4N6MA

Crystal structure of human cystatin e/m produced in lexsy
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
117
structure length
117
Chain Sequence
RMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cystatin-M
publication title Structure and mechanism of an aspartimide-dependent Peptide ligase in human legumain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor
total genus 22
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4n6mA00
1ROAA 3S67A 4N6TA 4ZM8A 1G96A 1WNHA 1DVDA 2W9QA 5EQLA 1RN7A 2CH9A 1EQKA 5LC6A 4TX4A 1IV7A 1IV9A 1FA3A 4N6OB 3K9MC 3L0RA 5ELUA 5ELJA 1R4CA 1TIJA 1N5PA 5LC7A 3QRDA 2BO9B 3PXMA 4LZIA 5A0OB 3MWZA 1A90A 1NB3I 1KWIA 1MNLA 4CCVA 1LXEA 3SVAA 1DVCA 4N6NB 3GAXA 3Q2PA 4N6LA 2O9UX 4N6V0 1N5HA 1CYUA 4EYCA 1STFI 3KFQC 3UL6A 3PYJA 1GD4A 3IMAB 3LH4A 3PS8A 1GD3A 3KSED 2W9PA 4N6UA 1YVBI 4N6MA 1N9JA 1A67A 1PFPA 2OCTA 3UL5A 2KXGA 1FUWA 1M9GA 1CEWI 4IT7A 3NX0A 1NB5I 1MOLA 1CYVA
chains in the Genus database with same CATH superfamily
1SIHA 1YGWA 1RGHA 3AMOA 1V57A 2CFLA 3DXOA 3S67A 3X3XA 1VQ43 3PGBA 1BGSA 1BUJA 4XBYA 1OGZA 1UDII 4NREA 2K54A 4CPKA 1O7WB 4R4KA 4HJLB 1RKYA 2E2UA 2W56A 5CF2A 1OHOA 2Y74A 2CKFB 1UW1A 2D1WA 4JRFA 1WMPA 4KFEA 4BTYA 1IVUA 1BVIA 2BNGA 2SARA 2WGOA 3CU3A 3EE1A 4L8PA 1I70A 2CFDA 2RBIA 3QRDA 1O7NB 5IF6A 1MWSA 4WYKB 4O8SA 5KP1A 4WWUC 3B8LA 4I5QA 2FGTA 3FF2A 1W6CA 3ER7A 2HMLB 3URPA 5A0OB 3HIGA 1T5YA 3MWZA 3OW22 4HM3B 1N8QA 3EX9A 2OTL3 7STDA 1A90A 3F8XA 1NB3I 3NQYA 1ULJB 1RN4A 4XBXA 1G02A 1TFOA 1X1YA 1JNQA 3EBYA 1RN1A 3F9SA 4R80A 3KN4A 1DYUA 2F99A 2IYJA 4HM2B 1LXEA 3KSPA 3N54B 4IIAA 4J9AA 3T8UA 3CCJ3 1LOYA 1ULIB 3LOYA 1TU5A 3G4S3 3CMA3 2QIYA 5AI1A 4EBGA 2W56B 3B4PA 1A2VA 1DVCA 1BRGA 2P0MA 2W2CA 1NJI4 1GY6A 3RGRA 4EV2A 2CG0A 3WA2X 1ROVA 3JUMA 2P38A 3GAXA 4N6NB 3B7CA 3AGOA 3LYGA 4HAAA 4NPBA 3RGAA 2O9UX 3FSDA 2C10A 3VGNA 3GRDA 4LEHA 3F40A 5D82A 3X3YA 3HK4A 3BNEA 4L8OA 3V98A 1CYUA 3NBRA 3J7Yd 1RGKA 4FMCA 5CLKA 2W03A 1WMNA 1O7GB 2RNTA 1E3RA 4I4KA 1HZ1A 3NQZA 1BNRA 3UL6A 1N8R4 5AIHA 1W6GA 3FF0A 2OOVA 3LTCA 1J2BA 4RBNA 1I2FA 4ILFA 4R1KA 3SX1A 1BNFA 2KAAA 2O3OA 2QGUA 3JUPA 6GSPA 5IG4A 1KD14 1I3FA 3VSYA 1STDA 2XSOB 1UGHI 2GU3A 3D4AA 1GOUA 3LH4A 1T2HA 4BL2A 1RGAA 4G1MB 3V99A 1Q7Y4 3NM7A 1IVXA 3STDA 3FCSB 1GMRA 3FG3A 3OWUA 1W7CA 4AEQA 1B2ZA 2GU1A 2XR8B 3BLZA 1JJ22 4KFFA 5KP4A 4GHOA 3KE7A 4N6MA 3CNXA 1YGEA 2BMOB 5M18A 3PCRA 1PFPA 1TP6A 2KF4A 3SYUA 3CXC2 2CWVA 3FH1A 5TGNA 3CC23 1FGOA 1KQS2 1M9GA 2OWPA 4O3VA 1LVNA 2F5WA 1PY3A 4K90B 1M1K4 1A2PA 2V1LA 3JUNA 1LOWA 3NUVA 2Q07A 5G1LA 2ML6A 4GSPA 1SPUA 4MMXB 2Y73A 4KZ1A 1G0TA 3PCSA 2CK3H 1L5GB 3FG4A 1GMQA 1BNSA 1QALA 3JUQA 1X1WA 1GYBA 2GBXB 4XB5A 3EF8A 3QK9A 1ZS7A 1BANA 1IQYA 1EKMA 3X41A 3K5TA 1RN7A 3KKGA 2CH9A 1NNVA 3EBTA 3K0ZA 1SQWA 5IG3A 2MC8A 3AHWA 3WA3A 1IK3A 2M7OA 1EQKA 3MPHA 5JPPA 2KCDA 1DMMA 2IA7A 3GWRA 1BRNL 2XEPA 1IV9A 3IJEB 1Q42A 1A2KA 3F7SA 2JQ5A 3DZLA 1FGRA 3K9MC 1RJOA 3L0RA 8CHOA 9RNTA 1ISKA 1AVKA 4BIRA 4OK0A 2QEX3 1TFKA 3GSPA 5G1KA 4CDLA 1LOVA 4HM5B 1RGFA 3LT8A 3K63A 3DGYA 3CCM3 3MSOA 2GEXA 4HM0B 5EVHA 3GZRA 1OH0A 1TRQA 2CIUA 1AV4A 5HOHA 1AY7A 3F8HA 1BAOA 4FCZA 3GZYB 3N8BA 4LSOA 1BRJA 1JZOA 4HM7B 4CCVA 1O7HB 3AHSA 1BSDA 1RRLA 4HKVB 1Q40A 1FW7A 2D42A 3DGMA 2YFIB 1B2XA 2BU4A 2L1SA 4WP5A 1DE3A 3DH2A 2HOHA 4HZBB 5AYSC 3H51A 1VQQA 1IDPA 1EG9B 5FW5A 1RGCA 3S5CA 3NV0A 3DGLA 4N6V0 1CQSA 5D83A 3M8CA 3SOAA 1EA2A 1I0XA 3NXJA 5KP3A 1OACA 3ZG0A 1VQK3 3I563 1JZDA 2YX9A 1D6YA 1RDSA 1PU4A 3CCE3 1MWTA 2I9WA 4RNZA 1IYYA 4O02B 1STFI 3AMOB 1RGGA 3EB8A 3KFQC 3Q90A 2LYXA 2W6JH 1MGWA 2P09A 3F14A 3SXXA 4EC6A 5BIRA 1BRHA 2CHCA 4FMBA 1GD4A 1RGLA 5FGOA 2ZHXB 1RSNA 5D81A 1QVF2 2E2TA 2K3DA 1RLSA 4BU4A 1LOXA 3IMAB 1DMNA 1Q40B 3FG1A 1D6UA 1Z1SA 1CH0A 2CWTA 2IMJA 1JBTA 3D79A 1M904 1GS3A 4STDA 3VF1A 1VQ53 1ZO2A 3FGYA 1RGEA 2HMMB 3DMCA 1GOVA 2UX0A 7GSPA 3GZBA 4J8TA 1FUTA 3UNLA 6RNTA 1GD3A 1UI8A 1TUHA 3KSED 3HZPA 1K28A 1W2ZA 1UCIA 2W9PA 1JN5A 4N6UA 2KF5A 1N9JA 4HM1B 3FZWA 2Z77A 1RMSA 1JBRA 1B2UA 1BRSA 1O7MB 4OVMA 3I0YA 1A67A 2MF7A 4FR9A 2OCTA 3UL5A 3GZXB 2KF6A 3DY5A 3JUOA 4K1VA 5CXOA 2CFWA 5M1AA 3CPOA 3X42A 3OWSA 1NU3A 3UJMA 2FNQA 3NX0A 3D5GA 1W00A 4HBRA 4AKZA 1VQ83 3CME3 3S28A 1W2B2 1NB5I 1AVLA 3LTDA 1MOLA 3ZG5A 2FXTA 4PEJA 1R4YA 1CYVA 1Q814 3AGNA 4O2HA 3OWYA 1BSAA 5AIFA 5IW9A 1LQGC 1I0VA 3FLJA 1G96A 1N9EA 2WGQA 3G713 1DVDA 1BNJA 4FCJA 2W9QA 1JKGA 3DGOA 1UUVB 3LZAA 3MG2A 1Q864 3CD63 5EQLA 2RSXA 3SEDA 1YJN3 2C4BA 3BU4A 4HM6B 1T2IA 1IU7A 1RCKA 2KF3A 1O7PB 5LC6A 3X40A 4EXRA 4EV5A 4TX4A 4R9KA 1UCLA 2AAEA 1QAKA 1FA3A 1AR0A 1Q7HA 2PZVA 1YJW3 8RNTA 1ASKA 2BHMA 3OV4A 5ELUA 5ELJA 1R4CA 4ORLA 2R4IA 2PNCA 1S5AA 3D9RA 1SARA 4GL6A 3CCQ3 3RNTA 1KSIA 3D5IA 1BSCA 3HIIA 5AIGA 1VQL3 4KFDA 4OUQA 3PXMA 1BUQA 4LZIA 4X2OA 2ZL8A 5DREA 5EEOA 1WMOA 4RNYA 5JPUA 1NDOB 2H0IA 3RDEA 3S27A 2W04A 3EC9A 3MG3A 2STDA 1MNLA 2BMQB 3KZTA 1EUIC 1RNTA 1HYFA 3MKIA 2KRTA 2Z7AA 4WFOA 4CJNA 4Q53A 7RNTA 3NBJA 1X1UA 2CX0A 1I2GA 2BT3A 4K61A 2HMJB 4L7KA 2CFKA 2C11A 3BIRA 1MGRA 2GEYA 4HM8B 2ZA4A 1OCVA 1HKXA 1QMAA 2UUGC 3CC73 1FGTA 4N6LA 1B3SA 4LMIA 4XDVA 1BSBA 1D6ZA 4DKIA 3MHEA 2XGNA 2B1XB 3FKAA 2OTJ3 3EQQB 5AEWB 1Q824 5AIIA 1RTUA 1JBSA 3T8NA 2R41A 1FGMA 5IG0A 3JVCA 5AYRB 4H3UA 3TDGA 4EYCA 4HYZA 3WDGB 1K8A4 1C7HA 2GXFA 3CCU3 3HX8A 2HMKB 2J8XB 3PYJA 4H61A 3CPW2 1FGQA 5RNTA 1RRHA 3MG1A 2F5MA 3WODG 1B2MA 1RCLA 3G8ZA 4WYKA 6STDA 1Q9EA 3DM8A 1BIRA 1X1XA 5IEOA 1ZGXA 1US1A 1VQN3 3B4OA 1JRQA 3BB9A 3O8YA 1RHLA 1B21A 1OHSA 1VQP3 1OF5A 2E2VA 4LYLB 2B24B 1W5ZA 5BXQA 3WHOA 5G2GA 3CCR3 4HVNA 2CW9A 5AEUB 1NWWA 1LNHA 1YNVX 4LGQA 1BRIA 1E97A 2F56A 1IQ8A 1I2EA 1NO3A 3UB1A 1FYSA 2HMOB 1UGIA 2OOVC 2XFSA 5HGRA 3OXAA 1YHQ3 1IQXA 1FUWA 5IERA 3CCL3 1JV2B 1VQ63 1BU4A 1QJGA 4QWTA 1OPYA 3U1WA 2RGQA 5STDA 1KC84 3E99A 5BVBA 3LTAA 4GB5A 3WR2A 1B20A 1JB5A 1UCKA 3EJVA 1VQ73 2GBWB 1S723 1IVWA 2XFTA 1TRPA 1ROAA 1DETA 1BRKA 2P05A 1BNIA 2ZDJA 4BTWA 2XRXB 4N6TA 2CWUA 5JBSA 4HZ9B 3KIIA 4FMAA 1MWUA 1AQZA 1GMPA 1K41A 2BIRA 3EN1B 4ZM8A 2XH9A 3G6E3 1VQ93 1IVVA 1E3VA 1OF5B 1W01A 1WNHA 1JB4A 4JF8A 3NV0B 3WMDA 3OX9A 1W4NA 4HM4B 5IG5A 1I8VA 2F98A 1UI7A 4FCMA 3EN8A 4KT3B 2YFLB 2JDIH 3KCHA 1V74A 1K9M4 3D3LA 1YI23 1WQLB 5BU4A 1IV7A 2XSHB 1W6YA 4U13A 4N6OB 4R9LA 3Q3FA 3WOEB 2UGIA 2Z76A 3DGNA 2BMRB 3U97A 1TIJA 1N5PA 2SBLA 3Q1CA 5LC7A 4NHFA 2RCDA 5IENA 3I553 1IT8A 3LT9A 3EHCA 2BO9B 2OQEC 3LXUX 4X2HA 1Y4KA 3ZFZA 3X3ZA 4RNTA 5I97A 1BNEA 2ML5A 3NM2A 4XBTA 1RNBA 1K734 1B27A 4FMDA 4XDWA 1KWIA 1OGXA 3MYTA 2XGLA 1IT7A 1UUGB 2IUJA 3SOYA 2L4VA 1GSPA 1YIJ3 3HOHA 1JN5B 1OHPA 2IY2A 3SVAA 2RFRA 3ECFA 3PZWA 1LQMB 2WO0A 2YFJB 3V92A 1PYLA 1WTHA 4HOHA 1T3BA 3LMLA 1JB2A 1UUWB 3Q2PA 3N9HA 5CK6A 2GSPA 5IEPA 1LRAA 3A76A 2H0HA 1LNIA 3K7CA 1FUSA 4WHAA 5GSPA 3ALAA 5M19A 3WOFB 5CF1A 2CX1A 2CFGA 3CNMA 1BNGA 1N5HA 2XF3A 3BNCA 1FZUA 3H3HA 1ZX2A 3T0UA 4J5GA 3A5EA 1GY5A 3S29A 3BNDA 3NBBA 3DUKA 4KVHA 4RZMA 4AKYA 1VZZA 3CCS3 1HU9A 1YIT3 4J5KA 3F7XA 1JKGB 2A15A 1UCJA 1TTOA 1TJDA 2H0GA 1VQM3 4MJDA 2INXA 1YJ93 1YVSA 4XM4A 2CG1A 3IPTA 2Z6BA 1BOXA 3HI7A 2OQEA 4BL3A 4N3VA 2P0XA 2QA43 3PS8A 4MMZB 1U5OA 2WOFA 1VQO3 3G0KA 1F8NA 2HMNB 2CC3A 1U8CB 3CC43 1V58A 3ROBA 1W02A 3NHXA 4MMYB 1GY7A 1YVBI 3G16A 1C54A 1SIIA 1OUNA 2F86B 2F4YA 4MEIA 1M1XB 3BNBA 3LTBA 4K1UA 1SJWA 1B2SA 2AADA 2KXGA 1BSEA 1DMQA 1I3IA 1CEWI 3CCV3 2IUKA 4IT7A 4BTXA 1QVG2 4IPBA 5DRVA 1MWRA 2K0MA 2WOHA 3SLUA 2LQVA 1EEJA 2W0QA 1GOYA 1QAFA 4EW5A
chains in the Genus database with same CATH topology
1SIHA 3AMOA 2CFLA 3DXOA 3S67A 3X3XA 1VQ43 3PGBA 4XBYA 1OGZA 4NREA 2K54A 1O7WB 4R4KA 4HJLB 1RKYA 2E2UA 2W56A 5CF2A 1OHOA 2Y74A 2CKFB 1UW1A 2D1WA 4JRFA 1WMPA 4KFEA 4BTYA 1IVUA 2BNGA 2WGOA 3CU3A 3EE1A 4L8PA 2CFDA 3QRDA 1O7NB 5IF6A 4WYKB 4O8SA 5KP1A 4WWUC 3B8LA 2FGTA 3FF2A 1W6CA 3ER7A 2HMLB 5A0OB 3OW22 3HIGA 1T5YA 3MWZA 4HM3B 1N8QA 3EX9A 2OTL3 7STDA 1A90A 3F8XA 1NB3I 3NQYA 1ULJB 4XBXA 1TFOA 3EBYA 1JNQA 3F9SA 4R80A 3KN4A 1DYUA 2F99A 4HM2B 4J9AA 1LXEA 3KSPA 3N54B 4IIAA 3WA3A 3T8UA 3CCJ3 1ULIB 3LOYA 1TU5A 3G4S3 3CMA3 2QIYA 5AI1A 4EBGA 2W56B 3B4PA 1A2VA 1DVCA 2P0MA 2W2CA 1NJI4 1VQ63 1GY6A 3RGRA 4EV2A 2CG0A 3WA2X 1ROVA 3JUMA 2P38A 3GAXA 4N6NB 3B7CA 3LYGA 3RGAA 2O9UX 3FSDA 2C10A 3VGNA 3GRDA 4LEHA 3F40A 5D82A 3X3YA 3HK4A 3BNEA 4L8OA 3V98A 1CYUA 3NBRA 3J7Yd 4FMCA 5CLKA 2W03A 1WMNA 1O7GB 1E3RA 4I4KA 3NQZA 3UL6A 1N8R4 5AIHA 1W6GA 3FF0A 2OOVA 3LTCA 1J2BA 4RBNA 4R1KA 3SX1A 2QGUA 2O3OA 3JUPA 5IG4A 1KD14 3VSYA 1STDA 2XSOB 2GU3A 3LH4A 4G1MB 3V99A 1Q7Y4 3NM7A 1IVXA 3STDA 3FCSB 3OWUA 3FG3A 1W7CA 4AEQA 2GU1A 2XR8B 3BLZA 1JJ22 4KFFA 5KP4A 3KE7A 4N6MA 3CNXA 1YGEA 2BMOB 3PCRA 1PFPA 1TP6A 3CXC2 2CWVA 3FH1A 5TGNA 3CC23 1FGOA 1KQS2 1M9GA 2OWPA 4O3VA 1LVNA 4K90B 1M1K4 2V1LA 3JUNA 3NUVA 2Q07A 2ML6A 4MMXB 1SPUA 2Y73A 4KZ1A 3PCSA 2CK3H 1L5GB 3FG4A 1QALA 3JUQA 1GYBA 2GBXB 4XB5A 3EF8A 3QK9A 1IQYA 1EKMA 3X41A 3K5TA 1RN7A 3KKGA 2CH9A 3EBTA 3K0ZA 1SQWA 5IG3A 2MC8A 1EQKA 1IK3A 2M7OA 3MPHA 5JPPA 2KCDA 1DMMA 2IA7A 3GWRA 2XEPA 1IV9A 3IJEB 1Q42A 1A2KA 3F7SA 2JQ5A 3DZLA 1FGRA 3K9MC 1RJOA 3L0RA 8CHOA 1ISKA 1AVKA 4OK0A 2QEX3 1TFKA 4CDLA 4HM5B 3LT8A 3K63A 3CCM3 3MSOA 2GEXA 4HM0B 5EVHA 3GZRA 1OH0A 2CIUA 1AV4A 3F8HA 4FCZA 3GZYB 3N8BA 4LSOA 4HM7B 4CCVA 1O7HB 1RRLA 4HKVB 1Q40A 2D42A 3DGMA 2YFIB 4WP5A 4HZBB 5AYSC 3H51A 1IDPA 1EG9B 5FW5A 3S5CA 3NV0A 3DGLA 4N6V0 1CQSA 5D83A 3M8CA 3SOAA 1EA2A 3NXJA 5KP3A 1OACA 1VQK3 3I563 2YX9A 1D6YA 3CCE3 1PU4A 2I9WA 4RNZA 4O02B 1STFI 3AMOB 3EB8A 3KFQC 3Q90A 2LYXA 2W6JH 3F14A 2P09A 3SXXA 4EC6A 4FMBA 2CHCA 1GD4A 5FGOA 1QVF2 5D81A 2E2TA 1LOXA 3IMAB 1DMNA 1Q40B 3FG1A 1D6UA 1Z1SA 2CWTA 2IMJA 1M904 1GS3A 4STDA 3VF1A 1VQ53 1ZO2A 3FGYA 2HMMB 3DMCA 2UX0A 3GZBA 4J8TA 3UNLA 1GD3A 1UI8A 1TUHA 3KSED 3HZPA 1K28A 1W2ZA 2W9PA 1JN5A 4N6UA 1N9JA 4HM1B 3FZWA 2Z77A 1O7MB 4OVMA 1A67A 3I0YA 2MF7A 4FR9A 2OCTA 3UL5A 3GZXB 3DY5A 3JUOA 5CXOA 4K1VA 3X42A 2CFWA 3CPOA 3OWSA 1NU3A 3UJMA 2FNQA 3NX0A 1W00A 4HBRA 4AKZA 1VQ83 3CME3 3S28A 1W2B2 1NB5I 1AVLA 3LTDA 1MOLA 2FXTA 4PEJA 1CYVA 1Q814 4O2HA 3OWYA 5AIFA 5IW9A 3FLJA 1G96A 1N9EA 2WGQA 3G713 1DVDA 4FCJA 2W9QA 1JKGA 3DGOA 1UUVB 3LZAA 3MG2A 1Q864 3CD63 5EQLA 2RSXA 3SEDA 1YJN3 4HM6B 1IU7A 3X40A 4EV5A 1O7PB 5LC6A 4EXRA 4TX4A 4R9KA 1QAKA 1FA3A 1AR0A 2PZVA 1YJW3 1ASKA 2BHMA 3OV4A 5ELUA 5ELJA 1R4CA 4ORLA 2R4IA 2PNCA 1S5AA 3D9RA 4GL6A 3CCQ3 1KSIA 3HIIA 1VQL3 5AIGA 1BUQA 4KFDA 4OUQA 3PXMA 4LZIA 4X2OA 2ZL8A 5DREA 5EEOA 1WMOA 4RNYA 5JPUA 1NDOB 3RDEA 3S27A 2W04A 3EC9A 3MG3A 2STDA 1MNLA 2BMQB 3KZTA 3MKIA 2KRTA 2Z7AA 4WFOA 4Q53A 3NBJA 2BT3A 4K61A 2HMJB 4L7KA 2CFKA 2C11A 4HM8B 2GEYA 1OCVA 1HKXA 1QMAA 3CC73 1FGTA 4N6LA 4XDVA 4LMIA 1D6ZA 3MHEA 2XGNA 2B1XB 3FKAA 2OTJ3 3EQQB 5AEWB 1Q824 5AIIA 3T8NA 1FGMA 5IG0A 3JVCA 5AYRB 4H3UA 3TDGA 4EYCA 4HYZA 3WDGB 1K8A4 1C7HA 2GXFA 3CCU3 3HX8A 2HMKB 3PYJA 4H61A 3CPW2 1FGQA 1RRHA 3MG1A 3WODG 3G8ZA 4WYKA 6STDA 3DM8A 5IEOA 1US1A 1VQN3 3B4OA 1JRQA 3BB9A 3O8YA 1OHSA 1VQP3 1OF5A 2E2VA 2B24B 1W5ZA 5BXQA 5G2GA 3CCR3 4HVNA 2CW9A 5AEUB 1NWWA 1LNHA 4LGQA 1E97A 1IQ8A 1NO3A 3UB1A 2HMOB 2OOVC 2XFSA 5HGRA 1YHQ3 3OXAA 1IQXA 1FUWA 5IERA 3CCL3 1JV2B 1QJGA 4QWTA 1OPYA 3U1WA 2RGQA 5STDA 1KC84 3E99A 5BVBA 3LTAA 4GB5A 1JB5A 3EJVA 1VQ73 2GBWB 1S723 1IVWA 2XFTA 1ROAA 2P05A 2ZDJA 4BTWA 2XRXB 4N6TA 2CWUA 5JBSA 4HZ9B 3KIIA 4FMAA 1VQ93 1K41A 3EN1B 4ZM8A 2XH9A 3G6E3 1IVVA 1E3VA 1OF5B 1W01A 1WNHA 1JB4A 4JF8A 3NV0B 3WMDA 3OX9A 1W4NA 4HM4B 5IG5A 2F98A 1UI7A 4FCMA 3EN8A 2YFLB 2JDIH 1K9M4 1V74A 3D3LA 1YI23 1WQLB 1IV7A 2XSHB 1W6YA 4U13A 4N6OB 4R9LA 3WOEB 2Z76A 3DGNA 2BMRB 3U97A 1TIJA 1N5PA 2SBLA 3Q1CA 5LC7A 4NHFA 2RCDA 5IENA 3I553 1IT8A 3LT9A 3EHCA 2BO9B 2OQEC 3LXUX 4X2HA 1Y4KA 3X3ZA 5I97A 2ML5A 3NM2A 4XBTA 1K734 4FMDA 4XDWA 1KWIA 1OGXA 3MYTA 2XGLA 1IT7A 2IUJA 3SOYA 2L4VA 1YIJ3 1JN5B 1OHPA 3SVAA 2RFRA 3ECFA 3PZWA 2WO0A 2YFJB 3V92A 1WTHA 3LMLA 1JB2A 1UUWB 3Q2PA 3N9HA 5CK6A 5IEPA 3A76A 3K7CA 4WHAA 3ALAA 3WOFB 5CF1A 2CFGA 3CNMA 1N5HA 2XF3A 3BNCA 3H3HA 1ZX2A 3T0UA 1GY5A 3S29A 3BNDA 3NBBA 3DUKA 4KVHA 4RZMA 4AKYA 1VZZA 3CCS3 1HU9A 1YIT3 3F7XA 1JKGB 2A15A 1VQM3 4MJDA 2INXA 1YJ93 4XM4A 2CG1A 3IPTA 2Z6BA 3HI7A 2OQEA 4N3VA 2P0XA 2QA43 3PS8A 4MMZB 1U5OA 2WOFA 1VQO3 3G0KA 1F8NA 2HMNB 2CC3A 1U8CB 3CC43 3ROBA 1W02A 3NHXA 4MMYB 1GY7A 1YVBI 3G16A 1SIIA 1OUNA 2F86B 4MEIA 1M1XB 3BNBA 3LTBA 4K1UA 1SJWA 2KXGA 1DMQA 1CEWI 3CCV3 2IUKA 4IT7A 4BTXA 1QVG2 4IPBA 5DRVA 2K0MA 2WOHA 3SLUA 2LQVA 2W0QA 1QAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ROA A;  3S67 A;  4N6T A;  4ZM8 A;  1G96 A;  1WNH A;  1DVD A;  2W9Q A;  5EQL A;  1RN7 A;  2CH9 A;  1EQK A;  5LC6 A;  4TX4 A;  1IV7 A;  1IV9 A;  1FA3 A;  4N6O B;  3K9M C;  3L0R A;  5ELU A;  5ELJ A;  1R4C A;  1TIJ A;  1N5P A;  5LC7 A;  3QRD A;  2BO9 B;  3PXM A;  4LZI A;  5A0O B;  3MWZ A;  1A90 A;  1NB3 I;  1KWI A;  1MNL A;  4CCV A;  1LXE A;  3SVA A;  1DVC A;  4N6N B;  3GAX A;  3Q2P A;  4N6L A;  2O9U X;  4N6V 0;  1N5H A;  1CYU A;  4EYC A;  1STF I;  3KFQ C;  3UL6 A;  3PYJ A;  1GD4 A;  3IMA B;  3LH4 A;  3PS8 A;  1GD3 A;  3KSE D;  2W9P A;  4N6U A;  1YVB I;  4N6M A;  1N9J A;  1A67 A;  1PFP A;  2OCT A;  3UL5 A;  2KXG A;  1FUW A;  1M9G A;  1CEW I;  4IT7 A;  3NX0 A;  1NB5 I;  1MOL A;  1CYV A; 
#chains in the Genus database with same CATH topology
 1SIH A;  1YGW A;  1RGH A;  3AMO A;  1V57 A;  2CFL A;  3DXO A;  3S67 A;  3X3X A;  1VQ4 3;  3PGB A;  1BGS A;  1BUJ A;  4XBY A;  1OGZ A;  1UDI I;  4NRE A;  2K54 A;  4CPK A;  1O7W B;  4R4K A;  4HJL B;  1RKY A;  2E2U A;  2W56 A;  5CF2 A;  1OHO A;  2Y74 A;  2CKF B;  1UW1 A;  2D1W A;  4JRF A;  1WMP A;  4KFE A;  4BTY A;  1IVU A;  1BVI A;  2BNG A;  2SAR A;  2WGO A;  3CU3 A;  3EE1 A;  4L8P A;  1I70 A;  2CFD A;  2RBI A;  3QRD A;  1O7N B;  5IF6 A;  1MWS A;  4WYK B;  4O8S A;  5KP1 A;  4WWU C;  3B8L A;  4I5Q A;  2FGT A;  3FF2 A;  1W6C A;  3ER7 A;  2HML B;  3URP A;  5A0O B;  3HIG A;  1T5Y A;  3MWZ A;  3OW2 2;  4HM3 B;  1N8Q A;  3EX9 A;  2OTL 3;  7STD A;  1A90 A;  3F8X A;  1NB3 I;  3NQY A;  1ULJ B;  1RN4 A;  4XBX A;  1G02 A;  1TFO A;  1X1Y A;  1JNQ A;  3EBY A;  1RN1 A;  3F9S A;  4R80 A;  3KN4 A;  1DYU A;  2F99 A;  2IYJ A;  4HM2 B;  1LXE A;  3KSP A;  3N54 B;  4IIA A;  4J9A A;  3T8U A;  3CCJ 3;  1LOY A;  1ULI B;  3LOY A;  1TU5 A;  3G4S 3;  3CMA 3;  2QIY A;  5AI1 A;  4EBG A;  2W56 B;  3B4P A;  1A2V A;  1DVC A;  1BRG A;  2P0M A;  2W2C A;  1NJI 4;  1GY6 A;  3RGR A;  4EV2 A;  2CG0 A;  3WA2 X;  1ROV A;  3JUM A;  2P38 A;  3GAX A;  4N6N B;  3B7C A;  3AGO A;  3LYG A;  4HAA A;  4NPB A;  3RGA A;  2O9U X;  3FSD A;  2C10 A;  3VGN A;  3GRD A;  4LEH A;  3F40 A;  5D82 A;  3X3Y A;  3HK4 A;  3BNE A;  4L8O A;  3V98 A;  1CYU A;  3NBR A;  3J7Y d;  1RGK A;  4FMC A;  5CLK A;  2W03 A;  1WMN A;  1O7G B;  2RNT A;  1E3R A;  4I4K A;  1HZ1 A;  3NQZ A;  1BNR A;  3UL6 A;  1N8R 4;  5AIH A;  1W6G A;  3FF0 A;  2OOV A;  3LTC A;  1J2B A;  4RBN A;  1I2F A;  4ILF A;  4R1K A;  3SX1 A;  1BNF A;  2KAA A;  2O3O A;  2QGU A;  3JUP A;  6GSP A;  5IG4 A;  1KD1 4;  1I3F A;  3VSY A;  1STD A;  2XSO B;  1UGH I;  2GU3 A;  3D4A A;  1GOU A;  3LH4 A;  1T2H A;  4BL2 A;  1RGA A;  4G1M B;  3V99 A;  1Q7Y 4;  3NM7 A;  1IVX A;  3STD A;  3FCS B;  1GMR A;  3FG3 A;  3OWU A;  1W7C A;  4AEQ A;  1B2Z A;  2GU1 A;  2XR8 B;  3BLZ A;  1JJ2 2;  4KFF A;  5KP4 A;  4GHO A;  3KE7 A;  4N6M A;  3CNX A;  1YGE A;  2BMO B;  5M18 A;  3PCR A;  1PFP A;  1TP6 A;  2KF4 A;  3SYU A;  3CXC 2;  2CWV A;  3FH1 A;  5TGN A;  3CC2 3;  1FGO A;  1KQS 2;  1M9G A;  2OWP A;  4O3V A;  1LVN A;  2F5W A;  1PY3 A;  4K90 B;  1M1K 4;  1A2P A;  2V1L A;  3JUN A;  1LOW A;  3NUV A;  2Q07 A;  5G1L A;  2ML6 A;  4GSP A;  1SPU A;  4MMX B;  2Y73 A;  4KZ1 A;  1G0T A;  3PCS A;  2CK3 H;  1L5G B;  3FG4 A;  1GMQ A;  1BNS A;  1QAL A;  3JUQ A;  1X1W A;  1GYB A;  2GBX B;  4XB5 A;  3EF8 A;  3QK9 A;  1ZS7 A;  1BAN A;  1IQY A;  1EKM A;  3X41 A;  3K5T A;  1RN7 A;  3KKG A;  2CH9 A;  1NNV A;  3EBT A;  3K0Z A;  1SQW A;  5IG3 A;  2MC8 A;  3AHW A;  3WA3 A;  1IK3 A;  2M7O A;  1EQK A;  3MPH A;  5JPP A;  2KCD A;  1DMM A;  2IA7 A;  3GWR A;  1BRN L;  2XEP A;  1IV9 A;  3IJE B;  1Q42 A;  1A2K A;  3F7S A;  2JQ5 A;  3DZL A;  1FGR A;  3K9M C;  1RJO A;  3L0R A;  8CHO A;  9RNT A;  1ISK A;  1AVK A;  4BIR A;  4OK0 A;  2QEX 3;  1TFK A;  3GSP A;  5G1K A;  4CDL A;  1LOV A;  4HM5 B;  1RGF A;  3LT8 A;  3K63 A;  3DGY A;  3CCM 3;  3MSO A;  2GEX A;  4HM0 B;  5EVH A;  3GZR A;  1OH0 A;  1TRQ A;  2CIU A;  1AV4 A;  5HOH A;  1AY7 A;  3F8H A;  1BAO A;  4FCZ A;  3GZY B;  3N8B A;  4LSO A;  1BRJ A;  1JZO A;  4HM7 B;  4CCV A;  1O7H B;  3AHS A;  1BSD A;  1RRL A;  4HKV B;  1Q40 A;  1FW7 A;  2D42 A;  3DGM A;  2YFI B;  1B2X A;  2BU4 A;  2L1S A;  4WP5 A;  1DE3 A;  3DH2 A;  2HOH A;  4HZB B;  5AYS C;  3H51 A;  1VQQ A;  1IDP A;  1EG9 B;  5FW5 A;  1RGC A;  3S5C A;  3NV0 A;  3DGL A;  4N6V 0;  1CQS A;  5D83 A;  3M8C A;  3SOA A;  1EA2 A;  1I0X A;  3NXJ A;  5KP3 A;  1OAC A;  3ZG0 A;  1VQK 3;  3I56 3;  1JZD A;  2YX9 A;  1D6Y A;  1RDS A;  1PU4 A;  3CCE 3;  1MWT A;  2I9W A;  4RNZ A;  1IYY A;  4O02 B;  1STF I;  3AMO B;  1RGG A;  3EB8 A;  3KFQ C;  3Q90 A;  2LYX A;  2W6J H;  1MGW A;  2P09 A;  3F14 A;  3SXX A;  4EC6 A;  5BIR A;  1BRH A;  2CHC A;  4FMB A;  1GD4 A;  1RGL A;  5FGO A;  2ZHX B;  1RSN A;  5D81 A;  1QVF 2;  2E2T A;  2K3D A;  1RLS A;  4BU4 A;  1LOX A;  3IMA B;  1DMN A;  1Q40 B;  3FG1 A;  1D6U A;  1Z1S A;  1CH0 A;  2CWT A;  2IMJ A;  1JBT A;  3D79 A;  1M90 4;  1GS3 A;  4STD A;  3VF1 A;  1VQ5 3;  1ZO2 A;  3FGY A;  1RGE A;  2HMM B;  3DMC A;  1GOV A;  2UX0 A;  7GSP A;  3GZB A;  4J8T A;  1FUT A;  3UNL A;  6RNT A;  1GD3 A;  1UI8 A;  1TUH A;  3KSE D;  3HZP A;  1K28 A;  1W2Z A;  1UCI A;  2W9P A;  1JN5 A;  4N6U A;  2KF5 A;  1N9J A;  4HM1 B;  3FZW A;  2Z77 A;  1RMS A;  1JBR A;  1B2U A;  1BRS A;  1O7M B;  4OVM A;  3I0Y A;  1A67 A;  2MF7 A;  4FR9 A;  2OCT A;  3UL5 A;  3GZX B;  2KF6 A;  3DY5 A;  3JUO A;  4K1V A;  5CXO A;  2CFW A;  5M1A A;  3CPO A;  3X42 A;  3OWS A;  1NU3 A;  3UJM A;  2FNQ A;  3NX0 A;  3D5G A;  1W00 A;  4HBR A;  4AKZ A;  1VQ8 3;  3CME 3;  3S28 A;  1W2B 2;  1NB5 I;  1AVL A;  3LTD A;  1MOL A;  3ZG5 A;  2FXT A;  4PEJ A;  1R4Y A;  1CYV A;  1Q81 4;  3AGN A;  4O2H A;  3OWY A;  1BSA A;  5AIF A;  5IW9 A;  1LQG C;  1I0V A;  3FLJ A;  1G96 A;  1N9E A;  2WGQ A;  3G71 3;  1DVD A;  1BNJ A;  4FCJ A;  2W9Q A;  1JKG A;  3DGO A;  1UUV B;  3LZA A;  3MG2 A;  1Q86 4;  3CD6 3;  5EQL A;  2RSX A;  3SED A;  1YJN 3;  2C4B A;  3BU4 A;  4HM6 B;  1T2I A;  1IU7 A;  1RCK A;  2KF3 A;  1O7P B;  5LC6 A;  3X40 A;  4EXR A;  4EV5 A;  4TX4 A;  4R9K A;  1UCL A;  2AAE A;  1QAK A;  1FA3 A;  1AR0 A;  1Q7H A;  2PZV A;  1YJW 3;  8RNT A;  1ASK A;  2BHM A;  3OV4 A;  5ELU A;  5ELJ A;  1R4C A;  4ORL A;  2R4I A;  2PNC A;  1S5A A;  3D9R A;  1SAR A;  4GL6 A;  3CCQ 3;  3RNT A;  1KSI A;  3D5I A;  1BSC A;  3HII A;  5AIG A;  1VQL 3;  4KFD A;  4OUQ A;  3PXM A;  1BUQ A;  4LZI A;  4X2O A;  2ZL8 A;  5DRE A;  5EEO A;  1WMO A;  4RNY A;  5JPU A;  1NDO B;  2H0I A;  3RDE A;  3S27 A;  2W04 A;  3EC9 A;  3MG3 A;  2STD A;  1MNL A;  2BMQ B;  3KZT A;  1EUI C;  1RNT A;  1HYF A;  3MKI A;  2KRT A;  2Z7A A;  4WFO A;  4CJN A;  4Q53 A;  7RNT A;  3NBJ A;  1X1U A;  2CX0 A;  1I2G A;  2BT3 A;  4K61 A;  2HMJ B;  4L7K A;  2CFK A;  2C11 A;  3BIR A;  1MGR A;  2GEY A;  4HM8 B;  2ZA4 A;  1OCV A;  1HKX A;  1QMA A;  2UUG C;  3CC7 3;  1FGT A;  4N6L A;  1B3S A;  4LMI A;  4XDV A;  1BSB A;  1D6Z A;  4DKI A;  3MHE A;  2XGN A;  2B1X B;  3FKA A;  2OTJ 3;  3EQQ B;  5AEW B;  1Q82 4;  5AII A;  1RTU A;  1JBS A;  3T8N A;  2R41 A;  1FGM A;  5IG0 A;  3JVC A;  5AYR B;  4H3U A;  3TDG A;  4EYC A;  4HYZ A;  3WDG B;  1K8A 4;  1C7H A;  2GXF A;  3CCU 3;  3HX8 A;  2HMK B;  2J8X B;  3PYJ A;  4H61 A;  3CPW 2;  1FGQ A;  5RNT A;  1RRH A;  3MG1 A;  2F5M A;  3WOD G;  1B2M A;  1RCL A;  3G8Z A;  4WYK A;  6STD A;  1Q9E A;  3DM8 A;  1BIR A;  1X1X A;  5IEO A;  1ZGX A;  1US1 A;  1VQN 3;  3B4O A;  1JRQ A;  3BB9 A;  3O8Y A;  1RHL A;  1B21 A;  1OHS A;  1VQP 3;  1OF5 A;  2E2V A;  4LYL B;  2B24 B;  1W5Z A;  5BXQ A;  3WHO A;  5G2G A;  3CCR 3;  4HVN A;  2CW9 A;  5AEU B;  1NWW A;  1LNH A;  1YNV X;  4LGQ A;  1BRI A;  1E97 A;  2F56 A;  1IQ8 A;  1I2E A;  1NO3 A;  3UB1 A;  1FYS A;  2HMO B;  1UGI A;  2OOV C;  2XFS A;  5HGR A;  3OXA A;  1YHQ 3;  1IQX A;  1FUW A;  5IER A;  3CCL 3;  1JV2 B;  1VQ6 3;  1BU4 A;  1QJG A;  4QWT A;  1OPY A;  3U1W A;  2RGQ A;  5STD A;  1KC8 4;  3E99 A;  5BVB A;  3LTA A;  4GB5 A;  3WR2 A;  1B20 A;  1JB5 A;  1UCK A;  3EJV A;  1VQ7 3;  2GBW B;  1S72 3;  1IVW A;  2XFT A;  1TRP A;  1ROA A;  1DET A;  1BRK A;  2P05 A;  1BNI A;  2ZDJ A;  4BTW A;  2XRX B;  4N6T A;  2CWU A;  5JBS A;  4HZ9 B;  3KII A;  4FMA A;  1MWU A;  1AQZ A;  1GMP A;  1K41 A;  2BIR A;  3EN1 B;  4ZM8 A;  2XH9 A;  3G6E 3;  1VQ9 3;  1IVV A;  1E3V A;  1OF5 B;  1W01 A;  1WNH A;  1JB4 A;  4JF8 A;  3NV0 B;  3WMD A;  3OX9 A;  1W4N A;  4HM4 B;  5IG5 A;  1I8V A;  2F98 A;  1UI7 A;  4FCM A;  3EN8 A;  4KT3 B;  2YFL B;  2JDI H;  3KCH A;  1V74 A;  1K9M 4;  3D3L A;  1YI2 3;  1WQL B;  5BU4 A;  1IV7 A;  2XSH B;  1W6Y A;  4U13 A;  4N6O B;  4R9L A;  3Q3F A;  3WOE B;  2UGI A;  2Z76 A;  3DGN A;  2BMR B;  3U97 A;  1TIJ A;  1N5P A;  2SBL A;  3Q1C A;  5LC7 A;  4NHF A;  2RCD A;  5IEN A;  3I55 3;  1IT8 A;  3LT9 A;  3EHC A;  2BO9 B;  2OQE C;  3LXU X;  4X2H A;  1Y4K A;  3ZFZ A;  3X3Z A;  4RNT A;  5I97 A;  1BNE A;  2ML5 A;  3NM2 A;  4XBT A;  1RNB A;  1K73 4;  1B27 A;  4FMD A;  4XDW A;  1KWI A;  1OGX A;  3MYT A;  2XGL A;  1IT7 A;  1UUG B;  2IUJ A;  3SOY A;  2L4V A;  1GSP A;  1YIJ 3;  3HOH A;  1JN5 B;  1OHP A;  2IY2 A;  3SVA A;  2RFR A;  3ECF A;  3PZW A;  1LQM B;  2WO0 A;  2YFJ B;  3V92 A;  1PYL A;  1WTH A;  4HOH A;  1T3B A;  3LML A;  1JB2 A;  1UUW B;  3Q2P A;  3N9H A;  5CK6 A;  2GSP A;  5IEP A;  1LRA A;  3A76 A;  2H0H A;  1LNI A;  3K7C A;  1FUS A;  4WHA A;  5GSP A;  3ALA A;  5M19 A;  3WOF B;  5CF1 A;  2CX1 A;  2CFG A;  3CNM A;  1BNG A;  1N5H A;  2XF3 A;  3BNC A;  1FZU A;  3H3H A;  1ZX2 A;  3T0U A;  4J5G A;  3A5E A;  1GY5 A;  3S29 A;  3BND A;  3NBB A;  3DUK A;  4KVH A;  4RZM A;  4AKY A;  1VZZ A;  3CCS 3;  1HU9 A;  1YIT 3;  4J5K A;  3F7X A;  1JKG B;  2A15 A;  1UCJ A;  1TTO A;  1TJD A;  2H0G A;  1VQM 3;  4MJD A;  2INX A;  1YJ9 3;  1YVS A;  4XM4 A;  2CG1 A;  3IPT A;  2Z6B A;  1BOX A;  3HI7 A;  2OQE A;  4BL3 A;  4N3V A;  2P0X A;  2QA4 3;  3PS8 A;  4MMZ B;  1U5O A;  2WOF A;  1VQO 3;  3G0K A;  1F8N A;  2HMN B;  2CC3 A;  1U8C B;  3CC4 3;  1V58 A;  3ROB A;  1W02 A;  3NHX A;  4MMY B;  1GY7 A;  1YVB I;  3G16 A;  1C54 A;  1SII A;  1OUN A;  2F86 B;  2F4Y A;  4MEI A;  1M1X B;  3BNB A;  3LTB A;  4K1U A;  1SJW A;  1B2S A;  2AAD A;  2KXG A;  1BSE A;  1DMQ A;  1I3I A;  1CEW I;  3CCV 3;  2IUK A;  4IT7 A;  4BTX A;  1QVG 2;  4IPB A;  5DRV A;  1MWR A;  2K0M A;  2WOH A;  3SLU A;  2LQV A;  1EEJ A;  2W0Q A;  1GOY A;  1QAF A;  4EW5 A; 
#chains in the Genus database with same CATH homology
 1SIH A;  3AMO A;  2CFL A;  3DXO A;  3S67 A;  3X3X A;  1VQ4 3;  3PGB A;  4XBY A;  1OGZ A;  4NRE A;  2K54 A;  1O7W B;  4R4K A;  4HJL B;  1RKY A;  2E2U A;  2W56 A;  5CF2 A;  1OHO A;  2Y74 A;  2CKF B;  1UW1 A;  2D1W A;  4JRF A;  1WMP A;  4KFE A;  4BTY A;  1IVU A;  2BNG A;  2WGO A;  3CU3 A;  3EE1 A;  4L8P A;  2CFD A;  3QRD A;  1O7N B;  5IF6 A;  4WYK B;  4O8S A;  5KP1 A;  4WWU C;  3B8L A;  2FGT A;  3FF2 A;  1W6C A;  3ER7 A;  2HML B;  5A0O B;  3OW2 2;  3HIG A;  1T5Y A;  3MWZ A;  4HM3 B;  1N8Q A;  3EX9 A;  2OTL 3;  7STD A;  1A90 A;  3F8X A;  1NB3 I;  3NQY A;  1ULJ B;  4XBX A;  1TFO A;  3EBY A;  1JNQ A;  3F9S A;  4R80 A;  3KN4 A;  1DYU A;  2F99 A;  4HM2 B;  4J9A A;  1LXE A;  3KSP A;  3N54 B;  4IIA A;  3WA3 A;  3T8U A;  3CCJ 3;  1ULI B;  3LOY A;  1TU5 A;  3G4S 3;  3CMA 3;  2QIY A;  5AI1 A;  4EBG A;  2W56 B;  3B4P A;  1A2V A;  1DVC A;  2P0M A;  2W2C A;  1NJI 4;  1VQ6 3;  1GY6 A;  3RGR A;  4EV2 A;  2CG0 A;  3WA2 X;  1ROV A;  3JUM A;  2P38 A;  3GAX A;  4N6N B;  3B7C A;  3LYG A;  3RGA A;  2O9U X;  3FSD A;  2C10 A;  3VGN A;  3GRD A;  4LEH A;  3F40 A;  5D82 A;  3X3Y A;  3HK4 A;  3BNE A;  4L8O A;  3V98 A;  1CYU A;  3NBR A;  3J7Y d;  4FMC A;  5CLK A;  2W03 A;  1WMN A;  1O7G B;  1E3R A;  4I4K A;  3NQZ A;  3UL6 A;  1N8R 4;  5AIH A;  1W6G A;  3FF0 A;  2OOV A;  3LTC A;  1J2B A;  4RBN A;  4R1K A;  3SX1 A;  2QGU A;  2O3O A;  3JUP A;  5IG4 A;  1KD1 4;  3VSY A;  1STD A;  2XSO B;  2GU3 A;  3LH4 A;  4G1M B;  3V99 A;  1Q7Y 4;  3NM7 A;  1IVX A;  3STD A;  3FCS B;  3OWU A;  3FG3 A;  1W7C A;  4AEQ A;  2GU1 A;  2XR8 B;  3BLZ A;  1JJ2 2;  4KFF A;  5KP4 A;  3KE7 A;  4N6M A;  3CNX A;  1YGE A;  2BMO B;  3PCR A;  1PFP A;  1TP6 A;  3CXC 2;  2CWV A;  3FH1 A;  5TGN A;  3CC2 3;  1FGO A;  1KQS 2;  1M9G A;  2OWP A;  4O3V A;  1LVN A;  4K90 B;  1M1K 4;  2V1L A;  3JUN A;  3NUV A;  2Q07 A;  2ML6 A;  4MMX B;  1SPU A;  2Y73 A;  4KZ1 A;  3PCS A;  2CK3 H;  1L5G B;  3FG4 A;  1QAL A;  3JUQ A;  1GYB A;  2GBX B;  4XB5 A;  3EF8 A;  3QK9 A;  1IQY A;  1EKM A;  3X41 A;  3K5T A;  1RN7 A;  3KKG A;  2CH9 A;  3EBT A;  3K0Z A;  1SQW A;  5IG3 A;  2MC8 A;  1EQK A;  1IK3 A;  2M7O A;  3MPH A;  5JPP A;  2KCD A;  1DMM A;  2IA7 A;  3GWR A;  2XEP A;  1IV9 A;  3IJE B;  1Q42 A;  1A2K A;  3F7S A;  2JQ5 A;  3DZL A;  1FGR A;  3K9M C;  1RJO A;  3L0R A;  8CHO A;  1ISK A;  1AVK A;  4OK0 A;  2QEX 3;  1TFK A;  4CDL A;  4HM5 B;  3LT8 A;  3K63 A;  3CCM 3;  3MSO A;  2GEX A;  4HM0 B;  5EVH A;  3GZR A;  1OH0 A;  2CIU A;  1AV4 A;  3F8H A;  4FCZ A;  3GZY B;  3N8B A;  4LSO A;  4HM7 B;  4CCV A;  1O7H B;  1RRL A;  4HKV B;  1Q40 A;  2D42 A;  3DGM A;  2YFI B;  4WP5 A;  4HZB B;  5AYS C;  3H51 A;  1IDP A;  1EG9 B;  5FW5 A;  3S5C A;  3NV0 A;  3DGL A;  4N6V 0;  1CQS A;  5D83 A;  3M8C A;  3SOA A;  1EA2 A;  3NXJ A;  5KP3 A;  1OAC A;  1VQK 3;  3I56 3;  2YX9 A;  1D6Y A;  3CCE 3;  1PU4 A;  2I9W A;  4RNZ A;  4O02 B;  1STF I;  3AMO B;  3EB8 A;  3KFQ C;  3Q90 A;  2LYX A;  2W6J H;  3F14 A;  2P09 A;  3SXX A;  4EC6 A;  4FMB A;  2CHC A;  1GD4 A;  5FGO A;  1QVF 2;  5D81 A;  2E2T A;  1LOX A;  3IMA B;  1DMN A;  1Q40 B;  3FG1 A;  1D6U A;  1Z1S A;  2CWT A;  2IMJ A;  1M90 4;  1GS3 A;  4STD A;  3VF1 A;  1VQ5 3;  1ZO2 A;  3FGY A;  2HMM B;  3DMC A;  2UX0 A;  3GZB A;  4J8T A;  3UNL A;  1GD3 A;  1UI8 A;  1TUH A;  3KSE D;  3HZP A;  1K28 A;  1W2Z A;  2W9P A;  1JN5 A;  4N6U A;  1N9J A;  4HM1 B;  3FZW A;  2Z77 A;  1O7M B;  4OVM A;  1A67 A;  3I0Y A;  2MF7 A;  4FR9 A;  2OCT A;  3UL5 A;  3GZX B;  3DY5 A;  3JUO A;  5CXO A;  4K1V A;  3X42 A;  2CFW A;  3CPO A;  3OWS A;  1NU3 A;  3UJM A;  2FNQ A;  3NX0 A;  1W00 A;  4HBR A;  4AKZ A;  1VQ8 3;  3CME 3;  3S28 A;  1W2B 2;  1NB5 I;  1AVL A;  3LTD A;  1MOL A;  2FXT A;  4PEJ A;  1CYV A;  1Q81 4;  4O2H A;  3OWY A;  5AIF A;  5IW9 A;  3FLJ A;  1G96 A;  1N9E A;  2WGQ A;  3G71 3;  1DVD A;  4FCJ A;  2W9Q A;  1JKG A;  3DGO A;  1UUV B;  3LZA A;  3MG2 A;  1Q86 4;  3CD6 3;  5EQL A;  2RSX A;  3SED A;  1YJN 3;  4HM6 B;  1IU7 A;  3X40 A;  4EV5 A;  1O7P B;  5LC6 A;  4EXR A;  4TX4 A;  4R9K A;  1QAK A;  1FA3 A;  1AR0 A;  2PZV A;  1YJW 3;  1ASK A;  2BHM A;  3OV4 A;  5ELU A;  5ELJ A;  1R4C A;  4ORL A;  2R4I A;  2PNC A;  1S5A A;  3D9R A;  4GL6 A;  3CCQ 3;  1KSI A;  3HII A;  1VQL 3;  5AIG A;  1BUQ A;  4KFD A;  4OUQ A;  3PXM A;  4LZI A;  4X2O A;  2ZL8 A;  5DRE A;  5EEO A;  1WMO A;  4RNY A;  5JPU A;  1NDO B;  3RDE A;  3S27 A;  2W04 A;  3EC9 A;  3MG3 A;  2STD A;  1MNL A;  2BMQ B;  3KZT A;  3MKI A;  2KRT A;  2Z7A A;  4WFO A;  4Q53 A;  3NBJ A;  2BT3 A;  4K61 A;  2HMJ B;  4L7K A;  2CFK A;  2C11 A;  4HM8 B;  2GEY A;  1OCV A;  1HKX A;  1QMA A;  3CC7 3;  1FGT A;  4N6L A;  4XDV A;  4LMI A;  1D6Z A;  3MHE A;  2XGN A;  2B1X B;  3FKA A;  2OTJ 3;  3EQQ B;  5AEW B;  1Q82 4;  5AII A;  3T8N A;  1FGM A;  5IG0 A;  3JVC A;  5AYR B;  4H3U A;  3TDG A;  4EYC A;  4HYZ A;  3WDG B;  1K8A 4;  1C7H A;  2GXF A;  3CCU 3;  3HX8 A;  2HMK B;  3PYJ A;  4H61 A;  3CPW 2;  1FGQ A;  1RRH A;  3MG1 A;  3WOD G;  3G8Z A;  4WYK A;  6STD A;  3DM8 A;  5IEO A;  1US1 A;  1VQN 3;  3B4O A;  1JRQ A;  3BB9 A;  3O8Y A;  1OHS A;  1VQP 3;  1OF5 A;  2E2V A;  2B24 B;  1W5Z A;  5BXQ A;  5G2G A;  3CCR 3;  4HVN A;  2CW9 A;  5AEU B;  1NWW A;  1LNH A;  4LGQ A;  1E97 A;  1IQ8 A;  1NO3 A;  3UB1 A;  2HMO B;  2OOV C;  2XFS A;  5HGR A;  1YHQ 3;  3OXA A;  1IQX A;  1FUW A;  5IER A;  3CCL 3;  1JV2 B;  1QJG A;  4QWT A;  1OPY A;  3U1W A;  2RGQ A;  5STD A;  1KC8 4;  3E99 A;  5BVB A;  3LTA A;  4GB5 A;  1JB5 A;  3EJV A;  1VQ7 3;  2GBW B;  1S72 3;  1IVW A;  2XFT A;  1ROA A;  2P05 A;  2ZDJ A;  4BTW A;  2XRX B;  4N6T A;  2CWU A;  5JBS A;  4HZ9 B;  3KII A;  4FMA A;  1VQ9 3;  1K41 A;  3EN1 B;  4ZM8 A;  2XH9 A;  3G6E 3;  1IVV A;  1E3V A;  1OF5 B;  1W01 A;  1WNH A;  1JB4 A;  4JF8 A;  3NV0 B;  3WMD A;  3OX9 A;  1W4N A;  4HM4 B;  5IG5 A;  2F98 A;  1UI7 A;  4FCM A;  3EN8 A;  2YFL B;  2JDI H;  1K9M 4;  1V74 A;  3D3L A;  1YI2 3;  1WQL B;  1IV7 A;  2XSH B;  1W6Y A;  4U13 A;  4N6O B;  4R9L A;  3WOE B;  2Z76 A;  3DGN A;  2BMR B;  3U97 A;  1TIJ A;  1N5P A;  2SBL A;  3Q1C A;  5LC7 A;  4NHF A;  2RCD A;  5IEN A;  3I55 3;  1IT8 A;  3LT9 A;  3EHC A;  2BO9 B;  2OQE C;  3LXU X;  4X2H A;  1Y4K A;  3X3Z A;  5I97 A;  2ML5 A;  3NM2 A;  4XBT A;  1K73 4;  4FMD A;  4XDW A;  1KWI A;  1OGX A;  3MYT A;  2XGL A;  1IT7 A;  2IUJ A;  3SOY A;  2L4V A;  1YIJ 3;  1JN5 B;  1OHP A;  3SVA A;  2RFR A;  3ECF A;  3PZW A;  2WO0 A;  2YFJ B;  3V92 A;  1WTH A;  3LML A;  1JB2 A;  1UUW B;  3Q2P A;  3N9H A;  5CK6 A;  5IEP A;  3A76 A;  3K7C A;  4WHA A;  3ALA A;  3WOF B;  5CF1 A;  2CFG A;  3CNM A;  1N5H A;  2XF3 A;  3BNC A;  3H3H A;  1ZX2 A;  3T0U A;  1GY5 A;  3S29 A;  3BND A;  3NBB A;  3DUK A;  4KVH A;  4RZM A;  4AKY A;  1VZZ A;  3CCS 3;  1HU9 A;  1YIT 3;  3F7X A;  1JKG B;  2A15 A;  1VQM 3;  4MJD A;  2INX A;  1YJ9 3;  4XM4 A;  2CG1 A;  3IPT A;  2Z6B A;  3HI7 A;  2OQE A;  4N3V A;  2P0X A;  2QA4 3;  3PS8 A;  4MMZ B;  1U5O A;  2WOF A;  1VQO 3;  3G0K A;  1F8N A;  2HMN B;  2CC3 A;  1U8C B;  3CC4 3;  3ROB A;  1W02 A;  3NHX A;  4MMY B;  1GY7 A;  1YVB I;  3G16 A;  1SII A;  1OUN A;  2F86 B;  4MEI A;  1M1X B;  3BNB A;  3LTB A;  4K1U A;  1SJW A;  2KXG A;  1DMQ A;  1CEW I;  3CCV 3;  2IUK A;  4IT7 A;  4BTX A;  1QVG 2;  4IPB A;  5DRV A;  2K0M A;  2WOH A;  3SLU A;  2LQV A;  2W0Q A;  1QAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...