4N6NB

Crystal structure of oxidized legumain in complex with cystatin e/m
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
117
structure length
117
Chain Sequence
b'VGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQMLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Legumain
publication title Structure and mechanism of an aspartimide-dependent Peptide ligase in human legumain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 24
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2013-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4n6nB00
1N9JA 3PXMA 5A0OB 1IV7A 4N6V0 5LC6A 3S67A 4TX4A 1STFI 4N6OB 3PS8A 1R4CA 1LXEA 4N6MA 3SVAA 1GD4A 3UL6A 1NB3I 4CCVA 3MWZA 3L0RA 3K9MC 1YVBI 3NX0A 5ELJA 1DVDA 1TIJA 1A90A 1CEWI 3KFQC 4ZM8A 1FUWA 1FA3A 4N6UA 3PYJA 3Q2PA 1G96A 2CH9A 2W9QA 2BO9B 4N6LA 4LZIA 4EYCA 5EQLA 4N6TA 2KXGA 2OCTA 1RN7A 1EQKA 1CYUA 1WNHA 1DVCA 3GAXA 1MNLA 1A67A 1GD3A 3LH4A 1NB5I 2W9PA 5LC7A 1PFPA 3IMAB 1IV9A 1KWIA 1MOLA 4IT7A 3KSED 4N6NB 1CYVA 3QRDA 3UL5A 5ELUA 1N5PA 2O9UX 1ROAA 1N5HA 1M9GA
chains in the Genus database with same CATH superfamily
1I70A 4O2HA 1GY6A 5A0OB 1BSBA 3DH2A 3CCE3 4R9LA 1WMOA 2E2TA 1UUGB 1RN1A 3S67A 3D5GA 5CXOA 2INXA 4CPKA 3CNMA 4BL2A 3NM7A 5GSPA 1TFOA 2AAEA 5RNTA 2OTL3 3NBBA 1JBRA 2L4VA 1W6GA 1O7NB 4XM4A 1RHLA 3KIIA 3FZWA 4CDLA 5FGOA 5FW5A 2CHCA 1NNVA 3D9RA 1X1UA 4HAAA 1QVF2 3WHOA 1YI23 2XRXB 5CF1A 1IT7A 4BTYA 1VQN3 5IG4A 4HM0B 1ZX2A 2J8XB 4EBGA 1YGEA 4Q53A 3ROBA 3CCR3 4EV5A 1EUIC 3ZG0A 5AEWB 1I2FA 2BHMA 4QWTA 4BIRA 3QK9A 1I0VA 2CWVA 1OPYA 3D5IA 3HIIA 3MWZA 3L0RA 2CFKA 3A76A 1PYLA 4FR9A 3PCRA 2P0XA 1JKGA 1N9EA 1O7WB 1YHQ3 1KC84 1SIIA 1BU4A 3V92A 1VQ93 2MC8A 2OOVA 1TIJA 2HMKB 2SBLA 3G8ZA 4HM5B 4I4KA 4RNZA 5D82A 3CC43 3KFQC 3DGYA 2Z76A 1MWUA 5AIIA 2WGQA 4L8PA 1FUWA 7RNTA 1JB2A 1Q9EA 1JKGB 4HM3B 3EBYA 3STDA 5JPUA 1UUWB 3BNCA 1K734 1VQO3 1C7HA 3SXXA 3BNBA 2KRTA 2W03A 4K1VA 3GZYB 1TTOA 2W9QA 3UNLA 2KF5A 1JBTA 4N6LA 1BVIA 4OK0A 2W0QA 5KP1A 3OXAA 1B2SA 1UGHI 3BNEA 5AYRB 4GL6A 2KXGA 1RGEA 1YJN3 2OCTA 3CCS3 1EG9B 2CFDA 3DUKA 3GRDA 1EQKA 3EF8A 3Q90A 2OOVC 4KVHA 1RJOA 3FCSB 1A67A 1QJGA 2P09A 2L1SA 1GS3A 2C10A 3K7CA 5AEUB 4XDVA 2R41A 1BNEA 4LEHA 3DXOA 2W9PA 3CCL3 5LC7A 3JUNA 1RKYA 3ECFA 3JVCA 4WHAA 4HOHA 1SJWA 3DGLA 3CC23 3CCQ3 1RN4A 2XFTA 2LYXA 2ZHXB 1GY5A 4HYZA 4BU4A 3NV0B 1BUQA 5G1KA 1SPUA 3LZAA 3MKIA 1MWTA 4KFFA 5M1AA 3S27A 1FYSA 3MPHA 1ZS7A 1ISKA 3IMAB 1IV9A 2LQVA 3WDGB 4I5QA 3U1WA 1BNRA 1OUNA 2RNTA 3GZBA 1HU9A 1VQQA 2D42A 3VSYA 3KSED 1B27A 4PEJA 1AQZA 5G1LA 1CYVA 3EX9A 2CC3A 1OH0A 1LOWA 4RZMA 1N5PA 2O9UX 3CC73 1RRHA 2E2UA 3F8HA 2CFWA 2FXTA 2RGQA 3LTAA 3G713 1C54A 5BVBA 4HM2B 1BRGA 3LYGA 4OVMA 3S29A 1RRLA 2ML5A 3KZTA 1BNSA 4K90B 3T8UA 1T5YA 1JRQA 1IVVA 1OGZA 2W2CA 4N3VA 3URPA 3CCM3 3EN8A 4NHFA 1D6ZA 1DMMA 3PXMA 1U8CB 4FMAA 4EV2A 1UW1A 4KFEA 4HM7B 2Y73A 1N8R4 1IDPA 3N8BA 3VF1A 1EEJA 4HVNA 3G4S3 1BRKA 1B2XA 1VQP3 2UX0A 1X1WA 3HK4A 5CLKA 3PS8A 3MYTA 1R4CA 2C4BA 3HI7A 2Z7AA 4N6MA 3GSPA 3JUMA 3AGOA 9RNTA 1Q40A 3Q1CA 1GD4A 5KP3A 1RGAA 2RBIA 4LYLB 1YIT3 1VQK3 3UL6A 1NB3I 1RGFA 1GMRA 3EHCA 4MEIA 4CCVA 3WODG 2K0MA 1Q7HA 3FG3A 4IPBA 2GBXB 3I553 4HZBB 3K9MC 3NX0A 1Q40B 3DGMA 1V57A 2YFLB 2P0MA 2I9WA 1T2IA 1OHOA 1W6CA 2OWPA 3TDGA 3OWSA 4GSPA 2XGLA 4HM1B 3S5CA 3NM2A 4U13A 1FUSA 4RNYA 8RNTA 4R80A 1A2PA 2F5WA 1BOXA 1FUTA 1EKMA 4ZM8A 3RNTA 1FA3A 3K63A 1PU4A 1BNIA 2KF6A 3IPTA 1IVUA 1LRAA 2Y74A 1ULIB 3DGNA 3CCJ3 1TJDA 1LQGC 1QMAA 1LNHA 1BRJA 1SARA 1W7CA 1EA2A 1M1XB 4LSOA 1S723 3EJVA 4EYCA 5EQLA 4O02B 3WA2X 2YFIB 3EB8A 1BRNL 3CMA3 1VQ83 3CD63 1W00A 4MMYB 5AIFA 3PCSA 5TGNA 4EC6A 1MGWA 1RN7A 4JRFA 1CYUA 1ZGXA 1LOXA 2IYJA 3D79A 5BIRA 3GAXA 3DM8A 1B21A 4ORLA 3FG4A 4KZ1A 3NHXA 1W6YA 3LH4A 1LOYA 2FGTA 3NQZA 1B2ZA 1NB5I 3WR2A 3FF2A 1Z1SA 2GSPA 2H0HA 3RDEA 3LMLA 3IJEB 1M904 1VQ43 1G02A 3JUQA 1JZOA 2M7OA 3ZFZA 1K8A4 1FZUA 1ZO2A 1PFPA 1US1A 3A5EA 4H61A 5HOHA 1BANA 2HMMB 5AI1A 1NJI4 1GSPA 2RFRA 1W02A 1MOLA 3FH1A 4IT7A 3MHEA 4BL3A 3J7Yd 1K9M4 4K61A 1A2KA 1VZZA 2GEXA 2CW9A 2CX0A 3U97A 2KAAA 1IQ8A 1F8NA 3ALAA 1T3BA 3GZRA 3NV0A 2SARA 2R4IA 4H3UA 5KP4A 1X1YA 2CWTA 3FF0A 2BU4A 1IT8A 1ROAA 1GOUA 1RTUA 3SOAA 4EW5A 1QVG2 3KN4A 3LTCA 4XDWA 5IG3A 1FGTA 3CCU3 1Q824 1BSDA 1DMNA 3CPW2 1IYYA 2F86B 1NU3A 1CQSA 1YNVX 1O7MB 2F4YA 2HOHA 1SQWA 2WGOA 1VQ63 1DETA 3FSDA 4N6V0 1Q42A 3LTDA 1BRHA 1OF5A 3HIGA 3B4PA 2F5MA 4GB5A 1LNIA 4TX4A 4X2OA 4R9KA 1I0XA 3SOYA 4L8OA 2FNQA 1T2HA 3NUVA 3AGNA 3AMOB 1JB5A 3N9HA 4N6OB 3B7CA 2ZL8A 2CG1A 3Q3FA 1HYFA 3UB1A 5IENA 1E3VA 3I0YA 5IEOA 1OF5B 4ILFA 1LQMB 1WMNA 1LXEA 4L7KA 2CK3H 2IMJA 2P05A 3OWUA 5IW9A 2XGNA 3KE7A 3OV4A 1IQYA 5AIHA 1ROVA 3SVAA 3T8NA 4HJLB 3FGYA 1JZDA 1RGKA 3SYUA 4HM8B 1Q7Y4 1DYUA 6GSPA 3E99A 1L5GB 2GEYA 1I3IA 1QALA 1RDSA 1RGLA 1IVXA 1G0TA 1BSAA 1OGXA 1YGWA 2CKFB 2GBWB 2W6JH 2WOFA 2BNGA 1V74A 1TUHA 1YVBI 4BTXA 2HMOB 3FLJA 1GY7A 2E2VA 2XSOB 5M19A 5IERA 1AY7A 5D83A 3BB9A 1KQS2 1BGSA 3B4OA 3H51A 4STDA 2QA43 1TU5A 1PY3A 3AHWA 3EBTA 1HZ1A 1FGRA 2BMRB 1KD14 1E3RA 4HKVB 3F7XA 1UGIA 3H3HA 2HMJB 2W56A 2Z77A 3PYJA 1QAKA 1B20A 1G96A 2IA7A 2WO0A 2WOHA 3HX8A 4J8TA 1NO3A 2CH9A 3VGNA 3LT8A 1BNGA 4AKYA 3FG1A 3GZXB 3V99A 3X42A 3K0ZA 4LZIA 2XEPA 5AIGA 1VQL3 1FW7A 7GSPA 1W2ZA 2OQEA 1UCIA 2QGUA 2W56B 2IUJA 2K3DA 3B8LA 1RGHA 2A15A 4OUQA 2RSXA 3PGBA 1R4YA 2QIYA 4FMBA 4FMDA 1JB4A 4K1UA 3PZWA 1DVCA 4WP5A 2Z6BA 2ZA4A 1MNLA 2K54A 3CCV3 2IY2A 1BNJA 2XF3A 1BSCA 3OWYA 5ELJA 2QEX3 1TP6A 1BAOA 4GHOA 1YVSA 3NBJA 2CFGA 2UUGC 4IIAA 1D6UA 1UCLA 3CME3 2XR8B 2F98A 4NPBA 3HZPA 3KSPA 1B2UA 3BU4A 3NBRA 4FCMA 3X3ZA 3HOHA 1YIJ3 5JBSA 1K41A 6RNTA 3F8XA 1GMQA 1RCKA 4XBXA 3WA3A 1VQ53 1RMSA 3N54B 5EVHA 2OQEC 2GU3A 2PZVA 2GXFA 3NQYA 3ER7A 1Y4KA 4WYKA 3WOFB 1IU7A 1Q814 3F7SA 1V58A 3M8CA 7STDA 3KCHA 1DMQA 1W5ZA 1QAFA 3QRDA 2CWUA 5ELUA 3UL5A 1AR0A 3LT9A 4R4KA 1O7PB 4FCJA 1Q864 1W01A 3GWRA 1VQ73 4WYKB 1W2B2 5M18A 2H0GA 5G2GA 1JN5A 2RCDA 1RLSA 1N5HA 3SX1A 1M9GA 4LGQA 1N9JA 1K28A 2C11A 3BLZA 3MSOA 1BRIA 1IV7A 2B1XB 4WFOA 4FCZA 3DGOA 2F99A 1YJ93 1NWWA 3LTBA 1UCJA 1KSIA 4DKIA 1N8QA 5LC6A 5CF2A 3F40A 4O3VA 1TRQA 2OTJ3 1JN5B 4J5GA 5D81A 3X3XA 1STFI 1UI8A 4NREA 1NDOB 1RSNA 3EE1A 2XSHB 5STDA 2BMOB 5IG0A 2O3OA 4G1MB 1B3SA 1OHSA 1AVKA 2P38A 3ZG5A 1BUJA 3X40A 4AEQA 1GOYA 4XBTA 3SEDA 3EC9A 1OACA 3CPOA 4MMXB 3D3LA 1BSEA 2ML6A 3OX9A 5HGRA 1X1XA 5BU4A 3AMOA 2CX1A 2HMNB 2XH9A 1DE3A 4HM4B 3NXJA 1UI7A 4RBNA 1U5OA 4MMZB 3UJMA 1UCKA 1VQM3 4HZ9B 3BIRA 3I563 3DZLA 5DRVA 8CHOA 1ASKA 4LMIA 2ZDJA 2B24B 3X3YA 1RGCA 1GYBA 4EXRA 1DVDA 2GU1A 2D1WA 1IVWA 1JV2B 3MG1A 1BIRA 3V98A 3CXC2 1RNBA 1A90A 1MGRA 1CEWI 1I2EA 1GMPA 1JNQA 3RGAA 2HMLB 3LOYA 2XFSA 4JF8A 3F9SA 1SIHA 4KT3B 1FGOA 4N6UA 2H0IA 3CU3A 1J2BA 1WQLB 2MF7A 5DREA 2IUKA 2Q07A 3Q2PA 1I3FA 4O8SA 1TFKA 2CIUA 1OCVA 2KF4A 1B2MA 1MWRA 2BIRA 3JUPA 2BO9B 3MG3A 2CFLA 1STDA 1UUVB 3X41A 2BMQB 1WTHA 2KF3A 4N6TA 1E97A 1W4NA 2KCDA 2UGIA 4XBYA 4CJNA 1D6YA 1AV4A 4RNTA 1S5AA 2V1LA 3BNDA 3EQQB 3DY5A 5IG5A 1WNHA 4WWUC 3MG2A 2STDA 3WMDA 4KFDA 1JBSA 1GD3A 5BXQA 1IQXA 1O7GB 2YX9A 2CG0A 4J9AA 1A2VA 1GOVA 2AADA 3G0KA 1JJ22 1BNFA 3SLUA 1FGMA 3JUOA 4FMCA 3WOEB 1WMPA 1YJW3 1I2GA 1I8VA 1LOVA 1RGGA 1AVLA 5IF6A 2PNCA 5IEPA 3CNXA 4BTWA 4MJDA 3S28A 3OW22 1MWSA 3DMCA 3AHSA 3KKGA 4HBRA 5I97A 6STDA 2YFJB 3O8YA 3G16A 1ULJB 5CK6A 3G6E3 3EN1B 1KWIA 3LXUX 4HM6B 1RCLA 1BRSA 4XB5A 5EEOA 2W04A 1OHPA 1RNTA 2F56A 2JQ5A 4N6NB 3T0UA 1LVNA 1UDII 3D4AA 4X2HA 1FGQA 3FKAA 1TRPA 3K5TA 1IK3A 1HKXA 5JPPA 1CH0A 3RGRA 1O7HB 4J5KA 2BT3A 1M1K4 5AYSC 4R1KA 2JDIH 3F14A 4AKZA
chains in the Genus database with same CATH topology
4O2HA 1GY6A 5A0OB 3CCE3 4R9LA 1WMOA 2E2TA 3S67A 5CXOA 2INXA 3CNMA 3NM7A 1TFOA 2OTL3 3NBBA 2L4VA 1W6GA 1O7NB 4XM4A 3KIIA 3FZWA 4CDLA 5FGOA 5FW5A 2CHCA 3D9RA 1QVF2 1YI23 2XRXB 5CF1A 1IT7A 4BTYA 1VQN3 5IG4A 4HM0B 1ZX2A 4EBGA 1YGEA 4Q53A 3ROBA 3CCR3 4EV5A 5AEWB 2BHMA 4QWTA 3QK9A 2CWVA 1OPYA 3HIIA 3MWZA 3L0RA 2CFKA 3A76A 4FR9A 3PCRA 2P0XA 1JKGA 1N9EA 1O7WB 1YHQ3 1KC84 1SIIA 3V92A 1VQ93 2MC8A 2OOVA 1TIJA 2HMKB 2SBLA 3G8ZA 4HM5B 4I4KA 4RNZA 5D82A 3CC43 3KFQC 2Z76A 5AIIA 2WGQA 4L8PA 1FUWA 1JB2A 1JKGB 4HM3B 3EBYA 3STDA 5JPUA 1UUWB 3BNCA 1K734 1VQO3 1C7HA 3SXXA 3BNBA 2KRTA 2W03A 4K1VA 3GZYB 2W9QA 3UNLA 4N6LA 4OK0A 2W0QA 5KP1A 3OXAA 3BNEA 5AYRB 4GL6A 2KXGA 1YJN3 2OCTA 3CCS3 1EG9B 2CFDA 3DUKA 3GRDA 1EQKA 3EF8A 3Q90A 2OOVC 4KVHA 1RJOA 3FCSB 1A67A 1QJGA 2P09A 1GS3A 2C10A 3K7CA 5AEUB 4XDVA 4LEHA 3DXOA 2W9PA 3CCL3 5LC7A 3JUNA 1RKYA 3ECFA 3JVCA 4WHAA 3CC23 1SJWA 3DGLA 2XFTA 2LYXA 1BUQA 1GY5A 4HYZA 3NV0B 1SPUA 3LZAA 3MKIA 4KFFA 3S27A 3MPHA 1ISKA 3IMAB 1IV9A 2LQVA 3WDGB 3U1WA 1OUNA 3GZBA 1HU9A 2D42A 3VSYA 3KSED 4PEJA 1CYVA 3EX9A 2CC3A 1OH0A 4RZMA 1N5PA 2O9UX 3CC73 1RRHA 2E2UA 3F8HA 2CFWA 2FXTA 2RGQA 3LTAA 3G713 5BVBA 4HM2B 3LYGA 4OVMA 3S29A 1RRLA 2ML5A 3KZTA 4K90B 3T8UA 1T5YA 1JRQA 1IVVA 1OGZA 2W2CA 4N3VA 3CCM3 3EN8A 4NHFA 1D6ZA 1DMMA 3PXMA 1U8CB 4FMAA 4EV2A 1UW1A 4KFEA 4HM7B 2Y73A 1N8R4 1IDPA 3N8BA 4HVNA 3G4S3 1VQP3 2UX0A 3HK4A 5CLKA 3PS8A 3MYTA 1R4CA 3HI7A 2Z7AA 4N6MA 3JUMA 1Q40A 3Q1CA 1GD4A 5KP3A 1YIT3 1VQK3 3UL6A 1NB3I 3EHCA 4MEIA 4CCVA 3WODG 2K0MA 3FG3A 4IPBA 2GBXB 3I553 4HZBB 3K9MC 3NX0A 1Q40B 3DGMA 2YFLB 5ELJA 2P0MA 2I9WA 2OWPA 1OHOA 1W6CA 3TDGA 3OWSA 2XGLA 4HM1B 3S5CA 3NM2A 4U13A 4RNYA 4R80A 1EKMA 4ZM8A 1FA3A 3K63A 1PU4A 3IPTA 1IVUA 2Y74A 1ULIB 3DGNA 3CCJ3 1QMAA 1LNHA 1W7CA 1EA2A 1M1XB 4LSOA 1S723 3EJVA 4EYCA 5EQLA 4O02B 3WA2X 2YFIB 3EB8A 3CD63 3CMA3 1VQ83 1W00A 4MMYB 5AIFA 3PCSA 5TGNA 4EC6A 1RN7A 4JRFA 1CYUA 1LOXA 3GAXA 3DM8A 4ORLA 3FG4A 4KZ1A 3NHXA 1W6YA 3LH4A 2FGTA 3NQZA 1NB5I 3FF2A 1Z1SA 3RDEA 3LMLA 3IJEB 1M904 1VQ43 3JUQA 2M7OA 1K8A4 1ZO2A 1PFPA 1US1A 4H61A 2HMMB 5AI1A 1NJI4 2RFRA 3J7Yd 1W02A 1MOLA 3FH1A 4IT7A 3MHEA 1K9M4 4K61A 1A2KA 1VZZA 2GEXA 2CW9A 3U97A 1IQ8A 1F8NA 3ALAA 3GZRA 3NV0A 2R4IA 4H3UA 5KP4A 2CWTA 3FF0A 1IT8A 1ROAA 3SOAA 1QVG2 3KN4A 3LTCA 4XDWA 5IG3A 1FGTA 3CCU3 1Q824 1DMNA 3CPW2 2F86B 1NU3A 1CQSA 1O7MB 1VQ63 1SQWA 2WGOA 3FSDA 4N6V0 1Q42A 3LTDA 3HIGA 1OF5A 3B4PA 4GB5A 4TX4A 4X2OA 4R9KA 3SOYA 4L8OA 2FNQA 3NUVA 3AMOB 1JB5A 3N9HA 4N6OB 3B7CA 2ZL8A 2CG1A 3UB1A 5IENA 1E3VA 3I0YA 5IEOA 1OF5B 4L7KA 3CCQ3 1WMNA 1LXEA 2CK3H 2IMJA 3OWUA 5IW9A 2XGNA 3KE7A 3OV4A 1IQYA 5AIHA 1ROVA 3SVAA 3T8NA 4HJLB 3FGYA 4HM8B 1Q7Y4 1DYUA 3E99A 1L5GB 2GEYA 1QALA 2CKFB 2GBWB 1IVXA 2WOFA 2W6JH 1OGXA 3VF1A 2BNGA 1V74A 1TUHA 1YVBI 4BTXA 2HMOB 3FLJA 1GY7A 2E2VA 2XSOB 5IERA 5D83A 3BB9A 1KQS2 3B4OA 3H51A 4STDA 2QA43 1TU5A 3EBTA 2BMRB 1FGRA 1KD14 1E3RA 2JDIH 4HKVB 3F7XA 3H3HA 2HMJB 2W56A 2Z77A 3PYJA 1QAKA 1G96A 2IA7A 2WO0A 2WOHA 3HX8A 4J8TA 1NO3A 2CH9A 3VGNA 3LT8A 4AKYA 3FG1A 3GZXB 3V99A 3X42A 3K0ZA 4LZIA 2XEPA 5AIGA 1VQL3 1W2ZA 2OQEA 2QGUA 2IUJA 2W56B 3B8LA 2A15A 4OUQA 2RSXA 3PGBA 4FMDA 2QIYA 4FMBA 4K1UA 1JB4A 3PZWA 1DVCA 4WP5A 2Z6BA 3CCV3 1MNLA 2K54A 2XF3A 3OWYA 2QEX3 1TP6A 3NBJA 2CFGA 4IIAA 1D6UA 3CME3 2XR8B 2F98A 3HZPA 3KSPA 4FCMA 1YIJ3 3NBRA 3X3ZA 5JBSA 1K41A 3F8XA 3WA3A 4XBXA 1VQ53 3N54B 5EVHA 2OQEC 2GU3A 2PZVA 2GXFA 3NQYA 3ER7A 1Y4KA 4WYKA 3WOFB 1IU7A 1Q814 3F7SA 3M8CA 7STDA 1DMQA 1W5ZA 1QAFA 3QRDA 2CWUA 5ELUA 3UL5A 1AR0A 3LT9A 4R4KA 1O7PB 4FCJA 1Q864 1W01A 3GWRA 1VQ73 4WYKB 1W2B2 5G2GA 1JN5A 2RCDA 1N5HA 3SX1A 1M9GA 4LGQA 1N9JA 1K28A 2C11A 3BLZA 3MSOA 1IV7A 2B1XB 4WFOA 4FCZA 3DGOA 2F99A 1YJ93 1NWWA 3LTBA 1KSIA 1N8QA 5LC6A 5CF2A 3F40A 4O3VA 2OTJ3 1JN5B 5D81A 3X3XA 1STFI 1UI8A 4NREA 1NDOB 3EE1A 5STDA 2XSHB 2BMOB 5IG0A 2O3OA 4G1MB 1OHSA 1AVKA 2P38A 3X40A 4AEQA 4XBTA 3SEDA 3EC9A 1OACA 3CPOA 4MMXB 3D3LA 2ML6A 3OX9A 5HGRA 3AMOA 2HMNB 2XH9A 4HM4B 3NXJA 1UI7A 4RBNA 1U5OA 4MMZB 3UJMA 1VQM3 4HZ9B 3I563 3DZLA 5DRVA 8CHOA 1ASKA 4LMIA 2ZDJA 2B24B 3X3YA 1GYBA 4EXRA 1DVDA 2GU1A 2D1WA 1IVWA 1JV2B 3MG1A 3V98A 3CXC2 1A90A 1CEWI 1JNQA 3RGAA 2HMLB 3LOYA 2XFSA 4JF8A 3F9SA 1SIHA 1FGOA 4N6UA 3CU3A 1J2BA 1WQLB 2MF7A 5DREA 2IUKA 2Q07A 3Q2PA 4O8SA 1TFKA 2CIUA 1OCVA 3JUPA 2BO9B 3MG3A 2CFLA 1STDA 1UUVB 3X41A 2BMQB 1WTHA 4N6TA 1E97A 1W4NA 2KCDA 4XBYA 1D6YA 1AV4A 1S5AA 2V1LA 3BNDA 3EQQB 3DY5A 5IG5A 1WNHA 4WWUC 3MG2A 2STDA 3WMDA 4KFDA 1GD3A 5BXQA 1IQXA 1O7GB 2YX9A 2CG0A 4J9AA 1A2VA 3G0KA 1JJ22 3SLUA 1FGMA 3JUOA 4FMCA 3WOEB 1WMPA 1YJW3 1AVLA 5IF6A 2PNCA 5IEPA 3CNXA 4BTWA 4MJDA 3S28A 3OW22 3DMCA 3KKGA 4HBRA 5I97A 6STDA 2YFJB 3O8YA 3G16A 1ULJB 5CK6A 3G6E3 3EN1B 1KWIA 3LXUX 4HM6B 5EEOA 4XB5A 2W04A 1OHPA 2JQ5A 4N6NB 3T0UA 1LVNA 4X2HA 1FGQA 3FKAA 1IK3A 3K5TA 1HKXA 5JPPA 3RGRA 1O7HB 2BT3A 1M1K4 5AYSC 4R1KA 2P05A 3F14A 4AKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N9J A;  3PXM A;  5A0O B;  1IV7 A;  4N6V 0;  5LC6 A;  3S67 A;  4TX4 A;  1STF I;  4N6O B;  3PS8 A;  1R4C A;  1LXE A;  4N6M A;  3SVA A;  1GD4 A;  3UL6 A;  1NB3 I;  4CCV A;  3MWZ A;  3L0R A;  3K9M C;  1YVB I;  3NX0 A;  5ELJ A;  1DVD A;  1TIJ A;  1A90 A;  1CEW I;  3KFQ C;  4ZM8 A;  1FUW A;  1FA3 A;  4N6U A;  3PYJ A;  3Q2P A;  1G96 A;  2CH9 A;  2W9Q A;  2BO9 B;  4N6L A;  4LZI A;  4EYC A;  5EQL A;  4N6T A;  2KXG A;  2OCT A;  1RN7 A;  1EQK A;  1CYU A;  1WNH A;  1DVC A;  3GAX A;  1MNL A;  1A67 A;  1GD3 A;  3LH4 A;  1NB5 I;  2W9P A;  5LC7 A;  1PFP A;  3IMA B;  1IV9 A;  1KWI A;  1MOL A;  4IT7 A;  3KSE D;  4N6N B;  1CYV A;  3QRD A;  3UL5 A;  5ELU A;  1N5P A;  2O9U X;  1ROA A;  1N5H A;  1M9G A; 
#chains in the Genus database with same CATH topology
 1I70 A;  4O2H A;  1GY6 A;  5A0O B;  1BSB A;  3DH2 A;  3CCE 3;  4R9L A;  1WMO A;  2E2T A;  1UUG B;  1RN1 A;  3S67 A;  3D5G A;  5CXO A;  2INX A;  4CPK A;  3CNM A;  4BL2 A;  3NM7 A;  5GSP A;  1TFO A;  2AAE A;  5RNT A;  2OTL 3;  3NBB A;  1JBR A;  2L4V A;  1W6G A;  1O7N B;  4XM4 A;  1RHL A;  3KII A;  3FZW A;  4CDL A;  5FGO A;  5FW5 A;  2CHC A;  1NNV A;  3D9R A;  1X1U A;  4HAA A;  1QVF 2;  3WHO A;  1YI2 3;  2XRX B;  5CF1 A;  1IT7 A;  4BTY A;  1VQN 3;  5IG4 A;  4HM0 B;  1ZX2 A;  2J8X B;  4EBG A;  1YGE A;  4Q53 A;  3ROB A;  3CCR 3;  4EV5 A;  1EUI C;  3ZG0 A;  5AEW B;  1I2F A;  2BHM A;  4QWT A;  4BIR A;  3QK9 A;  1I0V A;  2CWV A;  1OPY A;  3D5I A;  3HII A;  3MWZ A;  3L0R A;  2CFK A;  3A76 A;  1PYL A;  4FR9 A;  3PCR A;  2P0X A;  1JKG A;  1N9E A;  1O7W B;  1YHQ 3;  1KC8 4;  1SII A;  1BU4 A;  3V92 A;  1VQ9 3;  2MC8 A;  2OOV A;  1TIJ A;  2HMK B;  2SBL A;  3G8Z A;  4HM5 B;  4I4K A;  4RNZ A;  5D82 A;  3CC4 3;  3KFQ C;  3DGY A;  2Z76 A;  1MWU A;  5AII A;  2WGQ A;  4L8P A;  1FUW A;  7RNT A;  1JB2 A;  1Q9E A;  1JKG B;  4HM3 B;  3EBY A;  3STD A;  5JPU A;  1UUW B;  3BNC A;  1K73 4;  1VQO 3;  1C7H A;  3SXX A;  3BNB A;  2KRT A;  2W03 A;  4K1V A;  3GZY B;  1TTO A;  2W9Q A;  3UNL A;  2KF5 A;  1JBT A;  4N6L A;  1BVI A;  4OK0 A;  2W0Q A;  5KP1 A;  3OXA A;  1B2S A;  1UGH I;  3BNE A;  5AYR B;  4GL6 A;  2KXG A;  1RGE A;  1YJN 3;  2OCT A;  3CCS 3;  1EG9 B;  2CFD A;  3DUK A;  3GRD A;  1EQK A;  3EF8 A;  3Q90 A;  2OOV C;  4KVH A;  1RJO A;  3FCS B;  1A67 A;  1QJG A;  2P09 A;  2L1S A;  1GS3 A;  2C10 A;  3K7C A;  5AEU B;  4XDV A;  2R41 A;  1BNE A;  4LEH A;  3DXO A;  2W9P A;  3CCL 3;  5LC7 A;  3JUN A;  1RKY A;  3ECF A;  3JVC A;  4WHA A;  4HOH A;  1SJW A;  3DGL A;  3CC2 3;  3CCQ 3;  1RN4 A;  2XFT A;  2LYX A;  2ZHX B;  1GY5 A;  4HYZ A;  4BU4 A;  3NV0 B;  1BUQ A;  5G1K A;  1SPU A;  3LZA A;  3MKI A;  1MWT A;  4KFF A;  5M1A A;  3S27 A;  1FYS A;  3MPH A;  1ZS7 A;  1ISK A;  3IMA B;  1IV9 A;  2LQV A;  3WDG B;  4I5Q A;  3U1W A;  1BNR A;  1OUN A;  2RNT A;  3GZB A;  1HU9 A;  1VQQ A;  2D42 A;  3VSY A;  3KSE D;  1B27 A;  4PEJ A;  1AQZ A;  5G1L A;  1CYV A;  3EX9 A;  2CC3 A;  1OH0 A;  1LOW A;  4RZM A;  1N5P A;  2O9U X;  3CC7 3;  1RRH A;  2E2U A;  3F8H A;  2CFW A;  2FXT A;  2RGQ A;  3LTA A;  3G71 3;  1C54 A;  5BVB A;  4HM2 B;  1BRG A;  3LYG A;  4OVM A;  3S29 A;  1RRL A;  2ML5 A;  3KZT A;  1BNS A;  4K90 B;  3T8U A;  1T5Y A;  1JRQ A;  1IVV A;  1OGZ A;  2W2C A;  4N3V A;  3URP A;  3CCM 3;  3EN8 A;  4NHF A;  1D6Z A;  1DMM A;  3PXM A;  1U8C B;  4FMA A;  4EV2 A;  1UW1 A;  4KFE A;  4HM7 B;  2Y73 A;  1N8R 4;  1IDP A;  3N8B A;  3VF1 A;  1EEJ A;  4HVN A;  3G4S 3;  1BRK A;  1B2X A;  1VQP 3;  2UX0 A;  1X1W A;  3HK4 A;  5CLK A;  3PS8 A;  3MYT A;  1R4C A;  2C4B A;  3HI7 A;  2Z7A A;  4N6M A;  3GSP A;  3JUM A;  3AGO A;  9RNT A;  1Q40 A;  3Q1C A;  1GD4 A;  5KP3 A;  1RGA A;  2RBI A;  4LYL B;  1YIT 3;  1VQK 3;  3UL6 A;  1NB3 I;  1RGF A;  1GMR A;  3EHC A;  4MEI A;  4CCV A;  3WOD G;  2K0M A;  1Q7H A;  3FG3 A;  4IPB A;  2GBX B;  3I55 3;  4HZB B;  3K9M C;  3NX0 A;  1Q40 B;  3DGM A;  1V57 A;  2YFL B;  2P0M A;  2I9W A;  1T2I A;  1OHO A;  1W6C A;  2OWP A;  3TDG A;  3OWS A;  4GSP A;  2XGL A;  4HM1 B;  3S5C A;  3NM2 A;  4U13 A;  1FUS A;  4RNY A;  8RNT A;  4R80 A;  1A2P A;  2F5W A;  1BOX A;  1FUT A;  1EKM A;  4ZM8 A;  3RNT A;  1FA3 A;  3K63 A;  1PU4 A;  1BNI A;  2KF6 A;  3IPT A;  1IVU A;  1LRA A;  2Y74 A;  1ULI B;  3DGN A;  3CCJ 3;  1TJD A;  1LQG C;  1QMA A;  1LNH A;  1BRJ A;  1SAR A;  1W7C A;  1EA2 A;  1M1X B;  4LSO A;  1S72 3;  3EJV A;  4EYC A;  5EQL A;  4O02 B;  3WA2 X;  2YFI B;  3EB8 A;  1BRN L;  3CMA 3;  1VQ8 3;  3CD6 3;  1W00 A;  4MMY B;  5AIF A;  3PCS A;  5TGN A;  4EC6 A;  1MGW A;  1RN7 A;  4JRF A;  1CYU A;  1ZGX A;  1LOX A;  2IYJ A;  3D79 A;  5BIR A;  3GAX A;  3DM8 A;  1B21 A;  4ORL A;  3FG4 A;  4KZ1 A;  3NHX A;  1W6Y A;  3LH4 A;  1LOY A;  2FGT A;  3NQZ A;  1B2Z A;  1NB5 I;  3WR2 A;  3FF2 A;  1Z1S A;  2GSP A;  2H0H A;  3RDE A;  3LML A;  3IJE B;  1M90 4;  1VQ4 3;  1G02 A;  3JUQ A;  1JZO A;  2M7O A;  3ZFZ A;  1K8A 4;  1FZU A;  1ZO2 A;  1PFP A;  1US1 A;  3A5E A;  4H61 A;  5HOH A;  1BAN A;  2HMM B;  5AI1 A;  1NJI 4;  1GSP A;  2RFR A;  1W02 A;  1MOL A;  3FH1 A;  4IT7 A;  3MHE A;  4BL3 A;  3J7Y d;  1K9M 4;  4K61 A;  1A2K A;  1VZZ A;  2GEX A;  2CW9 A;  2CX0 A;  3U97 A;  2KAA A;  1IQ8 A;  1F8N A;  3ALA A;  1T3B A;  3GZR A;  3NV0 A;  2SAR A;  2R4I A;  4H3U A;  5KP4 A;  1X1Y A;  2CWT A;  3FF0 A;  2BU4 A;  1IT8 A;  1ROA A;  1GOU A;  1RTU A;  3SOA A;  4EW5 A;  1QVG 2;  3KN4 A;  3LTC A;  4XDW A;  5IG3 A;  1FGT A;  3CCU 3;  1Q82 4;  1BSD A;  1DMN A;  3CPW 2;  1IYY A;  2F86 B;  1NU3 A;  1CQS A;  1YNV X;  1O7M B;  2F4Y A;  2HOH A;  1SQW A;  2WGO A;  1VQ6 3;  1DET A;  3FSD A;  4N6V 0;  1Q42 A;  3LTD A;  1BRH A;  1OF5 A;  3HIG A;  3B4P A;  2F5M A;  4GB5 A;  1LNI A;  4TX4 A;  4X2O A;  4R9K A;  1I0X A;  3SOY A;  4L8O A;  2FNQ A;  1T2H A;  3NUV A;  3AGN A;  3AMO B;  1JB5 A;  3N9H A;  4N6O B;  3B7C A;  2ZL8 A;  2CG1 A;  3Q3F A;  1HYF A;  3UB1 A;  5IEN A;  1E3V A;  3I0Y A;  5IEO A;  1OF5 B;  4ILF A;  1LQM B;  1WMN A;  1LXE A;  4L7K A;  2CK3 H;  2IMJ A;  2P05 A;  3OWU A;  5IW9 A;  2XGN A;  3KE7 A;  3OV4 A;  1IQY A;  5AIH A;  1ROV A;  3SVA A;  3T8N A;  4HJL B;  3FGY A;  1JZD A;  1RGK A;  3SYU A;  4HM8 B;  1Q7Y 4;  1DYU A;  6GSP A;  3E99 A;  1L5G B;  2GEY A;  1I3I A;  1QAL A;  1RDS A;  1RGL A;  1IVX A;  1G0T A;  1BSA A;  1OGX A;  1YGW A;  2CKF B;  2GBW B;  2W6J H;  2WOF A;  2BNG A;  1V74 A;  1TUH A;  1YVB I;  4BTX A;  2HMO B;  3FLJ A;  1GY7 A;  2E2V A;  2XSO B;  5M19 A;  5IER A;  1AY7 A;  5D83 A;  3BB9 A;  1KQS 2;  1BGS A;  3B4O A;  3H51 A;  4STD A;  2QA4 3;  1TU5 A;  1PY3 A;  3AHW A;  3EBT A;  1HZ1 A;  1FGR A;  2BMR B;  1KD1 4;  1E3R A;  4HKV B;  3F7X A;  1UGI A;  3H3H A;  2HMJ B;  2W56 A;  2Z77 A;  3PYJ A;  1QAK A;  1B20 A;  1G96 A;  2IA7 A;  2WO0 A;  2WOH A;  3HX8 A;  4J8T A;  1NO3 A;  2CH9 A;  3VGN A;  3LT8 A;  1BNG A;  4AKY A;  3FG1 A;  3GZX B;  3V99 A;  3X42 A;  3K0Z A;  4LZI A;  2XEP A;  5AIG A;  1VQL 3;  1FW7 A;  7GSP A;  1W2Z A;  2OQE A;  1UCI A;  2QGU A;  2W56 B;  2IUJ A;  2K3D A;  3B8L A;  1RGH A;  2A15 A;  4OUQ A;  2RSX A;  3PGB A;  1R4Y A;  2QIY A;  4FMB A;  4FMD A;  1JB4 A;  4K1U A;  3PZW A;  1DVC A;  4WP5 A;  2Z6B A;  2ZA4 A;  1MNL A;  2K54 A;  3CCV 3;  2IY2 A;  1BNJ A;  2XF3 A;  1BSC A;  3OWY A;  5ELJ A;  2QEX 3;  1TP6 A;  1BAO A;  4GHO A;  1YVS A;  3NBJ A;  2CFG A;  2UUG C;  4IIA A;  1D6U A;  1UCL A;  3CME 3;  2XR8 B;  2F98 A;  4NPB A;  3HZP A;  3KSP A;  1B2U A;  3BU4 A;  3NBR A;  4FCM A;  3X3Z A;  3HOH A;  1YIJ 3;  5JBS A;  1K41 A;  6RNT A;  3F8X A;  1GMQ A;  1RCK A;  4XBX A;  3WA3 A;  1VQ5 3;  1RMS A;  3N54 B;  5EVH A;  2OQE C;  2GU3 A;  2PZV A;  2GXF A;  3NQY A;  3ER7 A;  1Y4K A;  4WYK A;  3WOF B;  1IU7 A;  1Q81 4;  3F7S A;  1V58 A;  3M8C A;  7STD A;  3KCH A;  1DMQ A;  1W5Z A;  1QAF A;  3QRD A;  2CWU A;  5ELU A;  3UL5 A;  1AR0 A;  3LT9 A;  4R4K A;  1O7P B;  4FCJ A;  1Q86 4;  1W01 A;  3GWR A;  1VQ7 3;  4WYK B;  1W2B 2;  5M18 A;  2H0G A;  5G2G A;  1JN5 A;  2RCD A;  1RLS A;  1N5H A;  3SX1 A;  1M9G A;  4LGQ A;  1N9J A;  1K28 A;  2C11 A;  3BLZ A;  3MSO A;  1BRI A;  1IV7 A;  2B1X B;  4WFO A;  4FCZ A;  3DGO A;  2F99 A;  1YJ9 3;  1NWW A;  3LTB A;  1UCJ A;  1KSI A;  4DKI A;  1N8Q A;  5LC6 A;  5CF2 A;  3F40 A;  4O3V A;  1TRQ A;  2OTJ 3;  1JN5 B;  4J5G A;  5D81 A;  3X3X A;  1STF I;  1UI8 A;  4NRE A;  1NDO B;  1RSN A;  3EE1 A;  2XSH B;  5STD A;  2BMO B;  5IG0 A;  2O3O A;  4G1M B;  1B3S A;  1OHS A;  1AVK A;  2P38 A;  3ZG5 A;  1BUJ A;  3X40 A;  4AEQ A;  1GOY A;  4XBT A;  3SED A;  3EC9 A;  1OAC A;  3CPO A;  4MMX B;  3D3L A;  1BSE A;  2ML6 A;  3OX9 A;  5HGR A;  1X1X A;  5BU4 A;  3AMO A;  2CX1 A;  2HMN B;  2XH9 A;  1DE3 A;  4HM4 B;  3NXJ A;  1UI7 A;  4RBN A;  1U5O A;  4MMZ B;  3UJM A;  1UCK A;  1VQM 3;  4HZ9 B;  3BIR A;  3I56 3;  3DZL A;  5DRV A;  8CHO A;  1ASK A;  4LMI A;  2ZDJ A;  2B24 B;  3X3Y A;  1RGC A;  1GYB A;  4EXR A;  1DVD A;  2GU1 A;  2D1W A;  1IVW A;  1JV2 B;  3MG1 A;  1BIR A;  3V98 A;  3CXC 2;  1RNB A;  1A90 A;  1MGR A;  1CEW I;  1I2E A;  1GMP A;  1JNQ A;  3RGA A;  2HML B;  3LOY A;  2XFS A;  4JF8 A;  3F9S A;  1SIH A;  4KT3 B;  1FGO A;  4N6U A;  2H0I A;  3CU3 A;  1J2B A;  1WQL B;  2MF7 A;  5DRE A;  2IUK A;  2Q07 A;  3Q2P A;  1I3F A;  4O8S A;  1TFK A;  2CIU A;  1OCV A;  2KF4 A;  1B2M A;  1MWR A;  2BIR A;  3JUP A;  2BO9 B;  3MG3 A;  2CFL A;  1STD A;  1UUV B;  3X41 A;  2BMQ B;  1WTH A;  2KF3 A;  4N6T A;  1E97 A;  1W4N A;  2KCD A;  2UGI A;  4XBY A;  4CJN A;  1D6Y A;  1AV4 A;  4RNT A;  1S5A A;  2V1L A;  3BND A;  3EQQ B;  3DY5 A;  5IG5 A;  1WNH A;  4WWU C;  3MG2 A;  2STD A;  3WMD A;  4KFD A;  1JBS A;  1GD3 A;  5BXQ A;  1IQX A;  1O7G B;  2YX9 A;  2CG0 A;  4J9A A;  1A2V A;  1GOV A;  2AAD A;  3G0K A;  1JJ2 2;  1BNF A;  3SLU A;  1FGM A;  3JUO A;  4FMC A;  3WOE B;  1WMP A;  1YJW 3;  1I2G A;  1I8V A;  1LOV A;  1RGG A;  1AVL A;  5IF6 A;  2PNC A;  5IEP A;  3CNX A;  4BTW A;  4MJD A;  3S28 A;  3OW2 2;  1MWS A;  3DMC A;  3AHS A;  3KKG A;  4HBR A;  5I97 A;  6STD A;  2YFJ B;  3O8Y A;  3G16 A;  1ULJ B;  5CK6 A;  3G6E 3;  3EN1 B;  1KWI A;  3LXU X;  4HM6 B;  1RCL A;  1BRS A;  4XB5 A;  5EEO A;  2W04 A;  1OHP A;  1RNT A;  2F56 A;  2JQ5 A;  4N6N B;  3T0U A;  1LVN A;  1UDI I;  3D4A A;  4X2H A;  1FGQ A;  3FKA A;  1TRP A;  3K5T A;  1IK3 A;  1HKX A;  5JPP A;  1CH0 A;  3RGR A;  1O7H B;  4J5K A;  2BT3 A;  1M1K 4;  5AYS C;  4R1K A;  2JDI H;  3F14 A;  4AKZ A; 
#chains in the Genus database with same CATH homology
 4O2H A;  1GY6 A;  5A0O B;  3CCE 3;  4R9L A;  1WMO A;  2E2T A;  3S67 A;  5CXO A;  2INX A;  3CNM A;  3NM7 A;  1TFO A;  2OTL 3;  3NBB A;  2L4V A;  1W6G A;  1O7N B;  4XM4 A;  3KII A;  3FZW A;  4CDL A;  5FGO A;  5FW5 A;  2CHC A;  3D9R A;  1QVF 2;  1YI2 3;  2XRX B;  5CF1 A;  1IT7 A;  4BTY A;  1VQN 3;  5IG4 A;  4HM0 B;  1ZX2 A;  4EBG A;  1YGE A;  4Q53 A;  3ROB A;  3CCR 3;  4EV5 A;  5AEW B;  2BHM A;  4QWT A;  3QK9 A;  2CWV A;  1OPY A;  3HII A;  3MWZ A;  3L0R A;  2CFK A;  3A76 A;  4FR9 A;  3PCR A;  2P0X A;  1JKG A;  1N9E A;  1O7W B;  1YHQ 3;  1KC8 4;  1SII A;  3V92 A;  1VQ9 3;  2MC8 A;  2OOV A;  1TIJ A;  2HMK B;  2SBL A;  3G8Z A;  4HM5 B;  4I4K A;  4RNZ A;  5D82 A;  3CC4 3;  3KFQ C;  2Z76 A;  5AII A;  2WGQ A;  4L8P A;  1FUW A;  1JB2 A;  1JKG B;  4HM3 B;  3EBY A;  3STD A;  5JPU A;  1UUW B;  3BNC A;  1K73 4;  1VQO 3;  1C7H A;  3SXX A;  3BNB A;  2KRT A;  2W03 A;  4K1V A;  3GZY B;  2W9Q A;  3UNL A;  4N6L A;  4OK0 A;  2W0Q A;  5KP1 A;  3OXA A;  3BNE A;  5AYR B;  4GL6 A;  2KXG A;  1YJN 3;  2OCT A;  3CCS 3;  1EG9 B;  2CFD A;  3DUK A;  3GRD A;  1EQK A;  3EF8 A;  3Q90 A;  2OOV C;  4KVH A;  1RJO A;  3FCS B;  1A67 A;  1QJG A;  2P09 A;  1GS3 A;  2C10 A;  3K7C A;  5AEU B;  4XDV A;  4LEH A;  3DXO A;  2W9P A;  3CCL 3;  5LC7 A;  3JUN A;  1RKY A;  3ECF A;  3JVC A;  4WHA A;  3CC2 3;  1SJW A;  3DGL A;  2XFT A;  2LYX A;  1BUQ A;  1GY5 A;  4HYZ A;  3NV0 B;  1SPU A;  3LZA A;  3MKI A;  4KFF A;  3S27 A;  3MPH A;  1ISK A;  3IMA B;  1IV9 A;  2LQV A;  3WDG B;  3U1W A;  1OUN A;  3GZB A;  1HU9 A;  2D42 A;  3VSY A;  3KSE D;  4PEJ A;  1CYV A;  3EX9 A;  2CC3 A;  1OH0 A;  4RZM A;  1N5P A;  2O9U X;  3CC7 3;  1RRH A;  2E2U A;  3F8H A;  2CFW A;  2FXT A;  2RGQ A;  3LTA A;  3G71 3;  5BVB A;  4HM2 B;  3LYG A;  4OVM A;  3S29 A;  1RRL A;  2ML5 A;  3KZT A;  4K90 B;  3T8U A;  1T5Y A;  1JRQ A;  1IVV A;  1OGZ A;  2W2C A;  4N3V A;  3CCM 3;  3EN8 A;  4NHF A;  1D6Z A;  1DMM A;  3PXM A;  1U8C B;  4FMA A;  4EV2 A;  1UW1 A;  4KFE A;  4HM7 B;  2Y73 A;  1N8R 4;  1IDP A;  3N8B A;  4HVN A;  3G4S 3;  1VQP 3;  2UX0 A;  3HK4 A;  5CLK A;  3PS8 A;  3MYT A;  1R4C A;  3HI7 A;  2Z7A A;  4N6M A;  3JUM A;  1Q40 A;  3Q1C A;  1GD4 A;  5KP3 A;  1YIT 3;  1VQK 3;  3UL6 A;  1NB3 I;  3EHC A;  4MEI A;  4CCV A;  3WOD G;  2K0M A;  3FG3 A;  4IPB A;  2GBX B;  3I55 3;  4HZB B;  3K9M C;  3NX0 A;  1Q40 B;  3DGM A;  2YFL B;  5ELJ A;  2P0M A;  2I9W A;  2OWP A;  1OHO A;  1W6C A;  3TDG A;  3OWS A;  2XGL A;  4HM1 B;  3S5C A;  3NM2 A;  4U13 A;  4RNY A;  4R80 A;  1EKM A;  4ZM8 A;  1FA3 A;  3K63 A;  1PU4 A;  3IPT A;  1IVU A;  2Y74 A;  1ULI B;  3DGN A;  3CCJ 3;  1QMA A;  1LNH A;  1W7C A;  1EA2 A;  1M1X B;  4LSO A;  1S72 3;  3EJV A;  4EYC A;  5EQL A;  4O02 B;  3WA2 X;  2YFI B;  3EB8 A;  3CD6 3;  3CMA 3;  1VQ8 3;  1W00 A;  4MMY B;  5AIF A;  3PCS A;  5TGN A;  4EC6 A;  1RN7 A;  4JRF A;  1CYU A;  1LOX A;  3GAX A;  3DM8 A;  4ORL A;  3FG4 A;  4KZ1 A;  3NHX A;  1W6Y A;  3LH4 A;  2FGT A;  3NQZ A;  1NB5 I;  3FF2 A;  1Z1S A;  3RDE A;  3LML A;  3IJE B;  1M90 4;  1VQ4 3;  3JUQ A;  2M7O A;  1K8A 4;  1ZO2 A;  1PFP A;  1US1 A;  4H61 A;  2HMM B;  5AI1 A;  1NJI 4;  2RFR A;  3J7Y d;  1W02 A;  1MOL A;  3FH1 A;  4IT7 A;  3MHE A;  1K9M 4;  4K61 A;  1A2K A;  1VZZ A;  2GEX A;  2CW9 A;  3U97 A;  1IQ8 A;  1F8N A;  3ALA A;  3GZR A;  3NV0 A;  2R4I A;  4H3U A;  5KP4 A;  2CWT A;  3FF0 A;  1IT8 A;  1ROA A;  3SOA A;  1QVG 2;  3KN4 A;  3LTC A;  4XDW A;  5IG3 A;  1FGT A;  3CCU 3;  1Q82 4;  1DMN A;  3CPW 2;  2F86 B;  1NU3 A;  1CQS A;  1O7M B;  1VQ6 3;  1SQW A;  2WGO A;  3FSD A;  4N6V 0;  1Q42 A;  3LTD A;  3HIG A;  1OF5 A;  3B4P A;  4GB5 A;  4TX4 A;  4X2O A;  4R9K A;  3SOY A;  4L8O A;  2FNQ A;  3NUV A;  3AMO B;  1JB5 A;  3N9H A;  4N6O B;  3B7C A;  2ZL8 A;  2CG1 A;  3UB1 A;  5IEN A;  1E3V A;  3I0Y A;  5IEO A;  1OF5 B;  4L7K A;  3CCQ 3;  1WMN A;  1LXE A;  2CK3 H;  2IMJ A;  3OWU A;  5IW9 A;  2XGN A;  3KE7 A;  3OV4 A;  1IQY A;  5AIH A;  1ROV A;  3SVA A;  3T8N A;  4HJL B;  3FGY A;  4HM8 B;  1Q7Y 4;  1DYU A;  3E99 A;  1L5G B;  2GEY A;  1QAL A;  2CKF B;  2GBW B;  1IVX A;  2WOF A;  2W6J H;  1OGX A;  3VF1 A;  2BNG A;  1V74 A;  1TUH A;  1YVB I;  4BTX A;  2HMO B;  3FLJ A;  1GY7 A;  2E2V A;  2XSO B;  5IER A;  5D83 A;  3BB9 A;  1KQS 2;  3B4O A;  3H51 A;  4STD A;  2QA4 3;  1TU5 A;  3EBT A;  2BMR B;  1FGR A;  1KD1 4;  1E3R A;  2JDI H;  4HKV B;  3F7X A;  3H3H A;  2HMJ B;  2W56 A;  2Z77 A;  3PYJ A;  1QAK A;  1G96 A;  2IA7 A;  2WO0 A;  2WOH A;  3HX8 A;  4J8T A;  1NO3 A;  2CH9 A;  3VGN A;  3LT8 A;  4AKY A;  3FG1 A;  3GZX B;  3V99 A;  3X42 A;  3K0Z A;  4LZI A;  2XEP A;  5AIG A;  1VQL 3;  1W2Z A;  2OQE A;  2QGU A;  2IUJ A;  2W56 B;  3B8L A;  2A15 A;  4OUQ A;  2RSX A;  3PGB A;  4FMD A;  2QIY A;  4FMB A;  4K1U A;  1JB4 A;  3PZW A;  1DVC A;  4WP5 A;  2Z6B A;  3CCV 3;  1MNL A;  2K54 A;  2XF3 A;  3OWY A;  2QEX 3;  1TP6 A;  3NBJ A;  2CFG A;  4IIA A;  1D6U A;  3CME 3;  2XR8 B;  2F98 A;  3HZP A;  3KSP A;  4FCM A;  1YIJ 3;  3NBR A;  3X3Z A;  5JBS A;  1K41 A;  3F8X A;  3WA3 A;  4XBX A;  1VQ5 3;  3N54 B;  5EVH A;  2OQE C;  2GU3 A;  2PZV A;  2GXF A;  3NQY A;  3ER7 A;  1Y4K A;  4WYK A;  3WOF B;  1IU7 A;  1Q81 4;  3F7S A;  3M8C A;  7STD A;  1DMQ A;  1W5Z A;  1QAF A;  3QRD A;  2CWU A;  5ELU A;  3UL5 A;  1AR0 A;  3LT9 A;  4R4K A;  1O7P B;  4FCJ A;  1Q86 4;  1W01 A;  3GWR A;  1VQ7 3;  4WYK B;  1W2B 2;  5G2G A;  1JN5 A;  2RCD A;  1N5H A;  3SX1 A;  1M9G A;  4LGQ A;  1N9J A;  1K28 A;  2C11 A;  3BLZ A;  3MSO A;  1IV7 A;  2B1X B;  4WFO A;  4FCZ A;  3DGO A;  2F99 A;  1YJ9 3;  1NWW A;  3LTB A;  1KSI A;  1N8Q A;  5LC6 A;  5CF2 A;  3F40 A;  4O3V A;  2OTJ 3;  1JN5 B;  5D81 A;  3X3X A;  1STF I;  1UI8 A;  4NRE A;  1NDO B;  3EE1 A;  5STD A;  2XSH B;  2BMO B;  5IG0 A;  2O3O A;  4G1M B;  1OHS A;  1AVK A;  2P38 A;  3X40 A;  4AEQ A;  4XBT A;  3SED A;  3EC9 A;  1OAC A;  3CPO A;  4MMX B;  3D3L A;  2ML6 A;  3OX9 A;  5HGR A;  3AMO A;  2HMN B;  2XH9 A;  4HM4 B;  3NXJ A;  1UI7 A;  4RBN A;  1U5O A;  4MMZ B;  3UJM A;  1VQM 3;  4HZ9 B;  3I56 3;  3DZL A;  5DRV A;  8CHO A;  1ASK A;  4LMI A;  2ZDJ A;  2B24 B;  3X3Y A;  1GYB A;  4EXR A;  1DVD A;  2GU1 A;  2D1W A;  1IVW A;  1JV2 B;  3MG1 A;  3V98 A;  3CXC 2;  1A90 A;  1CEW I;  1JNQ A;  3RGA A;  2HML B;  3LOY A;  2XFS A;  4JF8 A;  3F9S A;  1SIH A;  1FGO A;  4N6U A;  3CU3 A;  1J2B A;  1WQL B;  2MF7 A;  5DRE A;  2IUK A;  2Q07 A;  3Q2P A;  4O8S A;  1TFK A;  2CIU A;  1OCV A;  3JUP A;  2BO9 B;  3MG3 A;  2CFL A;  1STD A;  1UUV B;  3X41 A;  2BMQ B;  1WTH A;  4N6T A;  1E97 A;  1W4N A;  2KCD A;  4XBY A;  1D6Y A;  1AV4 A;  1S5A A;  2V1L A;  3BND A;  3EQQ B;  3DY5 A;  5IG5 A;  1WNH A;  4WWU C;  3MG2 A;  2STD A;  3WMD A;  4KFD A;  1GD3 A;  5BXQ A;  1IQX A;  1O7G B;  2YX9 A;  2CG0 A;  4J9A A;  1A2V A;  3G0K A;  1JJ2 2;  3SLU A;  1FGM A;  3JUO A;  4FMC A;  3WOE B;  1WMP A;  1YJW 3;  1AVL A;  5IF6 A;  2PNC A;  5IEP A;  3CNX A;  4BTW A;  4MJD A;  3S28 A;  3OW2 2;  3DMC A;  3KKG A;  4HBR A;  5I97 A;  6STD A;  2YFJ B;  3O8Y A;  3G16 A;  1ULJ B;  5CK6 A;  3G6E 3;  3EN1 B;  1KWI A;  3LXU X;  4HM6 B;  5EEO A;  4XB5 A;  2W04 A;  1OHP A;  2JQ5 A;  4N6N B;  3T0U A;  1LVN A;  4X2H A;  1FGQ A;  3FKA A;  1IK3 A;  3K5T A;  1HKX A;  5JPP A;  3RGR A;  1O7H B;  2BT3 A;  1M1K 4;  5AYS C;  4R1K A;  2P05 A;  3F14 A;  4AKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...