4N6MA

Crystal structure of human cystatin e/m produced in lexsy
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
117
structure length
117
Chain Sequence
RMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanism of an aspartimide-dependent Peptide ligase in human legumain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor
molecule keywords Cystatin-M
total genus 22
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4n6mA00
3UL6A 3LH4A 1G96A 5EQLA 1N9JA 3IMAB 1MOLA 4CCVA 4ZM8A 1M9GA 1IV9A 3NX0A 4N6OB 4N6UA 5LC6A 1DVDA 1DVCA 1FUWA 5ELJA 3SVAA 1WNHA 1GD4A 5LC7A 3S67A 3MWZA 4IT7A 1R4CA 1CEWI 1YVBI 1STFI 3QRDA 3Q2PA 1NB5I 2CH9A 3KSED 1N5PA 2BO9B 1CYUA 1PFPA 1EQKA 3K9MC 1RN7A 3GAXA 1IV7A 1CYVA 2OCTA 1NB3I 1LXEA 2W9QA 3PS8A 4N6TA 1ROAA 3L0RA 1GD3A 3KFQC 4N6LA 2KXGA 4TX4A 5ELUA 4EYCA 3PYJA 3UL5A 4LZIA 1KWIA 2O9UX 1A67A 3PXMA 5A0OB 1FA3A 2W9PA 4N6MA 1N5HA 4N6V0 4N6NB 1A90A 1TIJA 1MNLA
chains in the Genus database with same CATH superfamily
2UGIA 1TJDA 3D5GA 4HM5B 5IF6A 3NX0A 1VQ43 3DM8A 1MWSA 1JBTA 1DVDA 2E2TA 3MWZA 1OF5B 1RRHA 2V1LA 4KVHA 6GSPA 2OTJ3 2CH9A 3KSPA 1EG9B 3NM7A 3MG1A 1W6CA 3EC9A 1UUVB 3Q1CA 1WMOA 1RNBA 4DKIA 1YNVX 3NQZA 1IV7A 1US1A 4EBGA 1VQM3 5JPUA 1LXEA 3IJEB 1K734 3PS8A 3RNTA 2M7OA 2KF3A 5EVHA 1FUTA 3HX8A 2KF4A 4FMDA 3HOHA 2CFGA 3FZWA 4HAAA 5FGOA 5CXOA 3RDEA 1D6UA 6RNTA 1I2EA 2P0XA 2Z6BA 1JB4A 1J2BA 1YJW3 4OUQA 1X1YA 1GYBA 1D6ZA 3MKIA 2UUGC 3BU4A 2HMLB 5AIIA 1SJWA 2GEXA 2Q07A 1OGZA 4CDLA 2Y73A 4BL3A 4GSPA 4G1MB 1I0XA 3CCE3 1BRNL 2W03A 3CCS3 3EF8A 5RNTA 1FGRA 2L4VA 1YHQ3 1OF5A 3RGRA 2HMJB 3X3ZA 4STDA 1JZOA 4EYCA 2OOVA 4HM1B 3G4S3 3FG3A 2CWUA 4LGQA 3DXOA 2W9PA 1B2UA 4XDWA 2RNTA 4HM6B 4N6V0 2CX0A 2F99A 1VQ63 4WYKA 3M8CA 4BU4A 5I97A 2P0MA 1O7MB 3CCV3 3AHSA 1MWRA 2STDA 3X40A 2IA7A 3LT9A 1FYSA 3H3HA 3F8XA 5LC7A 3S67A 1VQO3 1S5AA 1CEWI 1YVBI 2GXFA 3KE7A 1ROVA 2Y74A 4RNYA 3UJMA 1Q7HA 1GOUA 1Q824 3CC43 3T8UA 1EQKA 2GU3A 1LVNA 3EQQB 3FG1A 5HOHA 9RNTA 2BMOB 1RCLA 3FH1A 1W2ZA 1GS3A 3K63A 1T5YA 3LTDA 1PY3A 3IPTA 2R4IA 1EKMA 5FW5A 1BSBA 4J8TA 5ELUA 2XGNA 3KZTA 4FR9A 1RLSA 3PXMA 1JBRA 1TU5A 1N5HA 2F86B 3STDA 4N6NB 2HMMB 3D79A 1BUJA 1IT7A 1T3BA 2E2VA 2W2CA 3GAXA 3NBJA 2WGQA 2D42A 1GMPA 3F40A 4O02B 4ZM8A 3CU3A 1GSPA 4N6UA 1IVXA 1OHSA 1BSCA 3F14A 4Q53A 3CNMA 1JN5A 1A2PA 3F9SA 1M1K4 3GZYB 2J8XB 3ZG5A 3CCM3 4K90B 1RSNA 1BANA 2XR8B 2ZHXB 3AHWA 2KF6A 2P09A 1VQN3 1L5GB 1GOYA 4KFEA 1ROAA 2HOHA 3K7CA 5BU4A 1NDOB 1YJ93 4R1KA 1RGFA 3EBYA 1AR0A 2OOVC 3DGOA 1I8VA 3MSOA 4O2HA 4N6MA 3WA3A 4RZMA 1HU9A 2A15A 4HBRA 5DREA 4NHFA 2Z77A 3EE1A 2FNQA 3EJVA 1TRPA 2WGOA 5D83A 1AVKA 3CPW2 3WA2X 4EW5A 3JUQA 4IPBA 3DGYA 3VSYA 1AQZA 3MPHA 3KIIA 3B8LA 1STFI 1UGIA 3S29A 1NJI4 4I5QA 5AYRB 3BIRA 1N5PA 4MEIA 1IQXA 2KCDA 1JN5B 3NBRA 2BT3A 1N9EA 1UCJA 3FF0A 3CPOA 5JPPA 4FCZA 2ZDJA 3K5TA 3LT8A 5DRVA 1Q864 3OWSA 2QIYA 1LNIA 4BTYA 5M1AA 4K1UA 1KQS2 1ULJB 1ZX2A 3SX1A 1BRIA 1TTOA 4LYLB 2ZL8A 4KFFA 1BNFA 5AEUB 1B2ZA 5D82A 3N54B 1BSDA 1Q42A 2XGLA 2CG1A 1IT8A 3SYUA 1DVCA 1ZGXA 2W6JH 4MMYB 1I0VA 3X3XA 1DMNA 2CFDA 2OQEC 5GSPA 1M904 1VQ93 1IQYA 2C11A 1FUSA 1YVSA 1IK3A 5HGRA 3WMDA 1A2KA 1RGEA 1B2SA 3F8HA 5AEWB 3DGMA 3QK9A 5IEOA 1G02A 2BU4A 3KKGA 1OUNA 1RCKA 4GB5A 3G6E3 1HZ1A 1IVVA 4J5GA 1TFOA 4XBTA 5G1KA 1BNJA 1RMSA 3CMA3 1GY6A 1VQ83 2L1SA 1SQWA 3FG4A 3OX9A 1PU4A 2KRTA 1KSIA 2K0MA 1BAOA 4LMIA 3X3YA 1O7NB 3WDGB 2P05A 1Q814 5TGNA 1MGRA 2WOFA 4N6OB 5BXQA 4KT3B 1UCIA 2HMOB 1FUWA 2JQ5A 4L8OA 1O7PB 2CFKA 2H0HA 3OWUA 4HVNA 1Q40B 1QVF2 2CFWA 4CJNA 2QGUA 4MJDA 3DUKA 1Y4KA 1CH0A 1NO3A 3FSDA 4N6TA 3CCL3 3NHXA 1VQP3 1W7CA 1YIJ3 3OV4A 2B1XB 3MHEA 4KFDA 1OH0A 4I4KA 4RNTA 1K9M4 1A2VA 2FXTA 5JBSA 1KD14 1DE3A 5A0OB 1UDII 1W6YA 1I3IA 4L7KA 3ALAA 3DZLA 4NPBA 1IDPA 3CCJ3 5IENA 1T2IA 3FLJA 1BOXA 1W02A 4FMAA 1E3VA 2RSXA 3B7CA 4EXRA 1WNHA 3CCR3 3AMOB 2FGTA 3MYTA 5IG4A 3CME3 3LZAA 3VGNA 1I2GA 3JUOA 3LYGA 1QAKA 1CQSA 1BNEA 5M19A 1BVIA 1RN7A 3VF1A 1RGHA 1HYFA 1NB3I 4J5KA 1B2MA 1TUHA 1IVWA 5D81A 1LNHA 1AV4A 3KFQC 1AY7A 4TX4A 2XSOB 1UI8A 3AGOA 5EEOA 3LTAA 3BLZA 1MWUA 3GSPA 1B27A 2XRXB 3N9HA 3E99A 4IIAA 4NREA 3S5CA 2JDIH 1IYYA 2F56A 1RTUA 3GZBA 5IG0A 2ML6A 3CCQ3 1E97A 1M9GA 1V58A 1VQQA 2OQEA 3G713 1UI7A 3ROBA 3A76A 1U5OA 4HM7B 4FMBA 3EHCA 1JB2A 1X1UA 4AKYA 1Z1SA 3AMOA 1EA2A 3FF2A 4U13A 4XM4A 2INXA 3B4PA 1BU4A 4K1VA 4H61A 2MF7A 4N6LA 4OVMA 1QJGA 2AAEA 2XF3A 3KN4A 3UL5A 2Z7AA 2O9UX 2W56A 2P38A 2W0QA 3CCU3 4AKZA 3TDGA 3X42A 1RRLA 3MG2A 2YFJB 2IMJA 3CXC2 1JBSA 2IUKA 4CPKA 4WHAA 4MMZB 1O7WB 2RCDA 1BNIA 1RDSA 1RGLA 2GU1A 7STDA 5IEPA 1BRHA 4IT7A 1LQMB 3HI7A 4HM0B 3U97A 2BMRB 3D4AA 4N3VA 2CWVA 3BNCA 1LRAA 2CX1A 4RNZA 3SOAA 3LXUX 1WQLB 5KP4A 5M18A 1C7HA 3URPA 4R9LA 5BIRA 4R4KA 1LOVA 2F5WA 3BNBA 1DMQA 3SEDA 1FW7A 2WO0A 3G8ZA 3DGNA 2BMQB 1OGXA 1BRKA 3NXJA 1OACA 2R41A 4ILFA 4GHOA 1UUWB 2IUJA 1U8CB 3NV0B 2BNGA 2CWTA 4QWTA 2LQVA 1BIRA 3EBTA 1BGSA 2H0IA 1W00A 3UL6A 2D1WA 4RBNA 1FGTA 2OWPA 2RFRA 1STDA 3SLUA 2SARA 3KCHA 5KP1A 3CD63 1E3RA 3SVAA 1JNQA 1DETA 1UGHI 3Q3FA 2C4BA 2K3DA 4FMCA 5IERA 1EEJA 3D3LA 3DY5A 1TFKA 4K61A 3CNXA 5AIGA 6STDA 3NQYA 4XBXA 1CYVA 3GWRA 3GZRA 4HM3B 4JF8A 3AGNA 5STDA 3O8YA 3S28A 3DH2A 2GEYA 4X2HA 1W5ZA 2BIRA 1GD3A 3D5IA 4MMXB 4H3UA 4OK0A 1RN4A 1FZUA 2MC8A 1RKYA 1RGCA 2ML5A 1K8A4 3NUVA 3ZFZA 1B20A 1GY5A 4EC6A 3T8NA 3EX9A 4HM4B 4HM8B 1F8NA 3V99A 1G96A 1IVUA 1WMNA 2F4YA 2B24B 2YFIB 3HZPA 1BNSA 4HJLB 4R9KA 3JVCA 1Q40A 3I563 1O7GB 3ZG0A 1KC84 1N8R4 2HMKB 3QRDA 1VZZA 1VQ53 1JB5A 3OWYA 1B21A 1W4NA 1JKGB 1QAFA 3ER7A 3LTBA 4XDVA 3WOFB 1RHLA 1SIHA 2CK3H 3BNDA 2RBIA 3N8BA 3WODG 4HKVB 5CK6A 4WFOA 4HM2B 2GBWB 4FCJA 3LTCA 3PYJA 2XFSA 5CLKA 4LZIA 2AADA 4XB5A 1FGQA 4BTWA 1JRQA 3OW22 1VQ73 1GMQA 2UX0A 1VQL3 2KF5A 3Q90A 2CIUA 3RGAA 1HKXA 3I0YA 1S723 4BIRA 1IQ8A 1BRSA 5G2GA 3UNLA 2GSPA 2CHCA 4BTXA 3K0ZA 1G0TA 2K54A 2GBXB 2BHMA 1R4CA 3A5EA 3SOYA 1EUIC 1N8QA 2E2UA 5AYSC 1BRJA 1LQGC 2BO9B 1OCVA 1ULIB 2YFLB 3K9MC 1K41A 1VQK3 1QALA 1YGEA 4ORLA 3EB8A 5G1LA 1BRGA 1O7HB 2XSHB 3GZXB 1JKGA 1X1WA 7GSPA 1MGWA 1RGAA 5IG5A 3ECFA 1ISKA 4O3VA 1B2XA 2KXGA 3F7SA 1UCKA 2IY2A 2H0GA 1SPUA 2LYXA 3B4OA 4XBYA 3OXAA 4J9AA 3FCSB 1QMAA 1I2FA 1ZO2A 3S27A 2SBLA 3SXXA 1A90A 1M1XB 1BNGA 1WMPA 3PZWA 3LH4A 5EQLA 3IMAB 3JUNA 4PEJA 1JV2B 2C10A 2ZA4A 3LOYA 4WYKB 1IU7A 4BL2A 1YJN3 2W04A 1PYLA 1OHOA 2F98A 2QA43 1RN1A 1GD4A 1OPYA 1NU3A 1Q9EA 3JUMA 2HMNB 3Q2PA 1NNVA 2QEX3 5KP3A 1PFPA 3F7XA 3DGLA 4LSOA 2KAAA 2XEPA 1TRQA 4R80A 2I9WA 3GRDA 1R4YA 2W56B 3L0RA 3WHOA 5CF1A 1UCLA 3CC23 1RNTA 4HZ9B 3DMCA 3FKAA 3NBBA 5IW9A 1YI23 3HK4A 4HZBB 1V74A 2RGQA 1FA3A 1C54A 3WR2A 1UUGB 1SIIA 1MWTA 5CF2A 3MG3A 1JJ22 1DMMA 1MOLA 4CCVA 2CC3A 3WOEB 1K28A 2PNCA 3X41A 1FGOA 1NB5I 1LOWA 5AI1A 4L8PA 2OTL3 1TP6A 1BSAA 3G0KA 1BNRA 1BUQA 3EN8A 4FCMA 3D9RA 2Z76A 3V92A 3G16A 3JUPA 1QVG2 1AVLA 5AIFA 3HIIA 3NV0A 1I70A 4WP5A 1LOXA 2CG0A 2YX9A 1RJOA 4HYZA 1FGMA 3HIGA 4KZ1A 3LMLA 1B3SA 1RGKA 4EV2A 1OHPA 1TIJA 1I3FA 3PGBA 3UB1A 3PCSA 5AIHA 1MNLA 1T2HA 1GOVA 1N9JA 1IV9A 1DYUA 1W01A 2IYJA 5LC6A 2CW9A 3FGYA 4LEHA 5ELJA 3EN1B 3BB9A 1GY7A 4X2OA 1UW1A 2O3OA 1WTHA 2WOHA 3NM2A 2F5MA 2XFTA 1W6GA 1ZS7A 1NWWA 2CKFB 1D6YA 3KSED 3BNEA 3PCRA 1CYUA 1YIT3 3I553 4EV5A 1W2B2 2OCTA 3J7Yd 3H51A 7RNTA 2W9QA 5IG3A 1RGGA 4O8SA 4HOHA 4WWUC 4GL6A 5BVBA 1JZDA 1KWIA 2XH9A 3U1WA 1YGWA 1ASKA 1BSEA 3CC73 1A67A 1LOYA 8CHOA 4JRFA 1X1XA 4AEQA 1V57A 1SARA 1GMRA 1Q7Y4 3V98A 2PZVA 3T0UA 2CFLA 8RNTA
chains in the Genus database with same CATH topology
4HM5B 5IF6A 3NX0A 1VQ43 3DM8A 1DVDA 2E2TA 3MWZA 1OF5B 1RRHA 2V1LA 4KVHA 2OTJ3 2CH9A 3KSPA 1EG9B 3NM7A 3MG1A 1W6CA 3EC9A 1UUVB 3Q1CA 1WMOA 3NQZA 4EBGA 1IV7A 1US1A 1VQM3 5JPUA 1LXEA 3IJEB 1K734 3PS8A 2M7OA 5EVHA 3HX8A 4FMDA 3RDEA 2CFGA 3FZWA 5FGOA 5CXOA 1D6UA 2P0XA 2Z6BA 1JB4A 1J2BA 1YJW3 4OUQA 1GYBA 1D6ZA 3MKIA 2HMLB 5AIIA 1SJWA 2GEXA 2Q07A 1OGZA 4CDLA 2Y73A 4G1MB 3CCE3 2W03A 3CCS3 3EF8A 1FGRA 2L4VA 1YHQ3 1OF5A 3RGRA 2HMJB 3X3ZA 4STDA 4EYCA 2OOVA 4HM1B 3G4S3 3FG3A 2CWUA 4LGQA 3DXOA 2W9PA 4XDWA 4HM6B 4N6V0 2F99A 1VQ63 4WYKA 3M8CA 5I97A 2P0MA 1O7MB 3CCV3 2STDA 3X40A 2IA7A 3LT9A 3H3HA 3F8XA 5LC7A 3S67A 1VQO3 1S5AA 1CEWI 1YVBI 2GXFA 3KE7A 1ROVA 2Y74A 4RNYA 3UJMA 1Q824 3CC43 3T8UA 1EQKA 2GU3A 1LVNA 3EQQB 3FG1A 2BMOB 3FH1A 1W2ZA 1GS3A 3K63A 1T5YA 3LTDA 3IPTA 2R4IA 1EKMA 5FW5A 4J8TA 5ELUA 2XGNA 3KZTA 4FR9A 3PXMA 1TU5A 1N5HA 2F86B 3STDA 4N6NB 2HMMB 1IT7A 2E2VA 2W2CA 3NBJA 3GAXA 3I553 2WGQA 2D42A 3F40A 4O02B 4ZM8A 3CU3A 4N6UA 1IVXA 1OHSA 3F14A 4Q53A 3CNMA 1JN5A 3F9SA 1M1K4 3GZYB 3CCM3 4K90B 2XR8B 2P09A 1VQN3 1L5GB 4KFEA 1ROAA 3K7CA 1NDOB 1YJ93 4R1KA 3EBYA 1AR0A 2OOVC 3DGOA 3MSOA 3WA3A 4O2HA 4N6MA 4RZMA 1HU9A 2A15A 4HBRA 5DREA 4NHFA 2Z77A 3EJVA 3EE1A 2FNQA 2WGOA 5D83A 3CPW2 1AVKA 3WA2X 3JUQA 4IPBA 3VSYA 3MPHA 3KIIA 3B8LA 1STFI 3S29A 1NJI4 5AYRB 1N5PA 4MEIA 1IQXA 2KCDA 1JN5B 3NBRA 2BT3A 1N9EA 3FF0A 3CPOA 5JPPA 4FCZA 2ZDJA 3K5TA 3LT8A 5DRVA 1Q864 3OWSA 2QIYA 4BTYA 1KQS2 4K1UA 1ULJB 1ZX2A 3SX1A 2ZL8A 4KFFA 5AEUB 5D82A 3N54B 1Q42A 2CG1A 2XGLA 1IT8A 1DVCA 2W6JH 4MMYB 3X3XA 1DMNA 2CFDA 2OQEC 1M904 1VQ93 1IQYA 2C11A 1IK3A 5HGRA 3WMDA 1A2KA 3F8HA 5AEWB 3DGMA 3QK9A 5IEOA 3KKGA 1OUNA 4GB5A 3G6E3 1IVVA 1TFOA 4XBTA 3CMA3 1GY6A 1VQ83 3OX9A 1SQWA 3FG4A 1PU4A 2KRTA 1KSIA 2K0MA 3X3YA 4LMIA 1O7NB 3WDGB 2P05A 1Q814 5TGNA 2WOFA 4N6OB 5BXQA 2HMOB 1FUWA 2JQ5A 4L8OA 1O7PB 2CFKA 3OWUA 4HVNA 1Q40B 1QVF2 2CFWA 2QGUA 4MJDA 3DUKA 1Y4KA 1NO3A 3FSDA 4N6TA 3CCL3 3NHXA 1VQP3 1W7CA 1YIJ3 3OV4A 2B1XB 3MHEA 4KFDA 1OH0A 4I4KA 1K9M4 1A2VA 2FXTA 5JBSA 1KD14 5A0OB 1W6YA 4L7KA 3ALAA 3DZLA 1IDPA 3CCJ3 5IENA 3FLJA 1W02A 4FMAA 1E3VA 2RSXA 3B7CA 4EXRA 1WNHA 3CCR3 3AMOB 2FGTA 3MYTA 5IG4A 3CME3 3LZAA 3VGNA 3JUOA 3LYGA 1QAKA 1CQSA 1RN7A 3VF1A 1NB3I 1TUHA 1IVWA 5D81A 1LNHA 1AV4A 3KFQC 4TX4A 2XSOB 1UI8A 5EEOA 3LTAA 3BLZA 4IIAA 2XRXB 3N9HA 3E99A 4NREA 3S5CA 2JDIH 5IG0A 3GZBA 2ML6A 3CCQ3 1E97A 1M9GA 2OQEA 3G713 1UI7A 3ROBA 3A76A 1U5OA 4HM7B 4FMBA 3EHCA 1JB2A 4AKYA 1Z1SA 3AMOA 1EA2A 3FF2A 4U13A 4XM4A 2INXA 3B4PA 4K1VA 4H61A 2MF7A 4N6LA 4OVMA 1QJGA 3KN4A 2XF3A 3UL5A 2Z7AA 2O9UX 2W56A 2P38A 2W0QA 3CCU3 4AKZA 3TDGA 3X42A 1RRLA 3MG2A 2YFJB 2IMJA 3CXC2 2IUKA 4WHAA 4MMZB 1O7WB 2RCDA 2GU1A 7STDA 5IEPA 4IT7A 3HI7A 4HM0B 3U97A 2BMRB 4N3VA 2CWVA 3BNCA 3SOAA 4RNZA 3LXUX 1WQLB 1C7HA 4R9LA 4R4KA 3BNBA 1DMQA 3SEDA 2WO0A 3G8ZA 3DGNA 2BMQB 1OGXA 3NXJA 1OACA 1UUWB 2IUJA 1U8CB 3NV0B 2BNGA 2CWTA 4QWTA 2LQVA 3EBTA 1W00A 3UL6A 2D1WA 4RBNA 1FGTA 2OWPA 2RFRA 1STDA 3SLUA 5KP1A 3CD63 1E3RA 3SVAA 1JNQA 5IERA 4FMCA 3D3LA 3DY5A 1TFKA 4K61A 3CNXA 5AIGA 6STDA 3NQYA 4XBXA 1CYVA 3GWRA 3GZRA 4HM3B 4JF8A 5STDA 3S28A 3O8YA 5CF1A 4X2HA 2GEYA 1W5ZA 4MMXB 1GD3A 4OK0A 4H3UA 2MC8A 1RKYA 2ML5A 1K8A4 3NUVA 4EC6A 1GY5A 3T8NA 3EX9A 4HM4B 4HM8B 1F8NA 3V99A 1G96A 1IVUA 1WMNA 2YFIB 2B24B 4HJLB 3HZPA 4R9KA 3JVCA 1Q40A 3I563 1O7GB 1KC84 1N8R4 2HMKB 3QRDA 1VZZA 1VQ53 1JB5A 3OWYA 3ER7A 1W4NA 1JKGB 1QAFA 3LTBA 4XDVA 3WOFB 1SIHA 2CK3H 3BNDA 3N8BA 3WODG 4HKVB 5CK6A 4WFOA 4HM2B 2GBWB 4FCJA 3LTCA 3PYJA 2XFSA 5CLKA 4LZIA 4XB5A 3OW22 1FGQA 4BTWA 1JRQA 1VQ73 2UX0A 1VQL3 3Q90A 2CIUA 3RGAA 1HKXA 3I0YA 1S723 1IQ8A 5G2GA 3UNLA 2CHCA 4BTXA 3K0ZA 2K54A 2GBXB 2BHMA 1R4CA 3SOYA 1N8QA 5AYSC 2E2UA 2BO9B 1OCVA 1ULIB 2YFLB 3K9MC 1K41A 1VQK3 1QALA 1YGEA 4ORLA 3EB8A 1O7HB 3GZXB 2XSHB 5IG5A 1JKGA 1ISKA 3ECFA 4O3VA 2KXGA 3F7SA 1SPUA 2LYXA 3B4OA 4XBYA 3OXAA 4J9AA 3FCSB 1QMAA 1ZO2A 3S27A 2SBLA 3SXXA 1A90A 1M1XB 1WMPA 3PZWA 3LH4A 5EQLA 3IMAB 3JUNA 4PEJA 1JV2B 2C10A 3LOYA 1YJN3 4WYKB 1IU7A 2W04A 1OHOA 2F98A 2QA43 1GD4A 1OPYA 1NU3A 3JUMA 2HMNB 3Q2PA 2QEX3 5KP3A 1PFPA 3F7XA 3DGLA 4LSOA 2XEPA 4R80A 2I9WA 3GRDA 2W56B 3L0RA 3CC23 4HZ9B 3DMCA 3FKAA 3NBBA 5IW9A 1YI23 3HK4A 4HZBB 1V74A 2RGQA 1FA3A 1SIIA 5CF2A 3MG3A 1JJ22 1DMMA 1MOLA 4CCVA 2CC3A 3WOEB 1K28A 2PNCA 3X41A 1FGOA 1NB5I 5AI1A 4L8PA 2OTL3 1TP6A 3G0KA 1BUQA 3EN8A 4FCMA 3D9RA 2Z76A 3V92A 3G16A 3JUPA 1QVG2 1AVLA 5AIFA 3HIIA 3NV0A 4WP5A 1LOXA 2CG0A 2YX9A 1RJOA 4HYZA 1FGMA 3HIGA 4KZ1A 3LMLA 4EV2A 1OHPA 1TIJA 3PGBA 3UB1A 3PCSA 5AIHA 1MNLA 1N9JA 1IV9A 1DYUA 1W01A 5LC6A 2CW9A 3FGYA 4LEHA 5ELJA 3EN1B 3BB9A 1GY7A 4X2OA 1UW1A 2O3OA 1WTHA 2WOHA 3NM2A 5KP4A 2XFTA 1W6GA 3KSED 1NWWA 2CKFB 1D6YA 1CYUA 3BNEA 3PCRA 1YIT3 4EV5A 1W2B2 2OCTA 3J7Yd 3H51A 2W9QA 5IG3A 4O8SA 4WWUC 4GL6A 5BVBA 1KWIA 2XH9A 3U1WA 3CC73 1ASKA 1A67A 8CHOA 4JRFA 4AEQA 1Q7Y4 3V98A 2PZVA 3T0UA 2CFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UL6 A;  3LH4 A;  1G96 A;  5EQL A;  1N9J A;  3IMA B;  1MOL A;  4CCV A;  4ZM8 A;  1M9G A;  1IV9 A;  3NX0 A;  4N6O B;  4N6U A;  5LC6 A;  1DVD A;  1DVC A;  1FUW A;  5ELJ A;  3SVA A;  1WNH A;  1GD4 A;  5LC7 A;  3S67 A;  3MWZ A;  4IT7 A;  1R4C A;  1CEW I;  1YVB I;  1STF I;  3QRD A;  3Q2P A;  1NB5 I;  2CH9 A;  3KSE D;  1N5P A;  2BO9 B;  1CYU A;  1PFP A;  1EQK A;  3K9M C;  1RN7 A;  3GAX A;  1IV7 A;  1CYV A;  2OCT A;  1NB3 I;  1LXE A;  2W9Q A;  3PS8 A;  4N6T A;  1ROA A;  3L0R A;  1GD3 A;  3KFQ C;  4N6L A;  2KXG A;  4TX4 A;  5ELU A;  4EYC A;  3PYJ A;  3UL5 A;  4LZI A;  1KWI A;  2O9U X;  1A67 A;  3PXM A;  5A0O B;  1FA3 A;  2W9P A;  4N6M A;  1N5H A;  4N6V 0;  4N6N B;  1A90 A;  1TIJ A;  1MNL A; 
#chains in the Genus database with same CATH topology
 2UGI A;  1TJD A;  3D5G A;  4HM5 B;  5IF6 A;  3NX0 A;  1VQ4 3;  3DM8 A;  1MWS A;  1JBT A;  1DVD A;  2E2T A;  3MWZ A;  1OF5 B;  1RRH A;  2V1L A;  4KVH A;  6GSP A;  2OTJ 3;  2CH9 A;  3KSP A;  1EG9 B;  3NM7 A;  3MG1 A;  1W6C A;  3EC9 A;  1UUV B;  3Q1C A;  1WMO A;  1RNB A;  4DKI A;  1YNV X;  3NQZ A;  1IV7 A;  1US1 A;  4EBG A;  1VQM 3;  5JPU A;  1LXE A;  3IJE B;  1K73 4;  3PS8 A;  3RNT A;  2M7O A;  2KF3 A;  5EVH A;  1FUT A;  3HX8 A;  2KF4 A;  4FMD A;  3HOH A;  2CFG A;  3FZW A;  4HAA A;  5FGO A;  5CXO A;  3RDE A;  1D6U A;  6RNT A;  1I2E A;  2P0X A;  2Z6B A;  1JB4 A;  1J2B A;  1YJW 3;  4OUQ A;  1X1Y A;  1GYB A;  1D6Z A;  3MKI A;  2UUG C;  3BU4 A;  2HML B;  5AII A;  1SJW A;  2GEX A;  2Q07 A;  1OGZ A;  4CDL A;  2Y73 A;  4BL3 A;  4GSP A;  4G1M B;  1I0X A;  3CCE 3;  1BRN L;  2W03 A;  3CCS 3;  3EF8 A;  5RNT A;  1FGR A;  2L4V A;  1YHQ 3;  1OF5 A;  3RGR A;  2HMJ B;  3X3Z A;  4STD A;  1JZO A;  4EYC A;  2OOV A;  4HM1 B;  3G4S 3;  3FG3 A;  2CWU A;  4LGQ A;  3DXO A;  2W9P A;  1B2U A;  4XDW A;  2RNT A;  4HM6 B;  4N6V 0;  2CX0 A;  2F99 A;  1VQ6 3;  4WYK A;  3M8C A;  4BU4 A;  5I97 A;  2P0M A;  1O7M B;  3CCV 3;  3AHS A;  1MWR A;  2STD A;  3X40 A;  2IA7 A;  3LT9 A;  1FYS A;  3H3H A;  3F8X A;  5LC7 A;  3S67 A;  1VQO 3;  1S5A A;  1CEW I;  1YVB I;  2GXF A;  3KE7 A;  1ROV A;  2Y74 A;  4RNY A;  3UJM A;  1Q7H A;  1GOU A;  1Q82 4;  3CC4 3;  3T8U A;  1EQK A;  2GU3 A;  1LVN A;  3EQQ B;  3FG1 A;  5HOH A;  9RNT A;  2BMO B;  1RCL A;  3FH1 A;  1W2Z A;  1GS3 A;  3K63 A;  1T5Y A;  3LTD A;  1PY3 A;  3IPT A;  2R4I A;  1EKM A;  5FW5 A;  1BSB A;  4J8T A;  5ELU A;  2XGN A;  3KZT A;  4FR9 A;  1RLS A;  3PXM A;  1JBR A;  1TU5 A;  1N5H A;  2F86 B;  3STD A;  4N6N B;  2HMM B;  3D79 A;  1BUJ A;  1IT7 A;  1T3B A;  2E2V A;  2W2C A;  3GAX A;  3NBJ A;  2WGQ A;  2D42 A;  1GMP A;  3F40 A;  4O02 B;  4ZM8 A;  3CU3 A;  1GSP A;  4N6U A;  1IVX A;  1OHS A;  1BSC A;  3F14 A;  4Q53 A;  3CNM A;  1JN5 A;  1A2P A;  3F9S A;  1M1K 4;  3GZY B;  2J8X B;  3ZG5 A;  3CCM 3;  4K90 B;  1RSN A;  1BAN A;  2XR8 B;  2ZHX B;  3AHW A;  2KF6 A;  2P09 A;  1VQN 3;  1L5G B;  1GOY A;  4KFE A;  1ROA A;  2HOH A;  3K7C A;  5BU4 A;  1NDO B;  1YJ9 3;  4R1K A;  1RGF A;  3EBY A;  1AR0 A;  2OOV C;  3DGO A;  1I8V A;  3MSO A;  4O2H A;  4N6M A;  3WA3 A;  4RZM A;  1HU9 A;  2A15 A;  4HBR A;  5DRE A;  4NHF A;  2Z77 A;  3EE1 A;  2FNQ A;  3EJV A;  1TRP A;  2WGO A;  5D83 A;  1AVK A;  3CPW 2;  3WA2 X;  4EW5 A;  3JUQ A;  4IPB A;  3DGY A;  3VSY A;  1AQZ A;  3MPH A;  3KII A;  3B8L A;  1STF I;  1UGI A;  3S29 A;  1NJI 4;  4I5Q A;  5AYR B;  3BIR A;  1N5P A;  4MEI A;  1IQX A;  2KCD A;  1JN5 B;  3NBR A;  2BT3 A;  1N9E A;  1UCJ A;  3FF0 A;  3CPO A;  5JPP A;  4FCZ A;  2ZDJ A;  3K5T A;  3LT8 A;  5DRV A;  1Q86 4;  3OWS A;  2QIY A;  1LNI A;  4BTY A;  5M1A A;  4K1U A;  1KQS 2;  1ULJ B;  1ZX2 A;  3SX1 A;  1BRI A;  1TTO A;  4LYL B;  2ZL8 A;  4KFF A;  1BNF A;  5AEU B;  1B2Z A;  5D82 A;  3N54 B;  1BSD A;  1Q42 A;  2XGL A;  2CG1 A;  1IT8 A;  3SYU A;  1DVC A;  1ZGX A;  2W6J H;  4MMY B;  1I0V A;  3X3X A;  1DMN A;  2CFD A;  2OQE C;  5GSP A;  1M90 4;  1VQ9 3;  1IQY A;  2C11 A;  1FUS A;  1YVS A;  1IK3 A;  5HGR A;  3WMD A;  1A2K A;  1RGE A;  1B2S A;  3F8H A;  5AEW B;  3DGM A;  3QK9 A;  5IEO A;  1G02 A;  2BU4 A;  3KKG A;  1OUN A;  1RCK A;  4GB5 A;  3G6E 3;  1HZ1 A;  1IVV A;  4J5G A;  1TFO A;  4XBT A;  5G1K A;  1BNJ A;  1RMS A;  3CMA 3;  1GY6 A;  1VQ8 3;  2L1S A;  1SQW A;  3FG4 A;  3OX9 A;  1PU4 A;  2KRT A;  1KSI A;  2K0M A;  1BAO A;  4LMI A;  3X3Y A;  1O7N B;  3WDG B;  2P05 A;  1Q81 4;  5TGN A;  1MGR A;  2WOF A;  4N6O B;  5BXQ A;  4KT3 B;  1UCI A;  2HMO B;  1FUW A;  2JQ5 A;  4L8O A;  1O7P B;  2CFK A;  2H0H A;  3OWU A;  4HVN A;  1Q40 B;  1QVF 2;  2CFW A;  4CJN A;  2QGU A;  4MJD A;  3DUK A;  1Y4K A;  1CH0 A;  1NO3 A;  3FSD A;  4N6T A;  3CCL 3;  3NHX A;  1VQP 3;  1W7C A;  1YIJ 3;  3OV4 A;  2B1X B;  3MHE A;  4KFD A;  1OH0 A;  4I4K A;  4RNT A;  1K9M 4;  1A2V A;  2FXT A;  5JBS A;  1KD1 4;  1DE3 A;  5A0O B;  1UDI I;  1W6Y A;  1I3I A;  4L7K A;  3ALA A;  3DZL A;  4NPB A;  1IDP A;  3CCJ 3;  5IEN A;  1T2I A;  3FLJ A;  1BOX A;  1W02 A;  4FMA A;  1E3V A;  2RSX A;  3B7C A;  4EXR A;  1WNH A;  3CCR 3;  3AMO B;  2FGT A;  3MYT A;  5IG4 A;  3CME 3;  3LZA A;  3VGN A;  1I2G A;  3JUO A;  3LYG A;  1QAK A;  1CQS A;  1BNE A;  5M19 A;  1BVI A;  1RN7 A;  3VF1 A;  1RGH A;  1HYF A;  1NB3 I;  4J5K A;  1B2M A;  1TUH A;  1IVW A;  5D81 A;  1LNH A;  1AV4 A;  3KFQ C;  1AY7 A;  4TX4 A;  2XSO B;  1UI8 A;  3AGO A;  5EEO A;  3LTA A;  3BLZ A;  1MWU A;  3GSP A;  1B27 A;  2XRX B;  3N9H A;  3E99 A;  4IIA A;  4NRE A;  3S5C A;  2JDI H;  1IYY A;  2F56 A;  1RTU A;  3GZB A;  5IG0 A;  2ML6 A;  3CCQ 3;  1E97 A;  1M9G A;  1V58 A;  1VQQ A;  2OQE A;  3G71 3;  1UI7 A;  3ROB A;  3A76 A;  1U5O A;  4HM7 B;  4FMB A;  3EHC A;  1JB2 A;  1X1U A;  4AKY A;  1Z1S A;  3AMO A;  1EA2 A;  3FF2 A;  4U13 A;  4XM4 A;  2INX A;  3B4P A;  1BU4 A;  4K1V A;  4H61 A;  2MF7 A;  4N6L A;  4OVM A;  1QJG A;  2AAE A;  2XF3 A;  3KN4 A;  3UL5 A;  2Z7A A;  2O9U X;  2W56 A;  2P38 A;  2W0Q A;  3CCU 3;  4AKZ A;  3TDG A;  3X42 A;  1RRL A;  3MG2 A;  2YFJ B;  2IMJ A;  3CXC 2;  1JBS A;  2IUK A;  4CPK A;  4WHA A;  4MMZ B;  1O7W B;  2RCD A;  1BNI A;  1RDS A;  1RGL A;  2GU1 A;  7STD A;  5IEP A;  1BRH A;  4IT7 A;  1LQM B;  3HI7 A;  4HM0 B;  3U97 A;  2BMR B;  3D4A A;  4N3V A;  2CWV A;  3BNC A;  1LRA A;  2CX1 A;  4RNZ A;  3SOA A;  3LXU X;  1WQL B;  5KP4 A;  5M18 A;  1C7H A;  3URP A;  4R9L A;  5BIR A;  4R4K A;  1LOV A;  2F5W A;  3BNB A;  1DMQ A;  3SED A;  1FW7 A;  2WO0 A;  3G8Z A;  3DGN A;  2BMQ B;  1OGX A;  1BRK A;  3NXJ A;  1OAC A;  2R41 A;  4ILF A;  4GHO A;  1UUW B;  2IUJ A;  1U8C B;  3NV0 B;  2BNG A;  2CWT A;  4QWT A;  2LQV A;  1BIR A;  3EBT A;  1BGS A;  2H0I A;  1W00 A;  3UL6 A;  2D1W A;  4RBN A;  1FGT A;  2OWP A;  2RFR A;  1STD A;  3SLU A;  2SAR A;  3KCH A;  5KP1 A;  3CD6 3;  1E3R A;  3SVA A;  1JNQ A;  1DET A;  1UGH I;  3Q3F A;  2C4B A;  2K3D A;  4FMC A;  5IER A;  1EEJ A;  3D3L A;  3DY5 A;  1TFK A;  4K61 A;  3CNX A;  5AIG A;  6STD A;  3NQY A;  4XBX A;  1CYV A;  3GWR A;  3GZR A;  4HM3 B;  4JF8 A;  3AGN A;  5STD A;  3O8Y A;  3S28 A;  3DH2 A;  2GEY A;  4X2H A;  1W5Z A;  2BIR A;  1GD3 A;  3D5I A;  4MMX B;  4H3U A;  4OK0 A;  1RN4 A;  1FZU A;  2MC8 A;  1RKY A;  1RGC A;  2ML5 A;  1K8A 4;  3NUV A;  3ZFZ A;  1B20 A;  1GY5 A;  4EC6 A;  3T8N A;  3EX9 A;  4HM4 B;  4HM8 B;  1F8N A;  3V99 A;  1G96 A;  1IVU A;  1WMN A;  2F4Y A;  2B24 B;  2YFI B;  3HZP A;  1BNS A;  4HJL B;  4R9K A;  3JVC A;  1Q40 A;  3I56 3;  1O7G B;  3ZG0 A;  1KC8 4;  1N8R 4;  2HMK B;  3QRD A;  1VZZ A;  1VQ5 3;  1JB5 A;  3OWY A;  1B21 A;  1W4N A;  1JKG B;  1QAF A;  3ER7 A;  3LTB A;  4XDV A;  3WOF B;  1RHL A;  1SIH A;  2CK3 H;  3BND A;  2RBI A;  3N8B A;  3WOD G;  4HKV B;  5CK6 A;  4WFO A;  4HM2 B;  2GBW B;  4FCJ A;  3LTC A;  3PYJ A;  2XFS A;  5CLK A;  4LZI A;  2AAD A;  4XB5 A;  1FGQ A;  4BTW A;  1JRQ A;  3OW2 2;  1VQ7 3;  1GMQ A;  2UX0 A;  1VQL 3;  2KF5 A;  3Q90 A;  2CIU A;  3RGA A;  1HKX A;  3I0Y A;  1S72 3;  4BIR A;  1IQ8 A;  1BRS A;  5G2G A;  3UNL A;  2GSP A;  2CHC A;  4BTX A;  3K0Z A;  1G0T A;  2K54 A;  2GBX B;  2BHM A;  1R4C A;  3A5E A;  3SOY A;  1EUI C;  1N8Q A;  2E2U A;  5AYS C;  1BRJ A;  1LQG C;  2BO9 B;  1OCV A;  1ULI B;  2YFL B;  3K9M C;  1K41 A;  1VQK 3;  1QAL A;  1YGE A;  4ORL A;  3EB8 A;  5G1L A;  1BRG A;  1O7H B;  2XSH B;  3GZX B;  1JKG A;  1X1W A;  7GSP A;  1MGW A;  1RGA A;  5IG5 A;  3ECF A;  1ISK A;  4O3V A;  1B2X A;  2KXG A;  3F7S A;  1UCK A;  2IY2 A;  2H0G A;  1SPU A;  2LYX A;  3B4O A;  4XBY A;  3OXA A;  4J9A A;  3FCS B;  1QMA A;  1I2F A;  1ZO2 A;  3S27 A;  2SBL A;  3SXX A;  1A90 A;  1M1X B;  1BNG A;  1WMP A;  3PZW A;  3LH4 A;  5EQL A;  3IMA B;  3JUN A;  4PEJ A;  1JV2 B;  2C10 A;  2ZA4 A;  3LOY A;  4WYK B;  1IU7 A;  4BL2 A;  1YJN 3;  2W04 A;  1PYL A;  1OHO A;  2F98 A;  2QA4 3;  1RN1 A;  1GD4 A;  1OPY A;  1NU3 A;  1Q9E A;  3JUM A;  2HMN B;  3Q2P A;  1NNV A;  2QEX 3;  5KP3 A;  1PFP A;  3F7X A;  3DGL A;  4LSO A;  2KAA A;  2XEP A;  1TRQ A;  4R80 A;  2I9W A;  3GRD A;  1R4Y A;  2W56 B;  3L0R A;  3WHO A;  5CF1 A;  1UCL A;  3CC2 3;  1RNT A;  4HZ9 B;  3DMC A;  3FKA A;  3NBB A;  5IW9 A;  1YI2 3;  3HK4 A;  4HZB B;  1V74 A;  2RGQ A;  1FA3 A;  1C54 A;  3WR2 A;  1UUG B;  1SII A;  1MWT A;  5CF2 A;  3MG3 A;  1JJ2 2;  1DMM A;  1MOL A;  4CCV A;  2CC3 A;  3WOE B;  1K28 A;  2PNC A;  3X41 A;  1FGO A;  1NB5 I;  1LOW A;  5AI1 A;  4L8P A;  2OTL 3;  1TP6 A;  1BSA A;  3G0K A;  1BNR A;  1BUQ A;  3EN8 A;  4FCM A;  3D9R A;  2Z76 A;  3V92 A;  3G16 A;  3JUP A;  1QVG 2;  1AVL A;  5AIF A;  3HII A;  3NV0 A;  1I70 A;  4WP5 A;  1LOX A;  2CG0 A;  2YX9 A;  1RJO A;  4HYZ A;  1FGM A;  3HIG A;  4KZ1 A;  3LML A;  1B3S A;  1RGK A;  4EV2 A;  1OHP A;  1TIJ A;  1I3F A;  3PGB A;  3UB1 A;  3PCS A;  5AIH A;  1MNL A;  1T2H A;  1GOV A;  1N9J A;  1IV9 A;  1DYU A;  1W01 A;  2IYJ A;  5LC6 A;  2CW9 A;  3FGY A;  4LEH A;  5ELJ A;  3EN1 B;  3BB9 A;  1GY7 A;  4X2O A;  1UW1 A;  2O3O A;  1WTH A;  2WOH A;  3NM2 A;  2F5M A;  2XFT A;  1W6G A;  1ZS7 A;  1NWW A;  2CKF B;  1D6Y A;  3KSE D;  3BNE A;  3PCR A;  1CYU A;  1YIT 3;  3I55 3;  4EV5 A;  1W2B 2;  2OCT A;  3J7Y d;  3H51 A;  7RNT A;  2W9Q A;  5IG3 A;  1RGG A;  4O8S A;  4HOH A;  4WWU C;  4GL6 A;  5BVB A;  1JZD A;  1KWI A;  2XH9 A;  3U1W A;  1YGW A;  1ASK A;  1BSE A;  3CC7 3;  1A67 A;  1LOY A;  8CHO A;  4JRF A;  1X1X A;  4AEQ A;  1V57 A;  1SAR A;  1GMR A;  1Q7Y 4;  3V98 A;  2PZV A;  3T0U A;  2CFL A;  8RNT A; 
#chains in the Genus database with same CATH homology
 4HM5 B;  5IF6 A;  3NX0 A;  1VQ4 3;  3DM8 A;  1DVD A;  2E2T A;  3MWZ A;  1OF5 B;  1RRH A;  2V1L A;  4KVH A;  2OTJ 3;  2CH9 A;  3KSP A;  1EG9 B;  3NM7 A;  3MG1 A;  1W6C A;  3EC9 A;  1UUV B;  3Q1C A;  1WMO A;  3NQZ A;  4EBG A;  1IV7 A;  1US1 A;  1VQM 3;  5JPU A;  1LXE A;  3IJE B;  1K73 4;  3PS8 A;  2M7O A;  5EVH A;  3HX8 A;  4FMD A;  3RDE A;  2CFG A;  3FZW A;  5FGO A;  5CXO A;  1D6U A;  2P0X A;  2Z6B A;  1JB4 A;  1J2B A;  1YJW 3;  4OUQ A;  1GYB A;  1D6Z A;  3MKI A;  2HML B;  5AII A;  1SJW A;  2GEX A;  2Q07 A;  1OGZ A;  4CDL A;  2Y73 A;  4G1M B;  3CCE 3;  2W03 A;  3CCS 3;  3EF8 A;  1FGR A;  2L4V A;  1YHQ 3;  1OF5 A;  3RGR A;  2HMJ B;  3X3Z A;  4STD A;  4EYC A;  2OOV A;  4HM1 B;  3G4S 3;  3FG3 A;  2CWU A;  4LGQ A;  3DXO A;  2W9P A;  4XDW A;  4HM6 B;  4N6V 0;  2F99 A;  1VQ6 3;  4WYK A;  3M8C A;  5I97 A;  2P0M A;  1O7M B;  3CCV 3;  2STD A;  3X40 A;  2IA7 A;  3LT9 A;  3H3H A;  3F8X A;  5LC7 A;  3S67 A;  1VQO 3;  1S5A A;  1CEW I;  1YVB I;  2GXF A;  3KE7 A;  1ROV A;  2Y74 A;  4RNY A;  3UJM A;  1Q82 4;  3CC4 3;  3T8U A;  1EQK A;  2GU3 A;  1LVN A;  3EQQ B;  3FG1 A;  2BMO B;  3FH1 A;  1W2Z A;  1GS3 A;  3K63 A;  1T5Y A;  3LTD A;  3IPT A;  2R4I A;  1EKM A;  5FW5 A;  4J8T A;  5ELU A;  2XGN A;  3KZT A;  4FR9 A;  3PXM A;  1TU5 A;  1N5H A;  2F86 B;  3STD A;  4N6N B;  2HMM B;  1IT7 A;  2E2V A;  2W2C A;  3NBJ A;  3GAX A;  3I55 3;  2WGQ A;  2D42 A;  3F40 A;  4O02 B;  4ZM8 A;  3CU3 A;  4N6U A;  1IVX A;  1OHS A;  3F14 A;  4Q53 A;  3CNM A;  1JN5 A;  3F9S A;  1M1K 4;  3GZY B;  3CCM 3;  4K90 B;  2XR8 B;  2P09 A;  1VQN 3;  1L5G B;  4KFE A;  1ROA A;  3K7C A;  1NDO B;  1YJ9 3;  4R1K A;  3EBY A;  1AR0 A;  2OOV C;  3DGO A;  3MSO A;  3WA3 A;  4O2H A;  4N6M A;  4RZM A;  1HU9 A;  2A15 A;  4HBR A;  5DRE A;  4NHF A;  2Z77 A;  3EJV A;  3EE1 A;  2FNQ A;  2WGO A;  5D83 A;  3CPW 2;  1AVK A;  3WA2 X;  3JUQ A;  4IPB A;  3VSY A;  3MPH A;  3KII A;  3B8L A;  1STF I;  3S29 A;  1NJI 4;  5AYR B;  1N5P A;  4MEI A;  1IQX A;  2KCD A;  1JN5 B;  3NBR A;  2BT3 A;  1N9E A;  3FF0 A;  3CPO A;  5JPP A;  4FCZ A;  2ZDJ A;  3K5T A;  3LT8 A;  5DRV A;  1Q86 4;  3OWS A;  2QIY A;  4BTY A;  1KQS 2;  4K1U A;  1ULJ B;  1ZX2 A;  3SX1 A;  2ZL8 A;  4KFF A;  5AEU B;  5D82 A;  3N54 B;  1Q42 A;  2CG1 A;  2XGL A;  1IT8 A;  1DVC A;  2W6J H;  4MMY B;  3X3X A;  1DMN A;  2CFD A;  2OQE C;  1M90 4;  1VQ9 3;  1IQY A;  2C11 A;  1IK3 A;  5HGR A;  3WMD A;  1A2K A;  3F8H A;  5AEW B;  3DGM A;  3QK9 A;  5IEO A;  3KKG A;  1OUN A;  4GB5 A;  3G6E 3;  1IVV A;  1TFO A;  4XBT A;  3CMA 3;  1GY6 A;  1VQ8 3;  3OX9 A;  1SQW A;  3FG4 A;  1PU4 A;  2KRT A;  1KSI A;  2K0M A;  3X3Y A;  4LMI A;  1O7N B;  3WDG B;  2P05 A;  1Q81 4;  5TGN A;  2WOF A;  4N6O B;  5BXQ A;  2HMO B;  1FUW A;  2JQ5 A;  4L8O A;  1O7P B;  2CFK A;  3OWU A;  4HVN A;  1Q40 B;  1QVF 2;  2CFW A;  2QGU A;  4MJD A;  3DUK A;  1Y4K A;  1NO3 A;  3FSD A;  4N6T A;  3CCL 3;  3NHX A;  1VQP 3;  1W7C A;  1YIJ 3;  3OV4 A;  2B1X B;  3MHE A;  4KFD A;  1OH0 A;  4I4K A;  1K9M 4;  1A2V A;  2FXT A;  5JBS A;  1KD1 4;  5A0O B;  1W6Y A;  4L7K A;  3ALA A;  3DZL A;  1IDP A;  3CCJ 3;  5IEN A;  3FLJ A;  1W02 A;  4FMA A;  1E3V A;  2RSX A;  3B7C A;  4EXR A;  1WNH A;  3CCR 3;  3AMO B;  2FGT A;  3MYT A;  5IG4 A;  3CME 3;  3LZA A;  3VGN A;  3JUO A;  3LYG A;  1QAK A;  1CQS A;  1RN7 A;  3VF1 A;  1NB3 I;  1TUH A;  1IVW A;  5D81 A;  1LNH A;  1AV4 A;  3KFQ C;  4TX4 A;  2XSO B;  1UI8 A;  5EEO A;  3LTA A;  3BLZ A;  4IIA A;  2XRX B;  3N9H A;  3E99 A;  4NRE A;  3S5C A;  2JDI H;  5IG0 A;  3GZB A;  2ML6 A;  3CCQ 3;  1E97 A;  1M9G A;  2OQE A;  3G71 3;  1UI7 A;  3ROB A;  3A76 A;  1U5O A;  4HM7 B;  4FMB A;  3EHC A;  1JB2 A;  4AKY A;  1Z1S A;  3AMO A;  1EA2 A;  3FF2 A;  4U13 A;  4XM4 A;  2INX A;  3B4P A;  4K1V A;  4H61 A;  2MF7 A;  4N6L A;  4OVM A;  1QJG A;  3KN4 A;  2XF3 A;  3UL5 A;  2Z7A A;  2O9U X;  2W56 A;  2P38 A;  2W0Q A;  3CCU 3;  4AKZ A;  3TDG A;  3X42 A;  1RRL A;  3MG2 A;  2YFJ B;  2IMJ A;  3CXC 2;  2IUK A;  4WHA A;  4MMZ B;  1O7W B;  2RCD A;  2GU1 A;  7STD A;  5IEP A;  4IT7 A;  3HI7 A;  4HM0 B;  3U97 A;  2BMR B;  4N3V A;  2CWV A;  3BNC A;  3SOA A;  4RNZ A;  3LXU X;  1WQL B;  1C7H A;  4R9L A;  4R4K A;  3BNB A;  1DMQ A;  3SED A;  2WO0 A;  3G8Z A;  3DGN A;  2BMQ B;  1OGX A;  3NXJ A;  1OAC A;  1UUW B;  2IUJ A;  1U8C B;  3NV0 B;  2BNG A;  2CWT A;  4QWT A;  2LQV A;  3EBT A;  1W00 A;  3UL6 A;  2D1W A;  4RBN A;  1FGT A;  2OWP A;  2RFR A;  1STD A;  3SLU A;  5KP1 A;  3CD6 3;  1E3R A;  3SVA A;  1JNQ A;  5IER A;  4FMC A;  3D3L A;  3DY5 A;  1TFK A;  4K61 A;  3CNX A;  5AIG A;  6STD A;  3NQY A;  4XBX A;  1CYV A;  3GWR A;  3GZR A;  4HM3 B;  4JF8 A;  5STD A;  3S28 A;  3O8Y A;  5CF1 A;  4X2H A;  2GEY A;  1W5Z A;  4MMX B;  1GD3 A;  4OK0 A;  4H3U A;  2MC8 A;  1RKY A;  2ML5 A;  1K8A 4;  3NUV A;  4EC6 A;  1GY5 A;  3T8N A;  3EX9 A;  4HM4 B;  4HM8 B;  1F8N A;  3V99 A;  1G96 A;  1IVU A;  1WMN A;  2YFI B;  2B24 B;  4HJL B;  3HZP A;  4R9K A;  3JVC A;  1Q40 A;  3I56 3;  1O7G B;  1KC8 4;  1N8R 4;  2HMK B;  3QRD A;  1VZZ A;  1VQ5 3;  1JB5 A;  3OWY A;  3ER7 A;  1W4N A;  1JKG B;  1QAF A;  3LTB A;  4XDV A;  3WOF B;  1SIH A;  2CK3 H;  3BND A;  3N8B A;  3WOD G;  4HKV B;  5CK6 A;  4WFO A;  4HM2 B;  2GBW B;  4FCJ A;  3LTC A;  3PYJ A;  2XFS A;  5CLK A;  4LZI A;  4XB5 A;  3OW2 2;  1FGQ A;  4BTW A;  1JRQ A;  1VQ7 3;  2UX0 A;  1VQL 3;  3Q90 A;  2CIU A;  3RGA A;  1HKX A;  3I0Y A;  1S72 3;  1IQ8 A;  5G2G A;  3UNL A;  2CHC A;  4BTX A;  3K0Z A;  2K54 A;  2GBX B;  2BHM A;  1R4C A;  3SOY A;  1N8Q A;  5AYS C;  2E2U A;  2BO9 B;  1OCV A;  1ULI B;  2YFL B;  3K9M C;  1K41 A;  1VQK 3;  1QAL A;  1YGE A;  4ORL A;  3EB8 A;  1O7H B;  3GZX B;  2XSH B;  5IG5 A;  1JKG A;  1ISK A;  3ECF A;  4O3V A;  2KXG A;  3F7S A;  1SPU A;  2LYX A;  3B4O A;  4XBY A;  3OXA A;  4J9A A;  3FCS B;  1QMA A;  1ZO2 A;  3S27 A;  2SBL A;  3SXX A;  1A90 A;  1M1X B;  1WMP A;  3PZW A;  3LH4 A;  5EQL A;  3IMA B;  3JUN A;  4PEJ A;  1JV2 B;  2C10 A;  3LOY A;  1YJN 3;  4WYK B;  1IU7 A;  2W04 A;  1OHO A;  2F98 A;  2QA4 3;  1GD4 A;  1OPY A;  1NU3 A;  3JUM A;  2HMN B;  3Q2P A;  2QEX 3;  5KP3 A;  1PFP A;  3F7X A;  3DGL A;  4LSO A;  2XEP A;  4R80 A;  2I9W A;  3GRD A;  2W56 B;  3L0R A;  3CC2 3;  4HZ9 B;  3DMC A;  3FKA A;  3NBB A;  5IW9 A;  1YI2 3;  3HK4 A;  4HZB B;  1V74 A;  2RGQ A;  1FA3 A;  1SII A;  5CF2 A;  3MG3 A;  1JJ2 2;  1DMM A;  1MOL A;  4CCV A;  2CC3 A;  3WOE B;  1K28 A;  2PNC A;  3X41 A;  1FGO A;  1NB5 I;  5AI1 A;  4L8P A;  2OTL 3;  1TP6 A;  3G0K A;  1BUQ A;  3EN8 A;  4FCM A;  3D9R A;  2Z76 A;  3V92 A;  3G16 A;  3JUP A;  1QVG 2;  1AVL A;  5AIF A;  3HII A;  3NV0 A;  4WP5 A;  1LOX A;  2CG0 A;  2YX9 A;  1RJO A;  4HYZ A;  1FGM A;  3HIG A;  4KZ1 A;  3LML A;  4EV2 A;  1OHP A;  1TIJ A;  3PGB A;  3UB1 A;  3PCS A;  5AIH A;  1MNL A;  1N9J A;  1IV9 A;  1DYU A;  1W01 A;  5LC6 A;  2CW9 A;  3FGY A;  4LEH A;  5ELJ A;  3EN1 B;  3BB9 A;  1GY7 A;  4X2O A;  1UW1 A;  2O3O A;  1WTH A;  2WOH A;  3NM2 A;  5KP4 A;  2XFT A;  1W6G A;  3KSE D;  1NWW A;  2CKF B;  1D6Y A;  1CYU A;  3BNE A;  3PCR A;  1YIT 3;  4EV5 A;  1W2B 2;  2OCT A;  3J7Y d;  3H51 A;  2W9Q A;  5IG3 A;  4O8S A;  4WWU C;  4GL6 A;  5BVB A;  1KWI A;  2XH9 A;  3U1W A;  3CC7 3;  1ASK A;  1A67 A;  8CHO A;  4JRF A;  4AEQ A;  1Q7Y 4;  3V98 A;  2PZV A;  3T0U A;  2CFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...