4N75A

Structural basis of bama-mediate outer membrane protein biogenesis
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
385
structure length
379
Chain Sequence
MNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTVDGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSNMQPQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAVYFPHQASNYDPDYDYECATQDGAKDLCKSDDAVGGNAMAVASLEFITPTPFISVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGKTW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional analysis of the beta-barrel domain of BamA from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords Outer membrane protein assembly factor BamA
total genus 90
structure length 379
sequence length 385
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01103 Bac_surface_Ag Surface antigen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.50 Mainly Beta Beta Barrel Porin membrane protein fhac: a member of the omp85/tpsb transporter family 4n75A00
4C00A 4C4VA 4N75A 4K3BA 4C4VB 4K3CA 3NJTA 4N74A
chains in the Genus database with same CATH superfamily
3HOEA 4QQ1A 4FOZA 4LSHA 2N2MA 3HWBA 5E79O 2MNHA 4AFKA 3DWOX 2XTQA 3WI5A 3WU2O 2KDYA 2R4OA 1QJ9A 2XE5A 2QTKA 4O3ZA 3PRNA 3PQSA 4O3WA 5IYUA 3AA6B 3AA7B 2F1TA 5DL6A 2W81C 3POUA 4IL6O 4G75A 5AFUL 5GTHO 2X27X 2X9KA 3EMNX 5B5EO 1ZHXA 4BUMX 2Y0HA 4C4VB 5KAIO 2XTRA 3LK3B 1S5LO 5EE2A 2R4LA 3VE2A 2K0LA 3QRCA 4FUVA 3SZVA 3UU2A 3A0BO 2OMFA 3A2SX 3VY8X 2N2LA 3G7GA 4GCPA 4LSIA 4E1TA 1G90A 3JTYA 4XNKA 3BRZA 4E1SA 4RLCA 3POQA 1ZHTA 2JQYA 4FZNA 4GCQA 4GF4A 4FMSA 3SY9A 3UPGA 3HW9A 3KZIO 5KAFO 2R4NA 3GP6A 5B66O 2J1NA 3PGSA 3AA6A 1BXWA 2Y2XA 1ZHZA 5PRNA 1HXTA 2IWVA 1IZNB 2XE3A 3T24A 5ADXL 2FGQX 3RBHA 1ORMA 2M07A 3PGUA 3V8UA 2WVPA 1BH3A 2W80C 2KC0A 3DA4A 2JMMA 1GFQA 3AA0A 1GFOA 1OPFA 4U9CA 4K3BA 4XNLA 4O4XA 5G38A 3T0SA 3PGRA 3KVDD 4B61A 4AYNA 4CTDA 5GTIO 4RJXA 1GFNA 4O3YA 1MM4A 3VZUX 1PRNA 5G26A 3LK2B 4JCHA 3VZWX 2ZLDA 1T16A 2XE1A 4RL9A 2LFUA 5TISO 4LSEA 4O3XB 4AKRB 5GV0A 4N74A 2K4TA 3JCUO 2J4UP 5G39A 2FGRA 2Y0KA 4PR7A 2PORA 4AUIA 2F1VA 3AA1B 1OSMA 4FRXA 4C69X 3PF1A 1PHOA 1ZHYA 4FSPA 4D65A 2LHFA 4KRAA 2WJQA 2R89A 2PRNA 3FYXA 3LK3A 3O0EA 4FQEA 3WI4A 3HOLA 2WJRA 1GFPA 5D5DA 3AA0B 4C00A 1GFMA 3BRYA 7PRNA 3DA3A 3AAEA 5DL8A 2ERVA 5G3AA 1IZNA 2XMXA 3SYSA 2AXTO 3SZDA 1H6S1 3LK42 2KZ7B 2M06A 2MHLA 1BT9A 1P4TA 3DWNA 4O49A 3QRAA 2ODJA 4LSFA 2Y7SA 2XG6A 3VZTX 1QJPA 3NJTA 3LK41 4D64A 5FVNA 2R8AA 3AA7A 4FZLA 4AKMA 1QJ8A 1HXUA 4PJ0O 3AAAB 1HXXA 1ZHWA 4AYID 5DL5A 4AZLA 5ADXK 3LK2A 2KZ7A 1YS5A 1Q9FA 3POXA 3PORA 2YPVA 4JFBA 3VY9X 2R4PA 5AFUK 2IWWA 3BS0A 4FZMA 2KXPB 4AYMC 4UB8O 4RJWA 1Q9GA 2YNKA 4RLBA 5T5FA 3AA1A 1MM5A 2O4VA 4AYDC 4F4BA 6PRNA 4D5UA 3NSGA 2R88A 1THQA 4GHBA 2Y0LA 3DZMA 4AYEC 5JDPA 2F1CX 3C5OA 4O4UA 3A0HO 2GE4A 4KR8A 4AKRA 3TZGA 4FSOA 4N75A 3UAQA 4KR4A 4UB6O 3SYBA 3SY7A 3K19A 4Z3TA 1MPFA 3AAAA 4N59A 4FRTA 4G76A 8PRNA 4FESA 4C4VA 4FT6A 2XE2A 3PQUA 4GCSA 4K3CA 4PUXA 5DL7A 4N58A 5H2FO 3T20A 1T1LA 3VE1A 3AAEB 2KXPA 1E54A 2ZFGA
chains in the Genus database with same CATH topology
4C00A 4C4VA 4N75A 4K3BA 4C4VB 4K3CA 3NJTA 4N74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C00 A;  4C4V A;  4N75 A;  4K3B A;  4C4V B;  4K3C A;  3NJT A;  4N74 A; 
#chains in the Genus database with same CATH topology
 3HOE A;  4QQ1 A;  4FOZ A;  4LSH A;  2N2M A;  3HWB A;  5E79 O;  2MNH A;  4AFK A;  3DWO X;  2XTQ A;  3WI5 A;  3WU2 O;  2KDY A;  2R4O A;  1QJ9 A;  2XE5 A;  2QTK A;  4O3Z A;  3PRN A;  3PQS A;  4O3W A;  5IYU A;  3AA6 B;  3AA7 B;  2F1T A;  5DL6 A;  2W81 C;  3POU A;  4IL6 O;  4G75 A;  5AFU L;  5GTH O;  2X27 X;  2X9K A;  3EMN X;  5B5E O;  1ZHX A;  4BUM X;  2Y0H A;  4C4V B;  5KAI O;  2XTR A;  3LK3 B;  1S5L O;  5EE2 A;  2R4L A;  3VE2 A;  2K0L A;  3QRC A;  4FUV A;  3SZV A;  3UU2 A;  3A0B O;  2OMF A;  3A2S X;  3VY8 X;  2N2L A;  3G7G A;  4GCP A;  4LSI A;  4E1T A;  1G90 A;  3JTY A;  4XNK A;  3BRZ A;  4E1S A;  4RLC A;  3POQ A;  1ZHT A;  2JQY A;  4FZN A;  4GCQ A;  4GF4 A;  4FMS A;  3SY9 A;  3UPG A;  3HW9 A;  3KZI O;  5KAF O;  2R4N A;  3GP6 A;  5B66 O;  2J1N A;  3PGS A;  3AA6 A;  1BXW A;  2Y2X A;  1ZHZ A;  5PRN A;  1HXT A;  2IWV A;  1IZN B;  2XE3 A;  3T24 A;  5ADX L;  2FGQ X;  3RBH A;  1ORM A;  2M07 A;  3PGU A;  3V8U A;  2WVP A;  1BH3 A;  2W80 C;  2KC0 A;  3DA4 A;  2JMM A;  1GFQ A;  3AA0 A;  1GFO A;  1OPF A;  4U9C A;  4K3B A;  4XNL A;  4O4X A;  5G38 A;  3T0S A;  3PGR A;  3KVD D;  4B61 A;  4AYN A;  4CTD A;  5GTI O;  4RJX A;  1GFN A;  4O3Y A;  1MM4 A;  3VZU X;  1PRN A;  5G26 A;  3LK2 B;  4JCH A;  3VZW X;  2ZLD A;  1T16 A;  2XE1 A;  4RL9 A;  2LFU A;  5TIS O;  4LSE A;  4O3X B;  4AKR B;  5GV0 A;  4N74 A;  2K4T A;  3JCU O;  2J4U P;  5G39 A;  2FGR A;  2Y0K A;  4PR7 A;  2POR A;  4AUI A;  2F1V A;  3AA1 B;  1OSM A;  4FRX A;  4C69 X;  3PF1 A;  1PHO A;  1ZHY A;  4FSP A;  4D65 A;  2LHF A;  4KRA A;  2WJQ A;  2R89 A;  2PRN A;  3FYX A;  3LK3 A;  3O0E A;  4FQE A;  3WI4 A;  3HOL A;  2WJR A;  1GFP A;  5D5D A;  3AA0 B;  4C00 A;  1GFM A;  3BRY A;  7PRN A;  3DA3 A;  3AAE A;  5DL8 A;  2ERV A;  5G3A A;  1IZN A;  2XMX A;  3SYS A;  2AXT O;  3SZD A;  1H6S 1;  3LK4 2;  2KZ7 B;  2M06 A;  2MHL A;  1BT9 A;  1P4T A;  3DWN A;  4O49 A;  3QRA A;  2ODJ A;  4LSF A;  2Y7S A;  2XG6 A;  3VZT X;  1QJP A;  3NJT A;  3LK4 1;  4D64 A;  5FVN A;  2R8A A;  3AA7 A;  4FZL A;  4AKM A;  1QJ8 A;  1HXU A;  4PJ0 O;  3AAA B;  1HXX A;  1ZHW A;  4AYI D;  5DL5 A;  4AZL A;  5ADX K;  3LK2 A;  2KZ7 A;  1YS5 A;  1Q9F A;  3POX A;  3POR A;  2YPV A;  4JFB A;  3VY9 X;  2R4P A;  5AFU K;  2IWW A;  3BS0 A;  4FZM A;  2KXP B;  4AYM C;  4UB8 O;  4RJW A;  1Q9G A;  2YNK A;  4RLB A;  5T5F A;  3AA1 A;  1MM5 A;  2O4V A;  4AYD C;  4F4B A;  6PRN A;  4D5U A;  3NSG A;  2R88 A;  1THQ A;  4GHB A;  2Y0L A;  3DZM A;  4AYE C;  5JDP A;  2F1C X;  3C5O A;  4O4U A;  3A0H O;  2GE4 A;  4KR8 A;  4AKR A;  3TZG A;  4FSO A;  4N75 A;  3UAQ A;  4KR4 A;  4UB6 O;  3SYB A;  3SY7 A;  3K19 A;  4Z3T A;  1MPF A;  3AAA A;  4N59 A;  4FRT A;  4G76 A;  8PRN A;  4FES A;  4C4V A;  4FT6 A;  2XE2 A;  3PQU A;  4GCS A;  4K3C A;  4PUX A;  5DL7 A;  4N58 A;  5H2F O;  3T20 A;  1T1L A;  3VE1 A;  3AAE B;  2KXP A;  1E54 A;  2ZFG A; 
#chains in the Genus database with same CATH homology
 4C00 A;  4C4V A;  4N75 A;  4K3B A;  4C4V B;  4K3C A;  3NJT A;  4N74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...