3CC1A 1WAUA 1SZNA 1EWEA 1XKYA 3OVPA 1XFBA 4IPJA 1DJNA 3PVFA 4LVAA 2J24A 3TMLA 5EMUA 1QO2A 4R53A 4HPXA 3UWWA 3T44A 3YPIA 5LNWA 2NXGA 2VFEA 5G2IA 4ZL1A 2Y70A 3HF3A 3KOFA 3OG3A 4TR9A 3W3OA 2KZHA 4ICNA 2NX9A 2NXHA 1DHPA 3P8IA 4WOQA 1LRTA 5D02A 4WY0F 3UY8A 5G2WA 4BI5A 3TAKA 2QCGA 1JCLA 3N2MA 5F1UA 4E38A 4PL2A 2QCMA 5C5YA 1DOSA 1KM6A 5FF0A 3HG5A 2H3BA 4J9JA 1J4EA 2HSAA 3S1VA 5K3VA 3HJZA 1LTDA 1JRCA 1OFQA 1RZMA 1SZFA 1TSIA 2V30A 3NYZA 4N4QA 1G7VA 2XFWA 4N6EA 2ZRYA 1VHCA 2C13A 2VFIA 3O1NA 4JN6A 1B3OA 1Y0EA 3MHUA 1FXPA 5KZMA 1XDLA 3L65A 3S1WA 5K9DA 3LHWA 1HUVA 1OFRA 1SO5A 2E68A 3QJAA 4ADUA 2YX0A 3O8AA 1PL9A 4GUFA 5LZLA 1VC4A 4ZQCA 1SW0A 3HBLA 4U4MA 2ZTJA 3GB6A 3C52A 4L4MA 5F2IA 2WSYA 1BKSA 4UFKA 2JKPA 3RNDA 1SSGA 3OIXA 2J9ZA 1KLYA 2QCNA 1IIHA 1TJPA 1GOXA 4CQ9A 1W5QA 3HG2A 2QCEA 3Q2DA 4JTEA 4QQ3A 3CWNA 3PB0A 5G1YA 1XBXA 4JNMA 1OX4A 1EPXA 4N6FA 3STFA 2NX1A 3A22A 1QCWA 3W7PA 3FS2A 3NOEA 3HPSA 2TRSA 5HINA 3KVKA 1MZHA 4LC6A 1D3GA 1OJXA 1H60A 3IIZA 4IOTA 3VE7A 2V81A 3WJXA 3OVRA 3I68A 3T7VA 1OF8A 3ANYA 3FFSA 1GQNA 5I3JA 3W7IA 1GTEA 3EX1A 1KFBA 1DORA 2A1YA 4QIUA 4K7YA 4LOCA 3C4UA 4NQ1A 1JCNA 4PTNA 1QPQA 3W2NA 1GYNA 4N9CA 3C0JA 3V1PA 1WOBA 2RH9A 4K36A 4FXSA 3SY5A 1TPUA 2G95A 4Y8FA 2YFOA 3MP5A 1R46A 3ATZA 1OABA 4RZ6A 3E02A 3TNOA 4KFPA 2GOUA 5FF3A 3CEUA 3QPYA 2VFFA 2CZDA 5HR6A 3LLDA 5FEZA 5LGZA 5AHNA 3EWYA 1KTBA 2Z6JA 3R12A 1H63A 1YPIA 3HGSA 3VI2A 2JGQA 3ZR4A 2NXIA 2X16A 5I3KA 1SU5A 4M6PA 2PRHA 3ABQA 5IBXC 2BTMA 2OCZA 1C9DA 3EKZA 3BK0A 3QYQA 4PODA 1KW1A 3CEPA 4XWUA 4ZQOA 5BRBA 4FX6M 1AMKA 3LHVA 1OFBA 1SO4A 2G97A 3W7CA 2W6RA 1IXPA 3WK2A 3W7LA 1LYXA 5LNSA 4FO4A 4QITA 1KFKA 2X30A 2V5BA 3BLFA 5EPDA 3NPUA 1P0KA 3MP4A 5HWJA 2DZVA 2YGYA 1ZHAA 5HUPA 3O16A 3TQ0A 3C6CA 3DGRA 3JS3A 4MLJA 1ZFJA 3LHTA 4PL1A 3M43A 5DCDA 2Y63A 2YR1A 2P10A 4MJMA 3LDVA 1W3IA 4BFAA 4YCPA 2J27A 5CZJA 1A50A 5F1VA 5K7JA 3HIJA 4BF9A 3L2IA 4DF0A 5CZTA 3C2EA 1VCVA 4JTIA 5CGQA 4I7WA 2WJZA 1KFEA 4MIMA 2QAFA 5EKYA 3W1PA 1WX0A 1LCOA 4UR7A 3TX9A 3LXBA 2W79A 2J9XA 3LLFA 1QPOA 1FDYA 1OK6A 4KFNA 2CLMA 1F2JA 4UNLA 1KFJA 4HPJA 3FEMA 2I14A 3BG9A 3FJLA 5C55A 4FX7A 3GR8A 5LNRA 1UASA 3SFKA 2H3DA 1KM4A 1YPFA 4BI7A 1Q45A 3DAQA 2EGZA 4NZFA 4R33A 5D2YA 3HMJG 3EX4A 4M6QA 3C8FA 3W07A 1P4CA 2RFGA 1DKWA 1JULA 1KV5A 1XI3A 1OYAA 5HUOA 1RQEA 3NL2A 1ZAJA 3P8JA 1JQXA 4UIOA 4UMAA 4KWWA 1TV5A 3G1VA 5H2ZA 4JXCA 4AH7A 3EWUA 5D04C 5D03A 2C15A 3KRUA 4AXKA 1YTDA 2Y7FA 1YDNA 1YLVA 3QQ1A 2P1FA 5TIMA 4O10A 3HPXA 4JIQA 4FNRA 3TK7A 3N34A 3VE9A 4Y9AA 4LW7A 3C3NA 3GZ3A 3KFTA 1OVDA 5D32A 4U28A 3RFAA 4D2JA 2CLFA 4GC4A 4OGZA 2ZRVA 3PUOA 4IXHA 3BGJA 4RXFA 5FF2A 4DO6A 5KTLA 4YLWA 3BG5A 2ZTKA 2XN0A 3L67A 2QCFA 1ZENA 1AG1O 2OX1A 4NX5A 3N9RA 4OHQA 5DCBA 5AHMA 1AL7A 1CX9A 1OYCA 4JYDA 3SI9A 4ZQRA 1Z42A 3E96A 3G8RA 4O0ZA 2YPIA 5E0KA 3W2JA 4NNCA 4S2BA 4NNBA 4I7VA 4ZVJA 3PBWA 1J5TA 2ABAA 3PAJA 4JTTA 4XUGA 3NQMA 1I2NA 3MI2A 1FWSA 5AYZA 3G1FA 4NVTA 3TJXA 4HSNA 3LCXA 4TU1A 3EB2A 3THAA 3HGOA 4OWGA 5CSSA 3W70A 3W7MA 1SSDA 2YXGA 1P5BA 3NXFA 1LRNA 2Y61A 1TPVA 4KWVA 1G4SA 1LM1A 2E5DA 3A5VA 4WXZA 4MJZA 3G3DA 3B0PA 4BWLC 1G7UA 3IIXA 3IIVA 2QJIA 1VYPX 4O28A 1OHLA 4HIBA 4UFJA 3W1XA 1AW1A 3I7RA 4WX2A 3ABRA 3DFOA
chains in the Genus database with same CATH superfamily
4S3DA 3OQ8A 2Z4GA 1PYMA 1GYMA 3AXKA 3P2VA 4AW7A 1YE4A 1E4NA 3PZVA 3SCSA 3NZ1A 3GVVA 3LGEA 3PPGA 3V1HA 1F4AA 4GYPC 5KZEA 3UVAA 5LIKX 2ICSA 5CPTA 1SO3A 3U2EA 2WBGA 1JYVA 1ODUA 4J1OA 3GNXA 4DPQA 4OKDA 1BEUA 4GRSA 5GPRA 1FWAC 4JTJA 4J5NA 8CGTA 3F1QA 4AG0A 4DI9A 3APYA 2VT0A 4RE3A 2HBXA 2DIKA 2UV8G 3P5YA 3FKKA 4KKXA 5DCEA 3MMUA 1Y5WA 1RR2A 3GE7A 3VABA 1DXFA 3OZOA 1LLWA 1WZLA 3IGXA 1XKJA 3R11A 4J3TA 3ZXWA 3P60A 2G50A 1JDEA 2WWCA 3NQFA 3OZMA 1FQ0A 4GKTA 5FEXA 2ZA3A 3N04A 2QEZA 5BOOA 1EYWA 4PMVA 3VCCA 1QPNA 1GJUA 3CZKA 1Z89A 5JQ9A 2ALDA 5I23A 5HMEA 3BMXA 4LVGA 2AAAA 3SRKA 3ARYA 3LPPA 3I4KA 2RJGA 3POCA 1XDJA 4PTWA 1XLKA 1UOKA 4HNUA 5BCAA 2VFHA 3LRMA 2J47A 3CZLA 2DT3A 4V33A 1KV8A 1OT1A 1ZCCA 3HN3A 5DLCA 3MCOA 1JPDX 3KRZA 4GMEA 1XG3A 1UIPA 3GSMA 2WNZA 3DU0A 2VR2A 1E51A 4BK9A 1AQMA 3R10A 1P7TB 2PRLA 3K4WA 3VPLA 5E0FA 4IJCA 3QFEA 4AWSA 5A8QA 1VLIA 1E3XA 4HBKA 3O07A 4RUBA 1E6NA 1FWGC 3UR5A 5CC5A 1O60A 5CLWA 4IZGA 1H0GA 3AICA 4NZCA 4XKYB 3BLDA 3K8LA 1TWSA 3W75A 4IG2A 2VDIA 3LXAA 1BWVA 1MQPA 3WUGA 3TLLA 8XIAA 1BVZA 2QUVA 2RKXA 4X2RA 1MFVA 1Q65A 3T0BA 5FF4A 1XRVA 3CPUA 3VOHA 1HN1A 1R2SA 1R38A 3AHXA 3PBYA 1YDOA 2Y62A 3AJ7A 2VRJA 3QMRA 3IVUA 2NWRA 1OD8A 1RVKA 3VCRA 2FYMA 4WKAA 2H9AB 2IQDA 3T0DA 2ZX8A 3OG2A 3U2CA 3VIGA 3AIUA 3VD4A 4AC7C 1Q2RA 3KTSA 2ISDA 3SUTA 3A3HA 3CK5A 2CBUA 2G3NA 3PPCA 4FXJA 1G69A 3LMZA 4C6QA 3MO4A 2WZIA 3CMFA 4WXYA 1XCWA 5CSUA 3WBWA 4PMDA 1H7XA 1T41A 5A3HA 1FWDC 1VBGA 5DY3A 1V0LA 1UR8A 3KM8A 2BBFA 2VZTA 1PCWA 3W22A 5AZ1A 3OP2A 1PKYA 1EIBA 2Z29A 4GVHA 2HK0A 4A35A 2J7DA 1PIFA 5CAHA 1T99A 3O0FA 3IWPA 5C6MA 1JIBA 3O63A 2J7HA 2ZVIA 1B3VA 2FVKA 5FJPA 3UZJA 3I6EA 3E49A 1RJPA 4I6VA 5K2ZA 3QC3A 2YCJA 2QMKA 5HANA 4CCCA 1H1YA 1QDSA 4LB4A 1CXKA 4HCHA 2HE8A 1BVWA 2PURA 4KPLA 2RDUA 4PBEA 2CZ5A 3GXTA 3LCFA 3B9DA 1UR3M 4IP5A 4O15A 4OECA 4Z08A 4UB9A 1V0MA 3B04A 2AQWA 5HMDA 1M53A 2G96A 1CGTA 4KWOA 3LOTA 1B5TA 3SM0A 1IQ8A 3N29A 5U7SA 3AMLA 4JNYA 2ALRA 3FOKA 4XAFA 3ZSTA 5B80A 2HWGA 5F2MA 3WENA 4J4KA 1FWBC 4IP4A 2W4XA 3Q67A 2V9DA 1B90A 2J13A 1F61A 3QZ6A 1NWSA 1GWJA 1J18A 4QSFA 3NL6A 4HNOA 4NNAA 1B4EA 5DEZA 3PP7A 4RXGA 3I6RA 4XTIA 4C1NA 1N8WA 3QW3A 4DJED 3AIBA 3GIYA 1WOAA 3SSZA 5A6TC 3G24A 2ASHA 3VX1A 4PN2A 1ME8A 1LOSA 4F0SA 1CLVA 1BGGA 3O05A 4E2DA 4IISA 1ZBKA 3NO5A 2ZA2A 1XXXA 4WGHA 1J6OA 3UA4A 3UGVA 4GG9A 3IJ6A 4P8UA 2V8ZA 3WQOA 3N1AA 5A8GA 3H4XA 3W27A 4K1WA 4JIPA 3ZLHA 1U5HA 3CHDA 2D22A 1TJ1A 3LHYA 4JZ5A 1TR1A 5CBJA 3N2OA 1CYGA 2C19A 1S5WA 3VZYA 4HU0A 4Y90A 5C7VA 2PGFA 1JYXA 1CB7B 4TVDA 1FUYA 4QQUA 3UG3A 1HZYA 2XH7A 5BROA 3WBXA 4QAIA 1KCZA 1GGOA 1KTCA 2BY1A 3UP8A 1R9ZA 3VNIA 4DJFD 2PC8A 3N6QA 3KEHA 3KHDA 2PTZA 1TVNA 5I5RA 4DF2A 4ZFCA 5JVLA 3TVAA 8XIMA 3KW3A 4JCMA 4DAFA 1OEPA 3WH9A 4LUTA 1XX1A 1A3WA 4UFLA 4FXFA 3C8NA 4JEQA 3W37A 2DVUA 3PTKA 5FESA 3BOFA 1NP2A 1XIGA 2BY3A 4ROPA 4O11A 1M7OA 4XAYA 3UU0A 3EMZA 4S3BA 1AJ2A 2JEPA 2TODA 5CJNA 1NEYA 5JBEA 4A3HA 1NDWA 5HR7A 3PPFA 4AVNA 1LBLA 3UA3A 4AZBA 3WIJA 3S2JA 4QDWA 4YPJA 3HPZA 1JYWA 4PMXA 4ZO7A 2FDMA 4QGCA 2Z2UA 4GYJA 2RDXA 2BB0A 5D38A 3W2LA 4F0LA 4GI6A 1PS9A 4NAEA 1WDDA 3IJLA 2A85A 4YTUA 4LWWA 4X22A 4HHPA 1GZGA 4YTRA 1B0IA 4AF0A 4A8LA 1W3LA 3O15A 4GACA 1EJTC 3CUFA 3AXIA 3F5KA 1UR9A 3KLKA 2OFJA 2DVTA 1F3TA 1M7JA 3UR2A 4AMAA 3CIWA 3IV3A 5CSYA 3EX3A 6A3HA 3UWZA 3A3WA 1R30A 3TXZA 2X0HA 1XYMA 1WKEA 3WH7A 3MDUA 2PDBA 1V4YA 2WVTA 1HKIA 4LCSA 4UOQA 5ABFB 2CYGA 5M3WA 3REQA 2FMNA 7TIMA 1UJQA 1UH3A 2XFYA 5TQLA 1PIGA 2DSWA 5CJ5A 1AD1A 1T5AA 4PULA 3ITLA 3O6YX 2O56A 4E4FA 3AU6A 3N3TA 1X6LA 5BU9A 3TWBA 2CLIA 1TCMA 2ODOA 5E93A 4HHMA 5D05A 5L6UA 2R91A 1RJQA 3G8EA 3UCDA 3COTA 2DZXA 3L66A 5GNXA 1H51A 5HK4A 2WSQA 4NAFB 1LZOA 5IRPA 1JCYA 3OIHA 2DU2A 3S5NA 4HK5A 4WK9A 1LROA 1MQRA 3VIPA 5LHFA 3U2ZA 1GG1A 3RM9A 1Z7AA 3BAWA 2ZUMA 2FFCA 3WELA 4J40A 4DM2A 2P8BA 4JFTA 4JL2A 3S6OA 3TV8A 2VL4A 3E5BA 3KAOA 1GVRA 3GRIA 1O1ZA 4LT9A 2VCBA 2J66A 3GIQA 4QROA 5CZSA 4UTUA 1E70M 3RF9A 4C6PA 3L2MA 1BXBA 2QDEA 2XH4A 4U5IA 3VOFA 1US0A 4Z2HA 2A7PA 3RMJA 2QCHA 1UROA 4AEEA 3NGJA 4M24A 4E8DA 5GJNA 2IPGA 3NOYA 3W7EA 4Q4KA 1E6QM 1VENA 1LL7A 2BDQA 3LI1A 3V4BA 1W6TA 3QSTA 1MNSA 3L12A 3W1AA 1UMYA 4CD4A 4ERAA 2CCRA 2BX7A 3KDOA 1Q6CA 3UWQA 1KCXA 1R5YA 2XVKA 5C71A 1X39A 3BAKA 1TVPA 2G5WA 2YDQA 4O1FA 1BGAA 4O8AA 2EPKX 3AMKA 5HWMA 4I9MA 1B1YA 4PBGA 3SUWA 2E7FA 4KFOA 1XUZA 2I9EA 2X7VA 3ELFA 2WQDA 4S3AA 4JTRA 3BV7A 3S4TA 1A3HA 2F6KA 1NDZA 4XD6A 5D33A 5D37A 3VGHA 1U83A 3BJSA 1TTQA 4JBRA 4XBJA 3PR2A 4Q8UA 2ACSA 2V3FA 1TIWA 4M6VA 3PC0A 5MKGB 2Z2AA 1WDWA 2Y7EA 2BODX 2ZIDA 1FXQA 1E0XA 3RLGA 1UR4A 1VFHA 4O1DA 5ABEA 3FYYA 1KBLA 3O3RA 1A5UA 1XSJA 2D2JA 3TA6A 3H54A 5JIPA 1M68A 1Y5VA 2ZUNA 3GO2A 4J35A 2QMJA 2NQJA 4MPKA 1RALA 2EJ1A 3F5JA 1PDZA 1O66A 4CLMA 3B9AA 4RK8A 2D0GA 8A3HA 1NQKA 3W1LA 2YCIX 2XIMA 3GH5A 1WO2A 1DXEA 3CU2A 1M04A 1ALDA 3L2LA 3WLQA 3VD9A 3UJRA 2YDSA 1ITXA 5EMKA 3DBPA 2PTDA 4JTLA 5KZ6A 2QJMA 3AWOA 3FA3A 4QJ4B 3WMCA 1I1WA 3M0IA 5GNYA 2ZUWA 3IIOA 3G3MA 3I7QA 4WY0B 3AC0A 4LNYA 4HMCA 5D9PA 1QPRA 4NJGA 3BW3A 3MSDA 4AD5A 4XZ9A 2H90A 4DZIA 5KMYA 1QOQA 3CTLA 4H2HA 1DJQA 1NFBA 2Z6IA 3MYOA 3AMGA 3S2LA 1XCXA 4UFIA 2JALA 2GUUA 2V2DA 3CYJA 1JDDA 3NO1A 1SJCA 2B31A 4LEQA 4JL1A 3GXPA 2F7FA 3KZSA 2DDXA 2Z1WA 5I7GA 3NURA 2X0YA 4CQCA 4HSOA 3SUUA 1WBHA 4FNTA 2GQ9A 3W29A 5I3GA 4IPLA 3VKJA 4AD3A 1EJUC 3B40A 3S0CA 3ZWTA 4LY8A 3ARRA 2G37A 4J2MA 3SJ3A 3UR7A 3FVMA 5C9XA 3WUEA 3W81A 4C5ZA 1E1EA 4WEVX 4UUIA 1LL4A 3CL6A 3L5LA 2V3DA 2W0UA 4JTKA 4O1AA 1MUMA 3QF0A 1T8XA 4M29A 4U33A 3W74A 5BXTA 4US6A 1N55A 3QRHA 4IGMA 4YYFA 1ZBVA 2GPTA 3FN9A 1NJJA 2WJEA 1JZ5A 3AUOA 1X1ZA 3RYSA 1IR2A 3GX9A 4B5WA 1HO1A 1C8QA 4NUWA 4DVOA 1WDPA 4TX6A 1RP8A 1WE5A 3TOYA 3W26A 4REQA 3O7UA 3L7RA 1ISZA 5HOSA 1BSLA 2W63A 1PYFA 4P2VA 2WCSA 3ZR5A 1GOQA 3DFQA 4H04A 3HV9A 4BHYA 3K4DA 4GYKA 1VPQA 2VEPA 4FXRA 3SY1A 1FCUA 1ZU8A 3TIMA 4C90A 2AQOA 1FP9A 1FDZA 3N14A 2NLIA 1P1XA 1PWMA 1R3VA 1QRQA 1O5RA 3GNOA 5REQA 4BKNA 5AFDA 3VIOA 1UKSA 1OC7A 1QPKA 4DJEC 2Q6ZA 4H9TA 3TJIA 2F8QA 2E67A 1EJXC 3TYCA 5F4XA 3MUXA 3V7PA 4TX9A 2DH3A 3UWYA 2A2IA 5G4HC 5LIXX 5A6LA 3M5XA 5D09A 4M3PA 4H8NA 3CAWA 2WV8A 1E4LA 2ISWA 2AAMA 4R88A 1TPEA 3VM7A 3WEOA 4DWSC 4JGDA 3DYOA 3KL5A 3W86A 3VUPA 3ZWSA 1BTMA 2DUAA 3LNMA 3M5VA 1Q7QA 3WEMA 3AQUA 2DPEA 3ZYZA 3MMTA 1ZS2A 4LJ3A 5J5RA 1DIEA 2A3CA 1G94A 3MKCA 2HROA 4HZ6A 1LBFA 4AHPA 5CQ1A 1ZJBA 1V7AA 1JL8A 2GQ3A 4ZCWA 3UESA 3GAYA 4DIAA 4PUMA 3OBKA 2PWEA 3MS8A 3WEZA 1O6IA 1R8LA 1Y8BA 1EJWC 3WUFA 1GW9A 1EX1A 5D2WA 3C3UA 1L8PA 1YDYA 1TFVA 1YE6A 2WKGA 1M7PA 3VXGA 4KEVA 1XLGA 2CESA 1TX0A 2Y24A 3T4CA 2FZ8A 2XM1A 4UCGA 1AQ0A 4E8CA 4LV9A 4MKVA 2FTPA 1X1NA 1J96A 4O17A 3CTTA 4QE4A 4H7CA 2WWDA 1ZP4A 4LAMA 1DIKA 4O8RA 4U31A 5HULA 3GU9A 1E15A 3GU2A 2BS9A 1UWUA 1TTJA 1AODA 2MUCA 3BVJA 4H4IA 1RQBA 4ZZ9A 3UVIA 3K8MA 2Q8ZA 1ADDA 1DVJA 1Q85A 3L0NA 2BSLA 3AROA 4PTXA 5AB3A 4S3JA 4L4PA 2DP3A 3CGTA 5AN7A 1F8IA 2ATMA 3G0UA 5EMMA 4HQVA 1Z8AA 4PSRA 3IV8A 4FI4A 1RLDA 2Y6ZA 1XLDA 3NTYA 4AQLA 1DWHM 4BA0A 1Q4NX 4L5ZA 4JFVA 3H21A 2C18A 3URNA 1KFWA 2D0FA 3DG3A 2QV5A 1GQIA 3L0GA 3NL3A 3ZLFA 4B4FA 1Z41A 3UG5A 1EB3A 3G0SA 3UZ5A 3PUGA 2WZTA 2VYOA 2O4QA 1UKPA 1B9BA 1GVFA 4CEXC 2ON3A 4POCA 4EKJA 2Y8UA 1C8XA 1S5MA 1YRRA 4D1IA 4B15A 3O6CA 4UQAA 3KTXA 1KM3A 1WV2A 3M0ZA 1Y65A 4WJ8A 4HCLA 5FJRA 2H9AA 1C7TA 1WBJA 1PJ9A 1PIIA 2C16A 1EDQA 3UG8A 3V18A 4CNNA 4L64A 4R85A 2E5BA 2XGIA 3S5SA 4MWAC 4Y96A 5FJIA 4HK7A 1V6TA 1YNQA 2Y85A 1MEWA 3H2NA 2VDGA 3UETA 1K9DA 3THUA 1O1HA 1J12A 4KIRA 2YA0A 4S1FA 1C91A 2PD5A 5G5IA 3S42A 2E6FA 3LY0A 1R86A 1V79A 2J62A 3S1XA 2O9TA 4FF5A 3KVMA 3DERA 1GZJA 4AD2A 3LCLA 1HG3A 4UXDA 4N02A 3SQSA 3W2KA 2JF6A 3VA8A 1WDQA 4KCUA 1EBGA 4IX0A 1HX0A 2PU1A 4Y9OA 4OV9A 2GDQA 1L6YA 4XG1A 1A5MC 3ARZA 1E1CB 3TQPA 3R13A 4X63A 4K2SA 4OE7A 2GK1B 3LK6A 4V27A 1US3A 4GI8A 3W1NA 2ZZ1A 2QV4A 3VFCA 5GJMA 2CLOA 1ZJHA 3PAOA 4E4UA 2NT0A 3BAXA 4YS1A 3NVTA 3CC1A 4W8BA 1CECA 1SZNA 4QDPA 3PVFA 1UKOA 3TMLA 4DAIA 4R53A 5LNWA 4F79A 2NXGA 4R9XA 3RUBL 3W3OA 4JIHA 3BMWA 4ICNA 4LGXA 1EDTA 1MXGA 3TAKA 3AHZA 4GVFA 5HA7A 3FK4A 1JCLA 3AIVA 2XFRA 2WHJA 2VWTA 1KM6A 4JIRA 3KBVA 3ARUA 2H3BA 4J9JA 1REQB 1Q6FA 1J4EA 5FACA 2PP3A 2PEVA 3HJZA 1LTDA 1OFQA 4MJ4A 3VD3A 4QTGA 4N4QA 4OBRA 1G7VA 1C93A 3I6TA 5JIWA 1D7KA 1TWZA 4F48A 1VHCA 2BVDA 4H2CA 2C13A 1V51A 3MHUA 4GIYA 1DJXA 4OIFA 4GA8A 1XDLA 2HBVA 2CETA 3L65A 1XV8A 3A13A 2VWSA 2ZICA 1UH2A 1OFRA 1SO5A 1XH0A 3LGDA 3IUHA 2HNEA 1PL9A 5LZLA 1E3ZA 2VGFA 5F2IA 1PB0A 1ECEA 4MAVA 2VX4A 4LYKA 2QUMA 4JOMA 1CENA 2HV5A 1W5QA 3EOEA 1W3KA 3PB0A 2D0HA 3R4IA 1XBXA 3U57A 2TRSA 3CUIA 1RAKA 3B3DA 1MZHA 5CAKA 1H60A 3NCOA 3VE7A 3WD3A 3E2VA 1B54A 2EPNA 3T7VA 3I68A 1VIWA 2A3LA 2QPSA 2WAGA 3AOFA 3EX1A 4NQ1A 4MB4A 3C0JA 3V1PA 1WOBA 3MSGA 3NZGA 1SFTA 2BOGX 4LYRA 1MW0A 1OD0A 4DHGA 2YB1A 4IH3A 2YFOA 3FXYA 2QF8A 1OABA 3PZUA 5CGTA 2HPMA 2OU4A 1E6SM 4MADA 1B3XA 4KFPA 2OEKA 2GOUA 5FF3A 4OUEA 3VOGA 2CZDA 1JXKA 5B7ZA 5AHNA 3EWYA 3VI2A 4AZCB 4LPCA 1ZPTA 4M6PA 5H8UA 1QI5A 1RUSA 5IBXC 4NIRA 2BTMA 1C9DA 3BK0A 2JEQA 3U5UA 4JQ3A 3SCUA 3ZVHA 3LHVA 3LQLA 4YTTA 1FRBA 1LYXA 5LNSA 4FO4A 1TWDA 1CGYA 3EBVA 1KFKA 2X30A 2V5BA 3BLFA 3UZXA 3NPUA 1P0KA 4A3RA 5E09A 2W9MA 3MP4A 1LUCA 3H7VA 4LYQA 1ZHAA 3JS3A 1ZFJA 1GHSA 1GOMA 2MANA 3T08A 1QNOA 2OO0A 1DJGA 4Q8TA 2X8RA 1WDRA 4R27A 1W3IA 5F1VA 4ICCX 2PBOA 3C2EA 2VCCA 4I7WA 1EJVC 1KFEA 1I6NA 2DIEA 2Z28A 4MIMA 2QAFA 3W1PA 1WX0A 1LCOA 4UR7A 5HDRA 1KWKA 1FDYA 5FL1A 4KFNA 4AY8A 3ZVIA 3UF9A 3CLWA 3EPOA 3AU2A 4LNCA 1TV2A 2WW5A 3TYDA 4NILA 2WJFA 3LS9A 4Y8EA 5C55A 3L23A 1KR0A 5LNRA 1UASA 5D4YA 4RZBA 3SFKA 1KM4A 1YPFA 3LQGA 1B3YA 3DAQA 2NSXA 4NZFA 3JU2A 4R33A 1CXIA 2VDHA 1IWAA 1EF3A 3EX4A 4M6QA 2VQTA 3W07A 4GPNA 1BQCA 4R3UA 2RFGA 2HISA 2NW0A 3N4AA 1OYAA 1POJA 1RQEA 1O5QA 5HUOA 3F4DA 1ZAJA 1JQXA 4V1YA 3M0LA 1R3SA 2WVUA 3WCZA 4JXCA 4AH7A 1OSEA 4ATDA 5D03A 3KRUA 3E3HA 3QQ1A 5TIMA 1UUQA 4FOKA 4JIQA 3TK7A 3C3NA 5J8LA 2OQYA 3KFTA 3RFAA 2WYSA 4ACYA 4GC4A 1YW1A 3OLGA 4PMJA 1U2YA 3V36A 4FLSA 1S2VA 3W53A 2BVWA 4W8AA 1MVYA 1FH7A 4FOJA 1ZENA 1D8CA 1AG1O 1EFZA 2REQB 3MZ2A 1ECQA 3T0CA 2ZDSA 1QJWA 1JEZA 3VUSA 5LXEA 1EJ7L 2GGEA 1KRBC 1Z9AA 4S2BA 5BXSA 4JPGA 2GL5A 1I2NA 3TN5A 1FWCC 3VU2A 2WCGA 3AMDA 2NVCA 2YCLB 1S5NA 4D6GA 3RGTA 1XISA 2PDKA 2NLYA 3PTDA 4D6JA 1V03A 4AXNA 2QIWA 3W70A 1DPMA 3EOUA 3TC3A 3ANUA 3OGSA 2A3BA 1UPPA 3UYIA 3B0PA 3IIVA 1VYPX 3VKCA 1OHLA 4UFJA 1AW1A 4WX2A 3V3WA 4LANA 5CSRA 4KGJA 4OQVA 4IMCA 3S2NA 3KOXA 2YBUA 4Z42C 2R82A 2HVOA 3HFTA 5EL1A 2V5JA 2WNNA 3P61A 1EHNA 3EXTA 4MJ2A 3NQ2A 3UJFA 3K1GA 3B8VA 3NDZA 3LRKA 2OT1A 4IQEA 1VCGA 3A5FA 2YCEA 1E1FA 3SIMA 4XBKA 4E5TA 1PZ1A 1RPKA 1YX1A 2PDNA 5CG0A 5GQBA 3H4GA 4GUGA 1AW2A 3Q37A 2D20A 2Z00A 1WNOA 2AQVA 3APGA 3RU6A 4OOUA 4DB7A 3F4WA 4YL2A 4I90A 1XBZA 4ROQA 3LZ5A 1EXBA 4GCXA 4LVDA 4ONVA 2CXEA 5DBTA 2VEFA 1TWIA 1W1B1 1WKDA 1FWRA 3TZFA 1ZBWA 3TSMA 3EA2A 5CPLA 2QVNA 4MFEA 4WZHA 4I9AA 4WD0A 1JD7A 4FEZA 2J7CA 1ME9A 2PWVA 1F5ZA 3SCQA 1EP1A 3FHQA 3W88A 1ZSXA 1QNPA 1YBQA 4GI4A 2WLZA 5LNVA 1UMLA 4BY3A 5IHSA 4UTMA 2PGWA 4L4OA 4QXIA 1OF6A 3ARWA 2XUCA 1GG0A 3G1YA 5BW6A 1DL3A 3FKRA 1KXHA 1UIOA 1AJ0A 3IUIA 4NYUA 1VCFA 4B90A 1SQ7A 3QQ0A 1XIMA 4INFA 3FDKA 3GG8A 2BGNE 1A53A 3S47A 5EBUA 3DC0A 2NT1A 4GUJA 2ZZ4A 2JQXA 3LEPA 2WC7A 4PRRA 4QJ5B 4GNVA 2XU2A 4D72A 5C70A 1XD1A 2OJPA 3AXHA 3BANA 5A8NA 4IWWA 4YVPA 1QMLA 5K9CA 5H91A 3KP1A 3WNOA 5SWUA 1BYBA 1WCGA 4HNVA 2OSYA 3F4NA 2VKZG 2O7QA 1WAWA 5U4NA 4U2YA 1A49A 3CL8A 4PMNA 3JW7A 5IFPA 2IQTA 2PWGA 2VEKA 4ZE4A 1KBKA 2ABBA 4DN1A 1CPUA 3HB9A 4H9VA 4M7SA 1DE6A 3VFLA 5HXMA 5ABTA 5D9OA 4H6QA 3CUHA 2DSZA 2ZCGA 1XLAA 2V2CA 2R9RA 1I0BA 2B7QA 2VRQA 3QPEA 2X2GA 3W1QA 3LN3A 5A2AA 5GNZA 2B81A 4B91A 3A23A 4JN7A 4LUJA 2F6UA 2J8TA 1N8FA 2OB3A 3MBDA 3A4JA 4AIUA 4DF1A 2VD9A 3NQ8A 3MUY1 4NZ5A 1XG4A 3LA4A 1VS1A 1M9HA 4LYPA 4FIQA 2YIHA 1X8CA 2DSVA 2YOCA 2G3FA 1P1MA 2DT0A 1XLBA 5LXXA 3H8AA 3UGRA 5I02A 4KT2A 5DX7A 3L4YA 3ARSA 4AY7A 2CKRA 1UC5A 1BRLB 1PXGA 3DI1A 4ZOEA 4L65A 3WF3A 4MKSA 3NA8A 2FZNA 3XISA 4D6IA 1BAGA 1L6FA 3OYZA 1PZ2A 3BSHA 3H7RA 4IIHA 4MTVA 1KGUA 4WJEA 4RV3A 5B7YA 2X7WA 4BI6A 1C3FA 5DRIA 1GEQA 4QP0A 3U7BA 4FLRA 4RE0A 1UZDA 2WM1A 1XM3A 3RO8A 4AD4A 3PY2A 4ATLA 5E1QA 2CEQA 3GDMA 1HFBA 3GD6A 4I6KA 1J0KA 5T8GA 4TVCA 1ZB5A 1HKVA 3UZWA 1GVQA 3QR3A 3W25A 4UQBA 4FR1A 5DMLA 1W17A 2XYLA 3L4ZA 4CCZA 3WJZA 4DX3A 2G3IA 3PS7A 4A8IA 2FJUB 3FYPA 3WZ0E 3IJ7A 8TIMA 3OLDA 4TMCA 4IJRA 3QTPA 2OT0A 4O12A 1SYTA 4HCDA 2Y5JA 3VMPA 1DIOA 1CLKA 5PTDA 1DJIA 2ZFAA 2CLKA 2VZUA 3SN0A 4AMCA 3FNDA 1ML1A 1Z32X 3U3HA 2ACQA 4M56A 4WKHA 3KWSA 1L6GA 4IPNB 3OJGA 1K7FA 1W5OA 3B06A 5CZ0A 5EFFA 2W62A 1LQ2A 1S3TC 1AH0A 1CGXA 3WQ6A 2OEJA 2XGBA 3T2QA 4W9TA 1J0YA 2XSBA 4MKNA 3VDBA 3NIYA 3QHNA 4DYJA 3KOYA 3RG6A 4HNCA 1E55A 1K77A 4GYPA 1NU5A 2BHZA 4DUOA 4GIRA 2A7RA 1JFHA 1FVPA 3ZMRA 1UUOA 2EXOA 2RAGA 3S83A 4ML4A 3U9IA 1R6WA 5M17A 5AVHA 1EC7A 4N9DA 5CGMA 1K7XA 3KE0A 2EEXA 1W9BM 4MY1A 2E0PA 4FPSA 4XVEA 3VIHA 1PZ0A 4YIWA 1XS2A 3KZPA 3CH9A 4ZOAA 3W7HA 3DHDA 4LS0A 4Q7BA 1UWTA 4ZBCA 1W3JA 3M9YA 1XRFA 2XTKA 1RD6A 2E6YA 1PZ3A 3TP4A 2HEJA 3CH0A 2BFGA 1MYRA 5E70A 4KW2A 1KTNA 5M2FX 2NV9A 2L5HA 4XZMX 3ITXA 5DELA 2VEIA 4HD5A 4AX6A 3W0KA 1HP4A 4RDZA 4BQ4A 2W67A 1E9YB 3DHUA 3QN3A 3GKAA 5LGXA 1LORA 2GYIA 1TA3A 2WVVB 3NDYA 2A5HA 4Z2IA 2ANUA 3NVDA 5BOEA 1A5SA 3EWDA 3VGDA 4MFDA 3PBMA 4JFSA 4V1XA 5DQPA 2Z0IA 5G4EA 4N0RA 4V2XA 2VGBA 1X98A 2PCQA 4ZO8A 4XAZA 4W87A 5KINA 4M5PA 4LFYA 3AO0A 4S23A 4PSPA 1TJRA 3B8TA 4JHZA 1OCNA 3CHFA 4JTHA 4JAWA 3KTCA 4JQ1A 3FJNA 1AZ2A 1BYDA 4PUWA 4TVUA 3T4WA 3PULA 4ZODA 3QZAA 1J0HA 4O18A 4BQ2A 4DEFA 5I79A 3N2BA 2GQ8A 2WK2A 2R94A 3EOOA 6PTDA 2PPGA 3JZEA 1TZ7A 3BLOA 3PFMA 1TV4A 3N12A 4PUNA 1PTDA 3RRXA 4CNTA 1CCWB 2XINA 3KRSA 3BZGA 4UTLA 3UD6A 2I5QA 3ALGA 2BLEA 3FCPA 4ZR8A 3C2YA 3W7GA 3QGAC 2FVLA 3OGRA 3Q65A 4ZA0A 1A0DA 2HRWA 3WMLA 3EWZA 4ZQMA 2BZNA 1TTIA 4O14A 1UD4A 1W8SA 2A21A 1KBIA 1H62A 1BLIA 5D30A 3WDJA 4LAZA 3G1SA 4UC5A 1W9VA 4P7OA 4M1RA 1UBSA 4A6GA 1IZJA 4RLIA 5H8MA 5LSMA 4R7JA 4C91A 3FA4A 1UOZA 3H24A 3TW6A 2J88A 3SAZA 3TH6A 2EF9A 1RLCL 3H4WA 4JQ2A 1FWWA 2XIBA 3QV6A 4DO4A 2V5DA 4MWAB 2ONEA 3P82A 3ID7A 2IW0A 4A22A 4EOUA 2ZKMX 1UG6A 1N2VA 1W1TA 4XVDA 3GVRA 3VKBA 3GHTA 2V0TA 4Q7IA 1UP3A 2DQXA 3BARA 3WLJA 1KQYA 1A80A 1N82A 2XIJA 2R1KA 2AL1A 3W82A 2JKEA 1R0MA 3RAOA 4GO8A 1E6PA 3N4EA 4OZOA 3GKFA 3UW6A 4EXBA 2HTMA 1H0IA 5I3FA 5LKYA 4KWUA 5BXPA 1MEIA 1MW3A 4HNNA 1GCYA 3N6HA 1PX3A 1IEVA 3VOIA 1XW8A 2XJ7A 1VRXA 4W4QA 1OZMA 1ONRA 2FTWA 5MF5A 1LOQA 3GHSA 1FWIC 2QIIA 2P3EA 3SN4A 3SCTA 2IS7A 1OFPA 4KRZA 1CEOA 4PEEA 3PWIA 3GBDA 2BVTA 4PMYA 4NZJA 3QOMA 3M0VA 4GIEA 3UXIA 3QR0A 2A3HA 4ORIA 3DFSA 1ZTVA 3WBYA 3DFYA 1KFLA 4ZMGA 4RJEA 3EZ4A 3EDEA 1PSCA 1XYLA 1R3WA 4L6OA 4WIWA 2CXGA 3CQ0A 4LH8A 3UJ2A 1UD5A 2F84A 4Y6GA 3TTSA 2C1GA 3CT7A 4US5D 3MUIA 3RK8A 3AYVA 2GVLA 2WNWA 2QPUA 2WC3A 4NSBA 1VIZA 1BYCA 2ISFA 2Q3OA 3H2AA 3HGJA 4CNUA 4AAJA 2Q8LA 4LUYA 3CV1A 3WQWA 3GC5A 2FPVA 3TTOA 1TYGA 3GAKA 1GVIA 3PZMA 4ASTA 1W2VA 1R47A 2WSPA 4ERGA 2CLHA 2G41A 2DORA 5H1WA 2INZA 1REQA 4K8GA 1K8CA 3VIJA 3F7JA 4O1EA 4F40A 3BLLA 4YVVA 4CQDA 1YADA 1JCMP 3OVGA 1ELSA 2OVLA 3A12A 3AIRA 2DZAA 1O5KA 7CGTA 3II1A 3TYEA 1VEPA 1ZQ5A 3OLIA 3QBUA 1ODZA 3KVJA 4Z1YA 1Q3NA 2CNCA 3WD1A 3GXIA 1JFXA 4PUDA 3UXAA 3MWAA 4IX2A 2DZTA 5DN1A 4MNMA 3A4XA 2CLPA 3I4EA 3E2SA 5I3HA 4E4PA 4PTMA 4LTSA 1V6YA 4OOZA 3H2OA 3M6YA 3T07A 1NELA 2QAPA 1DQUA 4ZGYA 5EU9A 4A8NA 4PMRA 3OA3A 3D47A 4B9ZA 4UWMA 2DVXA 2O9OA 4GBUA 4UFHA 2R1LA 4WSKA 1M01A 3LD5A 3W7JA 4IUGA 2FB3A 2DSUA 4EWJA 3P62A 5BZAA 5XINA 2E6DA 4HVXA 4HZMA 2D3NA 4P8WA 1XIJA 1UWRA 8RUCA 1LQAA 3S1UA 3JZUA 2PP0A 3QY7A 2WLYA 2ZUUA 1OBAA 2RDWA 1YYAA 1C90A 1ONXA 1XPYA 4EPBC 3VGFA 3BXWA 4GX9A 2G8ZA 2GJLA 3MWCA 1TB3A 1NM9A 2G0WA 1A4LA 3EDFA 3KOWA 3DKLA 2XSXA 2NV2A 4ADTA 3SN1A 4PUUA 2WKJA 2J74A 3TJLA 4XZWA 3DZ1A 2YA1A 4HK6A 3ABOA 4A3UA 4PBFA 4AZCA 4K8EA 4W5ZA 4O52A 2WANA 3HQPA 3CV6A 3H53A 4Q4MA 3EWXA 2B4GA 1XQLA 3RU8X 1S2AA 3ZT5A 1MZRA 2H6RA 3R89A 2NX3A 5EB8A 2Q8XA 3H26A 1TVLA 4NT0A 4L80A 2V6AA 4ICMA 1T96A 1XD0A 4ENLA 4HOXA 1VYRA 3SO7A 2GSEA 3BCFA 3G6MA 4KEZA 2XN2A 2YW4A 5G2HA 3TU9A 1HL2A 4A3QA 4RZ4A 3TN3A 3RLHA 1FWNA 2HS6A 2QPXA 4JICA 4FLQA 4UNIA 1WPCA 3G18A 4J2PA 3H22A 1V0KA 4A4AA 4H8VA 4IMDA 4K39A 1B9ZA 3K8KA 4MSSA 4K8HA 1DBTA 2WQPA 3CPRA 4M80A 3VTRA 4GQGA 4NJHA 4DRSA 3ECQA 4QLLA 1O7AA 5C2CA 2YLLA 1QK0A 2G3MA 2B7PA 4Y9NA 3MP3A 2E9MA 2VVSA 5HNTA 3UZYA 4FNQA 1NF7A 1XRTA 4I5RA 3HMCA 2V82A 3SCNA 4XZHA 3LPGA 1M65A 1A4MA 4L9ZA 4C6EA 4N9EA 4AIEA 4RL3A 4EACA 4JIEA 2ZXDA 1R85A 2VXNA 1OGBA 3G6LA 3V5OA 3SUVA 3W1TA 3TNBA 1XYCA 1UUMA 3B0VC 1JRBA 3HA1A 4GQBA 3W24A 3OQEA 1SMDA 4UCFA 1JPKA 4AHOA 1UP2A 1OINA 3UXKA 3W73A 1CNVA 4JS3A 4QEHA 3U2OA 2PZNA 4FMVA 4RW5A 5AKQA 2P50A 2QCDA 4UTJA 3VKAA 3CHCA 2GGIA 4ACZB 3DBNA 1UWAA 1JUBA 2PE4A 4GJ1A 1RPXA 2V3GA 2XIQA 4WVXA 3ARVA 1QNSA 2PDLA 3CB3A 4G8TA 2DZSA 1FHLA 2WMGA 2OEMA 1OCQA 3VDAA 3LHUA 2Y89A 5FAJA 2XIOA 3CZ8A 1CGVA 5JXQA 1T0OA 1M3UA 1OIFA 3E9AA 1ADSA 4YWIA 3QH2A 2PF0A 3ZLGA 3PSVA 1MUWA 2PSNA 2ACUA 3A47A 1W3TA 3LV5A 4IQJA 5HNUA 4QNEA 4XZLX 1E9ZB 1RK6A 4GFSA 4DQWA 2GJPA 3U4FA 4PA8A 4HTYA 5I03A 2GGHA 4GC3A 2OWCA 3KBWA 3W1UA 4FIRA 4DBUA 3BZJA 1WXYA 3CAQA 3UWUA 6CGTA 3T40A 3ZM8A 4WR3A 3CS2A 1YDVA 1JAKA 1JG9A 4J28A 4CNPA 4ERIA 4PR4A 3GNDA 3SQLA 1MXDA 4XIAA 3ORWA 2GQAA 3W83A 1K3UA 4GXMA 4XZNX 4R7WA 2A0NA 3T55A 1X6UA 1H7RA 1TIMA 1P6BA 4UQ9A 3BOLA 2CKSA 3PN8A 4OUIA 3ZJKA 4G7FA 3OVQA 1JUKA 4QJ3B 3U5YA 3LBMA 1FDJA 5AC8A 2VD8A 1B3WA 3M47A 4ES4A 4Z1BA 5D2TA 4C65A 3GNNA 4LVBA 3IVTA 4Q22A 4IPIA 5ABHA 2PLJA 3NR0A 2PB1A 3FGCB 1PKNA 2GFTA 3GR7A 4B5TA 1GKRA 3DFPA 3NZQA 3E5PA 3WL0A 3MC5A 1R2RA 2XISA 3GDRA 2YYTA 4JTSA 3FSTA 4GNJA 4IL2A 1LP6A 3NEHA 4A29A 4LF2A 3PJTA 4Q4QA 3HTWA 4IIBA 3R43A 1UA7A 1HGYA 3N6JA 1VGAA 2OLAA 4D6DA 3FDGA 4Q8OA 1V5XA 4O1CA 3W02A 3GS6A 5D8WA 3M07A 4MM1A 4HMNA 4ZTXA 4IP7A 3SRFA 3SEPA 3TN6A 3TTEA 4PMQA 2RGMA 2XVGA 3DKJA 5A94A 3SCOA 2D1ZA 5DXYA 1KXVA 2YXXA 1LOLA 3T42A 3N3MA 3GNPA 3QKEA 3RPMA 4AYSA 3WQVA 3WQEA 3OOQA 2PDJA 1ZALA 3LNPA 3PNUA 3RLUA 2HNHA 1EJRC 4PCNA 1K8XA 3EMQA 2NZLA 4J3SA 3BICA 2FJKA 1UWQA 2BGSA 2OZTA 4Q6JA 3KCOA 3NM1A 1TRIA 4DJDC 3WX7A 3PM6A 1KB3A 1HIZA 3GHRA 3K2GA 2C1HA 2PA6A 2XPKA 1K9EA 2D23A 3ZS4A 4QDMA 3VMNA 2WCAA 3P3BA 4R34A 4LUSA 2BOEX 3P80A 3EWWA 2UY2A 2ZRXA 1HXJA 3MUZ1 4FHAA 2EG7A 3QMSA 3O2LA 1DQXA 5I09A 4IJBA 1N8IA 2VZOA 1XYZA 1KXQA 2CHRA 4IXXA 4H19A 3CM4A 1V08A 2NUYA 3VK5A 1G67A 3GC2A 4C6DA 4PMUA 2AKMA 3RHGA 2Z1BA 3BLEA 3RR1A 4GABA 3AZRA 1B2YA 3RJYA 3EEGA 3P7YA 3ITGA 2JF7A 1NWTA 3THQA 3D5HA 4C5YA 4Q4SA 1EWDA 1YXYA 1Z6KA 3STEA 4ZB5A 1HJQA 3WNNA 1ISYA 5FOOA 2IQ0A 3AYRA 2WMIA 4C1KA 3HOJA 2FB2A 2CZVA 1FA2A 4G56A 5F4SA 3RXZA 1EQPA 1C7SA 3HPFA 3BE7A 1QW7A 2I57A 1GPWA 2FTYA 4H9YA 2BXZA 5A2BA 1OFEA 1CBGA 3FIGA 4LX4A 2YSWA 4KRTA 4GCAA 4B5VA 4RPPA 3TAOA 3VILA 1SJAA 4CCDA 1VZWA 2VEMA 2ZYFA 4AIOA 3K30A 4IUOA 1W1ZA 4C6MA 2EPLX 1VLWA 2VX5A 3MYPA 4EVZA 4JYEA 4YWSA 2VFDA 1LRQA 5BMWA 3B03A 4C6KA 3ES7A 2C8NA 5FCZA 1XLIA 1H5VA 4C6NA 3C5QA 5F7UA 3G0XA 3A21A 1V93A 3B9EA 3I3BA 3OLEA 3AALA 3H23A 4G6CA 2AKZA 1JPIA 5BNKA 6ALDA 3BO9A 4QM1A 3M0HA 4E8GA 5FAGA 5A8OA 1E4MM 2VM8A 1NDYA 1XFBA 2DY3A 3A4WA 4AIBA 2J24A 4KESA 4HPXA 3T44A 1IV8A 3IAPA 5G2IA 4WSJA 3KOFA 3KL3A 4TR9A 1DHPA 1J0JA 4DJEA 2ZXBA 4WY0F 4G7EA 2O9PA 5G2WA 4BI5A 4J3XA 2DT2A 3LLXA 4QS5A 3R79A 4U3CA 5LA0A 4PL2A 1J0IA 2QCMA 5C5YA 1DOSA 3RIKA 3DN5A 3URAA 1IEWA 4GH1A 2ZC1A 3TZNA 4XSMA 1Q63A 1DIDA 2VVNA 3S1VA 3UFYA 1YQ2A 3CBWA 3M0KA 3NYZA 4NF7A 4C7DA 4W5UA 4DWSA 3VNYA 1FXPA 5T9BG 3DG7A 3P6LA 4GI9A 1J9YA 1UKTA 1HUVA 2Y8KA 1MMFA 4H8HA 2E68A 4ADUA 3RMEA 3PJUA 4GUFA 4H01A 4ZQCA 1SW0A 2FGZA 5CC7A 1E6ZA 1IEQA 4UFKA 2JKPA 3EDDA 1D8WA 3EDJA 1BF2A 4IG2B 3WN6A 2J9ZA 3WF1A 1IIHA 2NQHA 4JTEA 5TD4A 3U4AA 5BRPA 4DJFA 1MDLA 4UQEA 2PODA 1RCXB 3KVKA 4C6BA 3WDPP 3DESA 4UOZA 4RW3A 4JFUA 4LC6A 1OJXA 3IIZA 4S3KA 4XD5A 3D3AA 3OVRA 3ANYA 5I3JA 4W7VA 1KFBA 2A1YA 2WVVA 1JCNA 4PTNA 1QPQA 4HU8A 4N9CA 3N25A 2RH9A 4K36A 4FXSA 5IOBA 3UERA 1XIEA 3SY5A 4AY1A 2IKIA 9XIMA 4Y8FA 3WL1A 3PZOA 1JZ3A 1V3MA 3B8SA 2CHNA 2E25A 3E02A 3TNOA 2SFPA 1JD9A 1XFCA 3ARPA 3VGEA 3CEUA 1OWQA 1A5NC 3PJWA 3ITTA 2FFIA 5EMLA 1CT5A 2E8ZA 2J7FA 1H63A 2HE5A 2NXIA 3ENLA 2PRHA 3PTMA 2OCZA 2E9BA 1QI0A 1TZZA 3QYQA 1KW1A 5BRBA 3N18A 4FX6M 3EPNA 1SO4A 2W66A 2VZVA 3W7CA 3B8UA 1IXPA 3GVWA 3KS5A 3W7LA 3HQOA 4QITA 1GOWA 2VGIA 3PTQA 3QGVA 3C0LA 4H8UA 4LXFA 3AI0A 5HWJA 2YGYA 4MNJA 1OZQA 5HUPA 3RN6A 3TQ0A 4X9YA 4H1ZA 2DIJA 5ECVA 1CXHA 3LHTA 3AAMA 4MB1A 3DCPA 4FALA 3M4HA 5DCDA 3UG4A 2YR1A 2P10A 4FSAA 3LDVA 2IPWA 1A50A 5CZJA 5K7JA 3WLLA 1KRMA 1BTCA 1PKLA 4Q4PA 1K70A 5JMUA 3W6MA 4QX4A 4PMZA 1VCVA 4NP7A 1JAEA 2YL9A 2J8FA 5EKYA 4DWSD 1OC6A 2FHBA 3TX9A 3LXBA 2J9XA 1QPOA 4XD3A 2I5IA 4QG6A 3KOZA 3MKKA 3TYZA 4UNLA 3KCLA 3FEMA 3HFYA 4CU8A 3BG9A 5I00A 3OHMB 3TA9A 4FX7A 4AX7A 2AMGA 4MWAA 1W9PA 2H3DA 4PB4A 4BI7A 2EGZA 3DYPA 5D2YA 2CITA 4HJFA 2PDIA 4BJHA 1G5AA 2J6VA 3D3FA 3M7SA 1NFPA 1VFLA 1JULA 1KV5A 1CB2A 1F07A 2CC0A 3IACA 4UIOA 3EPMA 2I17A 5E9AA 3SCVA 4YVXA 3WQFA 3NYDA 5AECA 2XZ7A 1E4IA 1LWJA 4XD4A 1XLFA 4Y9AA 2WSKA 2X40A 1G0CA 4XV0A 1QWKA 2ZRVA 4IXHA 4YLWA 4EANA 2ZTKA 2XN0A 3ARTA 2GJXA 5HPCA 3N9RA 4FOUA 4OHQA 3AFBA 4QAWA 1CX9A 1J79A 1XINA 4G5DA 3SI9A 3VC5A 1E40A 3VIKA 3G8RA 4O0ZA 4XB3A 3W2JA 4I7VA 5H6HA 2ABAA 4JTTA 3NJ3A 1I75A 3NQMA 4LY4A 2CHOA 4ZE5A 1WZMA 4AZ6A 4NVTA 5TF0A 3E38A 3KUMA 4LBRA 1DYSA 3ABXA 4HSNA 3PZIA 3THAA 2PZ0A 1I9CB 3GIPA 4OWGA 2PDXA 1DE5A 4HZ7A 1SSDA 2WXDM 3A3XA 1P5BA 1LRNA 2Y61A 2IPJA 1TPVA 3SFWA 2E5DA 4BWLC 1G7UA 2QJIA 5JH2A 4GYFA 2PTWA 4O28A 2IUZA 4HIBA 1L0PA 1J8VA 3ABRA 4HN8A 1O4UA 4FK9A 5D9MA 3N19B 2RDTA 2XFFA 3AS1A 2INFA 4KERA 4LUTB 3EEZA 5JBDA 2VMFA 5L9FA 3MPGA 4L9YA 5BYWA 1GONA 3QV9A 1M1BA 3BWWA 1KNWA 2FPTA 1U1JA 4ZQNA 1IGWA 3JR2A 3H2EA 1HNYA 3U6WA 1W1VA 1IIGA 1UWSA 3MV01 2BASA 3TR9A 3VKKA 4KEMA 2D24A 1DJWA 1BG9A 4E2OA 2VJXA 2VRKA 4MWAD 1WA3A 3WYZA 3ARXA 2NV1A 2QR6A 9XIAA 2WOQA 1TV3A 1PDYA 1WDSA 3NUKA 3AWNA 5CPOA 1KGWA 4K6AA 2A4AA 4PFMA 4NAEB 1GVOA 1LLZA 2Y5SA 2OXNA 4O4WA 1D2KA 3G2GA 2A7NA 2HDJA 3EXSA 3GM8A 4GX8A 1A0CA 5XIAA 4DZHA 3GG7A 4UTWC 4AF0B 5AOUA 3W76A 1KM0A 2PLKA 3LBOA 4GFIA 5E0CA 1UHVA 4EP8C 4PCPA 2QVHA 5ECUA 5ENLA 3CV2A 3W7OA 2VC7A 2WMHA 3BGGA 1ITQA 4H6KA 4LVFA 2F38A 3BSMA 1VPXA 1L6WA 5A95A 3ONCA 1TWWA 4NG3A 2EAWA 3P81A 3PWAA 4WDTA 4MYXA 3M0YA 4F2BA 2PI6A 3R7MA 1B57A 1FTXA 1EF2A 2DSKA 3MA8A 3REQB 3SADA 2ZC8A 2J6XA 1JDFA 3AIQA 9CGTA 1WUEA 2QUTA 4MG4A 1H7OA 1B3ZA 3ATYA 1TX2A 3TFXA 5IBXA 1BD0A 5J04A 4H9UA 5DY2A 3FA5A 1RCOB 4LALA 4DO5A 6REQA 4A2RA 3O6DA 5LHEA 2HPIA 5FKYA 1CXEA 4O57A 2WC4A 3CB8A 2POZA 2HVMA 3VVGA 1QHPA 5K4XA 5HMSA 3N2TA 4WOZA 3A24A 1KA9F 2PP1A 1IZKA 5DF0A 4DI8A 2IMRA 3B4YA 3I3EA 4DNMA 3WJWA 2W61A 3OBEA 3WQDA 4LBSA 1AA1B 3N9KA 2W5FA 1PCKA 5KETA 3SRHA 1SJDA 2Y7GA 3STPA 1W5NA 1YNYA 4ORMA 3RX4A 3UNDA 2DGAA 5FF7A 1EXPA 3TC6A 4KCVA 4DXVA 1XPGA 1XSKA 5AHFA 3R8RA 1XLEA 2ZX5A 5LYRA 3WF2A 1NTHA 1U1UA 1V02A 1XCFA 4AFYA 3LPFA 2WVSA 4UTTC 2GVJA 4L4LA 3H70A 2YFNA 3GVGA 3QOKA 2BXYA 5CC6A 3PF3A 3WNPA 3VDCA 2GOKA 2C7FA 4XQ6A 3WBAA 3TSDA 1KCLA 3VCNA 4Z1DA 1FH9A 2J79A 3W2MA 3HG3A 3QY6A 3G5EA 4GVGA 1SR9A 3QVQA 4DY1A 4BF5A 3MHFA 3T78A 2WSRA 2QXWA 1I2PA 2WMKA 4F2UA 4FF7A 1QXLA 3HQNA 3XIMA 3M64A 2PWFA 1NF0A 2OMAA 1I60A 3FAXA 3KDNA 3S1GA 1LQ0A 2BY2A 4P7LA 1VJSA 2WPBA 1OGSA 4GINA 4U5KA 5DO8A 1DP0A 3HGRA 3R1ZA 4CN1A 3CO8A 4E2VA 2Z1KA 1JZ2A 4MVAA 1T7LA 3INPA 5E9XA 4JD4A 3GTFA 2J9YA 1DV7A 3VM5A 1Q6LA 1SZEA 1I45A 3HQ1A 5D2VA 3CAVA 3EWBX 4H7ZA 1EO5A 3N9SA 3QW4B 3CIVA 3JRKA 1XF0A 5JH1A 1MEHA 2QNEA 4GY0A 1PX8A 2P5NA 3W87A 5HQMA 6TAAA 3WD2A 1G01A 3TROA 3W72A 3SIZA 3MW7A 5IXEA 5HATA 4ML9A 3LB0A 1KM5A 1G4TA 4LCRA 4CEUC 4MAZA 3MVIA 3N73A 4TQTA 3TW7A 3KXQA 3IIPA 4JTCA 3TOPA 1H1ZA 4DELA 4E6MA 1TPC1 4F8XA 1Q13A 2IPFA 4B9YA 3PWGA 1KR1A 3BAJA 5MHBA 5AHIA 3F2BA 1TJ0A 3WLPA 1IEXA 5AC5A 1AH3A 1E0WA 3W7RA 4IMGA 3ARQA 4M82A 1FWFC 4IFKA 1PHQA 2CW6A 3AXXA 5F2LA 3OW1A 1FKWA 3T6CA 3NZRA 3OYXA 7REQA 4LC8A 4MZ1A 3MU7A 4PCSA 2VC6A 4YHGA 3RCNA 1EL3A 4DWDA 5BWAA 1EIXA 1MFUA 4B3LA 1TE6A 4L6DA 2A79A 2ZZ6A 1FWTA 3H12A 5AC7A 1TJ2A 3QEZA 4MDOA 4HHHA 1J2BA 1XIHA 3KRBA 3SJNA 1J2WA 4V15A 3SECA 3MCNA 5DXXA 5D2XA 1OX4B 1JZ4A 3DOPA 4TUFA 2ACRA 4GUIA 1JPHA 1F05A 3WQGA 3U48A 2XH2A 1UWIA 4H9XA 1OYBA 1H7PA 4M0XA 1WKFA 3S3GA 3RM4A 3VGGA 4MLRA 2DUXA 4Z2KA 1F9CA 3TYUA 2V67A 1V8EA 4NI8A 3CZEA 3F4CA 3BJFA 3R58A 3NM3A 1HJVA 2J7GA 3IRSA 3CZGA 3DC8A 4PUJA 2XDFA 4J3VA 4QISA 1EA9C 3QKZA 1ZP3A 2BHUA 1UB3A 3PZ9A 1W5MA 3GFXA 5IM51 3GXNA 1E6RA 1JUEA 3W38A 1EUNA 3ZIZA 1TMQA 2OZ0A 1RJRA 3R8GA 1TV7A 1GTHA 2O9RA 1MI3A 3GNRA 3WJYA 3KBSA 4WLCA 2ZXAA 3PANA 1R9XA 4EPKA 4UQCA 3CO4A 2D2HA 5E6ZA 3LTSA 4XZIA 4REQB 3DDMA 4IGHA 5C54A 4KCTA 1B4KA 2PDHA 1TTPA 2JKAA 4KMQA 4HNLA 3VX0A 4Q4OA 4IQLA 1XIDA 4GGHA 3BC9A 1BFNA 2PRMA 3XINA 5A8MA 2YZRA 3PK7A 4E2BA 4EAYA 4NKCA 2TMDA 2ZBTA 1XLLA 2CBIA 5REQB 1L8NA 4TO8A 2E40A 3WKZA 5DT7A 3AIWA 4FX8A 2OSWA 1P0NA 2DJLA 4UNKA 3W7NA 1OT2A 1QWGA 4NRRA 4WHBA 4FAMA 4F0KA 1OQFA 2GJNA 1JXJA 2A6LA 3B8WA 1G1YA 2FIQA 2ZQ0A 3KBJA 5AHLA 4Z1AA 1THFD 2X1SA 5A1AA 4Q32A 1E9LA 1R3TA 3WLMA 1TPB1 2C0AA 3W7QA 4FR6A 2YJQA 2ZE0A 3NSMA 1KRCC 2GGGA 1QOPA 4BR1A 4CCEA 3BH4A 5HPOA 2OZ3A 2IKJA 2VX7A 3W4RA 2ZUVA 3WQ4A 3EOSA 1P7TA 3BSGA 3IGHX 1EOMA 3F03K 4H6RA 2E4TA 1TQXA 3TUUA 1GJPA 3UZZA 4F0RA 3IJQA 2GUBA 3P5ZA 4O53A 3ZT6A 2XIIA 3GG1A 4CN4A 3RPDA 4I3GA 1LJYA 4JTQA 1VHNA 1ZAIA 4Z0JA 4XX6A 2QHAA 4XKYA 4DPPA 3PG8A 1QTWA 1IT7A 4JQ4A 4O19A 3ZFHA 4GK8A 4AU0A 2DZUA 4YTQA 3DYMA 4HTBA 1RV8A 3W85A 4JX4A 3B9OA 2PD9A 5I0DA 3TFCA 2AGTA 3WDQA 3V75A 2AL2B 3NPWA 2P8CA 3QZEA 4JQAA 2ZRUA 3MCMA 2XVNA 1W1YA 1IXQA 1BF6A 3E0LA 1CDGA 4DNHA 1RXOB 2QUNA 4IMEA 1Q6DA 2J78A 4UQDA 5CPNA 1RSCA 1S5TA 5HQLA 1KC7A 1HW6A 1XLJA 1GEHA 1BQGA 3MKVA 4GHRA 3T0TA 3BQ5A 3IPWA 2R1PA 3G77A 5I3IA 4EPDC 1BXCA 1H4PA 2VELA 1TPDA 4X3ZA 2BVYA 2IKHA 2Y7DA 2NQLA 3SSJA 5K4ZA 2PU0A 3R2GA 5FEWA 3OZYA 1XIIA 5FD0A 1DWGM 1EO7A 2EJAA 3LZ3A 2XWEA 3ICJA 3CMGA 2GGJA 1RP9A 4C7GA 5XIMA 1F74A 3E12A 1TMHA 4KGLA 1UJPA 3VNLA 3AXMA 1XWYA 1FCVA 2ZOXA 4TV6A 2OSXA 1GK8A 4KEUA 1EC8A 4PB5A 1GOOA 1K4HA 2I16A 1KM2A 2G4JA 3BPWA 3CASA 4LS1A 2QW5A 3CIXA 2J77A 1UZ4A 5AY7A 1NWUA 4IQDA 4PFHA 2VR4A 3SDOA 4LAKA 1GOIA 1NWRA 3M41A 1SW7A 2BOFX 3R0DA 1XLHA 2INEA 3LCHA 4H83A 3USBA 3NSXA 4DBEA 3MV11 3QQWA 4HYRA 1Q5MA 4IFRA 2QT3A 1PE1A 2GDUA 1H7NA 3THCA 2WZEA 1X7IA 3EA1A 1UP0A 2ZDRA 3M5ZA 3A6OA 1DJYA 4YYCA 1PKMA 1H50A 3ZOAA 3GDTA 4QNWA 2PDGA 2CLEA 2ZZ5A 1JI1A 3PJXA 3MI6A 1E9IA 1PAMA 3U8GA 3E6EA 1EOKA 4NASA 1X8FA 1A5KC 2ZZ3A 4HKPA 5HBFA 3AZSA 5C2GA 3E2QA 3W1MA 5EMJA 3WQCA 2RHGA 3AHVA 3QR1A 2WMJA 1P0EA 2WJDA 4K1GA 4PTDA 1HQTA 3WLHA 2DV0A 3AJXA