4N75A

Structural basis of bama-mediate outer membrane protein biogenesis
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
385
structure length
379
Chain Sequence
MNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTVDGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSNMQPQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAVYFPHQASNYDPDYDYECATQDGAKDLCKSDDAVGGNAMAVASLEFITPTPFISVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGKTW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Outer membrane protein assembly factor BamA
publication title Structural and functional analysis of the beta-barrel domain of BamA from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 90
structure length 379
sequence length 385
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01103 Bac_surface_Ag Surface antigen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.50 Mainly Beta Beta Barrel Porin membrane protein fhac: a member of the omp85/tpsb transporter family 4n75A00
4N75A 4C00A 4K3BA 3NJTA 4N74A 4K3CA 4C4VB 4C4VA
chains in the Genus database with same CATH superfamily
3LK2A 4FSOA 4PUXA 4N75A 4Z3TA 2N2MA 3SYBA 4K3BA 4UB6O 2IWVA 3SY7A 3A0HO 3UPGA 4C4VA 2MHLA 1T16A 4G75A 4RJWA 5DL7A 5KAFO 3T24A 1G90A 1BH3A 3VY8X 3HOLA 1BT9A 3GP6A 4AKRB 4AYDC 1MM4A 1ZHZA 1ZHYA 1IZNB 3AA0A 3BRYA 3HW9A 4FSPA 2F1TA 4IL6O 4D64A 1HXXA 5ADXL 2GE4A 1P4TA 4AYID 4FZLA 4FMSA 2YPVA 4D65A 1E54A 3AAAB 2KDYA 3LK3B 1GFNA 2ODJA 4KRAA 3BS0A 3PORA 4O4XA 4U9CA 3V8UA 3WI4A 3PQSA 1ORMA 2K0LA 3AA6B 2XTQA 4FUVA 5T5FA 4F4BA 1QJPA 2Y0HA 4RL9A 4N59A 4C00A 5G3AA 4FZNA 4E1TA 4FOZA 3VZTX 3BRZA 3T0SA 2JMMA 5AFUL 1ZHXA 3DA3A 3VZUX 4XNLA 3KVDD 1OSMA 2QTKA 3KZIO 4N58A 3UU2A 4C69X 5AFUK 2R4LA 4LSEA 3VE1A 4FQEA 1GFQA 4PR7A 3DZMA 4AKRA 1PRNA 5JDPA 4E1SA 1IZNA 1GFPA 4FESA 1PHOA 3SY9A 2IWWA 1OPFA 4CTDA 4D5UA 2J1NA 4FT6A 4XNKA 3WI5A 4O4UA 3EMNX 1MPFA 3TZGA 4GHBA 1S5LO 1HXUA 3AAAA 1T1LA 2XG6A 3C5OA 3LK3A 2KC0A 3SZVA 5GV0A 3PQUA 3JCUO 1QJ8A 2XMXA 3AA6A 8PRNA 3AAEB 6PRNA 5GTIO 3NJTA 3VZWX 4RLCA 5H2FO 1ZHWA 3DWNA 4AYNA 3T20A 4LSHA 4O3YA 4RLBA 2FGQX 3AA7B 4FZMA 2KXPB 5IYUA 3HOEA 3DWOX 4QQ1A 2R4OA 2YNKA 4N74A 2XE3A 4AZLA 4B61A 5G38A 2M07A 3HWBA 4UB8O 1YS5A 2XE1A 4AUIA 5DL5A 4GCQA 3AA1B 3K19A 4K3CA 2AXTO 5E79O 2W80C 2N2LA 2WJRA 3POUA 3A2SX 4O3WA 2Y0LA 2PORA 3FYXA 2K4TA 3O0EA 4O3ZA 1H6S1 2WJQA 1MM5A 5DL6A 4AFKA 5B5EO 3PGRA 4RJXA 7PRNA 3AAEA 1ZHTA 2ZLDA 3DA4A 3VE2A 2W81C 2F1CX 2Y7SA 3VY9X 5EE2A 5G26A 2ERVA 2XE2A 3PGSA 3UAQA 5TISO 3NSGA 1GFOA 3RBHA 2KZ7B 3LK2B 2PRNA 3QRAA 1QJ9A 2R89A 4LSFA 2ZFGA 3AA7A 2KXPA 3QRCA 4FRXA 5B66O 4C4VB 2Y0KA 4GF4A 4FRTA 3A0BO 4JFBA 4AKMA 4GCSA 4KR4A 4LSIA 4JCHA 3AA0B 5DL8A 3WU2O 4BUMX 2F1VA 3POXA 5KAIO 2R88A 3AA1A 3PF1A 2LHFA 5PRNA 5ADXK 2O4VA 2X9KA 3PGUA 1Q9FA 4O3XB 2R8AA 5D5DA 2Y2XA 3SZDA 3SYSA 2J4UP 2WVPA 4PJ0O 5GTHO 2JQYA 1BXWA 2OMFA 1GFMA 2MNHA 3LK41 4G76A 1HXTA 5FVNA 2XE5A 2R4NA 1THQA 4KR8A 1Q9GA 3LK42 4AYEC 2M06A 2XTRA 3JTYA 4GCPA 4O49A 2X27X 3PRNA 3POQA 5G39A 2R4PA 3G7GA 2LFUA 2FGRA 4AYMC 2KZ7A
chains in the Genus database with same CATH topology
4N75A 4C00A 4K3BA 3NJTA 4N74A 4K3CA 4C4VB 4C4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N75 A;  4C00 A;  4K3B A;  3NJT A;  4N74 A;  4K3C A;  4C4V B;  4C4V A; 
#chains in the Genus database with same CATH topology
 3LK2 A;  4FSO A;  4PUX A;  4N75 A;  4Z3T A;  2N2M A;  3SYB A;  4K3B A;  4UB6 O;  2IWV A;  3SY7 A;  3A0H O;  3UPG A;  4C4V A;  2MHL A;  1T16 A;  4G75 A;  4RJW A;  5DL7 A;  5KAF O;  3T24 A;  1G90 A;  1BH3 A;  3VY8 X;  3HOL A;  1BT9 A;  3GP6 A;  4AKR B;  4AYD C;  1MM4 A;  1ZHZ A;  1ZHY A;  1IZN B;  3AA0 A;  3BRY A;  3HW9 A;  4FSP A;  2F1T A;  4IL6 O;  4D64 A;  1HXX A;  5ADX L;  2GE4 A;  1P4T A;  4AYI D;  4FZL A;  4FMS A;  2YPV A;  4D65 A;  1E54 A;  3AAA B;  2KDY A;  3LK3 B;  1GFN A;  2ODJ A;  4KRA A;  3BS0 A;  3POR A;  4O4X A;  4U9C A;  3V8U A;  3WI4 A;  3PQS A;  1ORM A;  2K0L A;  3AA6 B;  2XTQ A;  4FUV A;  5T5F A;  4F4B A;  1QJP A;  2Y0H A;  4RL9 A;  4N59 A;  4C00 A;  5G3A A;  4FZN A;  4E1T A;  4FOZ A;  3VZT X;  3BRZ A;  3T0S A;  2JMM A;  5AFU L;  1ZHX A;  3DA3 A;  3VZU X;  4XNL A;  3KVD D;  1OSM A;  2QTK A;  3KZI O;  4N58 A;  3UU2 A;  4C69 X;  5AFU K;  2R4L A;  4LSE A;  3VE1 A;  4FQE A;  1GFQ A;  4PR7 A;  3DZM A;  4AKR A;  1PRN A;  5JDP A;  4E1S A;  1IZN A;  1GFP A;  4FES A;  1PHO A;  3SY9 A;  2IWW A;  1OPF A;  4CTD A;  4D5U A;  2J1N A;  4FT6 A;  4XNK A;  3WI5 A;  4O4U A;  3EMN X;  1MPF A;  3TZG A;  4GHB A;  1S5L O;  1HXU A;  3AAA A;  1T1L A;  2XG6 A;  3C5O A;  3LK3 A;  2KC0 A;  3SZV A;  5GV0 A;  3PQU A;  3JCU O;  1QJ8 A;  2XMX A;  3AA6 A;  8PRN A;  3AAE B;  6PRN A;  5GTI O;  3NJT A;  3VZW X;  4RLC A;  5H2F O;  1ZHW A;  3DWN A;  4AYN A;  3T20 A;  4LSH A;  4O3Y A;  4RLB A;  2FGQ X;  3AA7 B;  4FZM A;  2KXP B;  5IYU A;  3HOE A;  3DWO X;  4QQ1 A;  2R4O A;  2YNK A;  4N74 A;  2XE3 A;  4AZL A;  4B61 A;  5G38 A;  2M07 A;  3HWB A;  4UB8 O;  1YS5 A;  2XE1 A;  4AUI A;  5DL5 A;  4GCQ A;  3AA1 B;  3K19 A;  4K3C A;  2AXT O;  5E79 O;  2W80 C;  2N2L A;  2WJR A;  3POU A;  3A2S X;  4O3W A;  2Y0L A;  2POR A;  3FYX A;  2K4T A;  3O0E A;  4O3Z A;  1H6S 1;  2WJQ A;  1MM5 A;  5DL6 A;  4AFK A;  5B5E O;  3PGR A;  4RJX A;  7PRN A;  3AAE A;  1ZHT A;  2ZLD A;  3DA4 A;  3VE2 A;  2W81 C;  2F1C X;  2Y7S A;  3VY9 X;  5EE2 A;  5G26 A;  2ERV A;  2XE2 A;  3PGS A;  3UAQ A;  5TIS O;  3NSG A;  1GFO A;  3RBH A;  2KZ7 B;  3LK2 B;  2PRN A;  3QRA A;  1QJ9 A;  2R89 A;  4LSF A;  2ZFG A;  3AA7 A;  2KXP A;  3QRC A;  4FRX A;  5B66 O;  4C4V B;  2Y0K A;  4GF4 A;  4FRT A;  3A0B O;  4JFB A;  4AKM A;  4GCS A;  4KR4 A;  4LSI A;  4JCH A;  3AA0 B;  5DL8 A;  3WU2 O;  4BUM X;  2F1V A;  3POX A;  5KAI O;  2R88 A;  3AA1 A;  3PF1 A;  2LHF A;  5PRN A;  5ADX K;  2O4V A;  2X9K A;  3PGU A;  1Q9F A;  4O3X B;  2R8A A;  5D5D A;  2Y2X A;  3SZD A;  3SYS A;  2J4U P;  2WVP A;  4PJ0 O;  5GTH O;  2JQY A;  1BXW A;  2OMF A;  1GFM A;  2MNH A;  3LK4 1;  4G76 A;  1HXT A;  5FVN A;  2XE5 A;  2R4N A;  1THQ A;  4KR8 A;  1Q9G A;  3LK4 2;  4AYE C;  2M06 A;  2XTR A;  3JTY A;  4GCP A;  4O49 A;  2X27 X;  3PRN A;  3POQ A;  5G39 A;  2R4P A;  3G7G A;  2LFU A;  2FGR A;  4AYM C;  2KZ7 A; 
#chains in the Genus database with same CATH homology
 4N75 A;  4C00 A;  4K3B A;  3NJT A;  4N74 A;  4K3C A;  4C4V B;  4C4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...