4N75A

Structural basis of bama-mediate outer membrane protein biogenesis
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
385
structure length
379
Chain Sequence
MNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTVDGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSNMQPQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAVYFPHQASNYDPDYDYECATQDGAKDLCKSDDAVGGNAMAVASLEFITPTPFISVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGKTW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional analysis of the beta-barrel domain of BamA from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords Outer membrane protein assembly factor BamA
total genus 90
structure length 379
sequence length 385
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01103 Bac_surface_Ag Surface antigen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.50 Mainly Beta Beta Barrel Porin membrane protein fhac: a member of the omp85/tpsb transporter family 4n75A00
4C4VB 4K3CA 4K3BA 4N75A 4C00A 4C4VA 4N74A 3NJTA
chains in the Genus database with same CATH superfamily
1IZNA 1OSMA 1HXXA 2XTQA 4LSIA 5G3AA 3VZUX 5AFUL 2J4UP 2KZ7B 3PGUA 4O4XA 1ZHZA 3DA4A 4FSPA 2GE4A 5G39A 4AZLA 2M07A 3A0BO 2N2LA 1ZHYA 3LK3B 1QJPA 3POUA 4XNLA 1BXWA 1GFOA 2K4TA 4KR8A 4D64A 4GHBA 3HOEA 3JTYA 3LK3A 3G7GA 3PGRA 3LK41 3SYSA 3T20A 1P4TA 3KZIO 3PQUA 3DWNA 5B66O 1OPFA 4AKRA 1S5LO 4FZMA 4C4VA 5D5DA 2Y7SA 2ODJA 4UB6O 5DL8A 5G38A 2JQYA 1PRNA 4C4VB 4AKMA 2Y2XA 3PRNA 3AA6A 4O3WA 4FESA 2R4NA 4N75A 5DL5A 5FVNA 2YPVA 5GTHO 5H2FO 4RLBA 3AA1B 3DA3A 3O0EA 3VE1A 3AA6B 3NSGA 5KAFO 5T5FA 1BH3A 3VZTX 4AYMC 4F4BA 2X27X 3VE2A 3LK2A 4N59A 1E54A 4FUVA 2YNKA 3WU2O 4RL9A 5B5EO 4AYNA 4IL6O 4BUMX 2ERVA 3V8UA 3QRCA 3JCUO 1GFPA 4PJ0O 3LK42 4RJXA 3AAEB 1ZHXA 3C5OA 4QQ1A 2R4PA 5PRNA 4FZNA 2ZFGA 2IWVA 5KAIO 5AFUK 6PRNA 2JMMA 3HW9A 4AYEC 2R8AA 1GFMA 4CTDA 4K3CA 2LFUA 4FT6A 2W81C 3UAQA 2R4LA 3AAAA 7PRNA 2QTKA 2WVPA 2XE3A 4C69X 4D5UA 4RJWA 1IZNB 1T16A 2J1NA 2PRNA 3BRYA 2F1VA 2K0LA 3NJTA 4FRTA 2F1TA 5TISO 3WI5A 3SYBA 1THQA 3K19A 2KZ7A 1PHOA 2R4OA 4E1SA 4G75A 2Y0LA 4GF4A 4AFKA 4GCQA 2R89A 3PORA 4PR7A 2R88A 3VY9X 4O4UA 3DWOX 1Q9FA 1GFNA 5DL7A 2X9KA 4G76A 1GFQA 3A0HO 4AUIA 1G90A 4B61A 5G26A 4PUXA 8PRNA 1ZHTA 4E1TA 4RLCA 3SZDA 3SY9A 5DL6A 3T24A 1HXUA 2PORA 4AKRB 3DZMA 4O3XB 3KVDD 1MPFA 1QJ9A 2O4VA 3POQA 4LSEA 3VY8X 5GTIO 2AXTO 2OMFA 4GCPA 2MHLA 3RBHA 2XE2A 1BT9A 1MM4A 4KRAA 4O49A 3WI4A 2IWWA 2WJRA 3POXA 2XG6A 3T0SA 4JCHA 4FQEA 4N74A 3SY7A 3LK2B 2XMXA 4Z3TA 1QJ8A 4N58A 2XTRA 3VZWX 3PQSA 4C00A 5IYUA 2M06A 4FOZA 3PGSA 4AYDC 3PF1A 2ZLDA 3BRZA 4UB8O 2KXPB 1MM5A 4O3ZA 3EMNX 4XNKA 2KC0A 3AA1A 4LSHA 3UU2A 2N2MA 2KXPA 1YS5A 2MNHA 5EE2A 3BS0A 4LSFA 5E79O 3HWBA 1ORMA 2WJQA 1HXTA 3SZVA 4GCSA 1H6S1 2W80C 4D65A 5ADXL 4FSOA 3HOLA 1T1LA 2XE5A 5JDPA 3AAEA 4O3YA 4JFBA 2FGQX 3UPGA 3TZGA 3A2SX 4KR4A 5ADXK 3AA7A 4AYID 2XE1A 3AA0B 5GV0A 4K3BA 2F1CX 1Q9GA 2KDYA 2Y0KA 3AA7B 3FYXA 4FMSA 4FRXA 4U9CA 3QRAA 3AA0A 2Y0HA 4FZLA 3GP6A 3AAAB 2FGRA 1ZHWA 2LHFA
chains in the Genus database with same CATH topology
4C4VB 4K3CA 4K3BA 4N75A 4C00A 4C4VA 4N74A 3NJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C4V B;  4K3C A;  4K3B A;  4N75 A;  4C00 A;  4C4V A;  4N74 A;  3NJT A; 
#chains in the Genus database with same CATH topology
 1IZN A;  1OSM A;  1HXX A;  2XTQ A;  4LSI A;  5G3A A;  3VZU X;  5AFU L;  2J4U P;  2KZ7 B;  3PGU A;  4O4X A;  1ZHZ A;  3DA4 A;  4FSP A;  2GE4 A;  5G39 A;  4AZL A;  2M07 A;  3A0B O;  2N2L A;  1ZHY A;  3LK3 B;  1QJP A;  3POU A;  4XNL A;  1BXW A;  1GFO A;  2K4T A;  4KR8 A;  4D64 A;  4GHB A;  3HOE A;  3JTY A;  3LK3 A;  3G7G A;  3PGR A;  3LK4 1;  3SYS A;  3T20 A;  1P4T A;  3KZI O;  3PQU A;  3DWN A;  5B66 O;  1OPF A;  4AKR A;  1S5L O;  4FZM A;  4C4V A;  5D5D A;  2Y7S A;  2ODJ A;  4UB6 O;  5DL8 A;  5G38 A;  2JQY A;  1PRN A;  4C4V B;  4AKM A;  2Y2X A;  3PRN A;  3AA6 A;  4O3W A;  4FES A;  2R4N A;  4N75 A;  5DL5 A;  5FVN A;  2YPV A;  5GTH O;  5H2F O;  4RLB A;  3AA1 B;  3DA3 A;  3O0E A;  3VE1 A;  3AA6 B;  3NSG A;  5KAF O;  5T5F A;  1BH3 A;  3VZT X;  4AYM C;  4F4B A;  2X27 X;  3VE2 A;  3LK2 A;  4N59 A;  1E54 A;  4FUV A;  2YNK A;  3WU2 O;  4RL9 A;  5B5E O;  4AYN A;  4IL6 O;  4BUM X;  2ERV A;  3V8U A;  3QRC A;  3JCU O;  1GFP A;  4PJ0 O;  3LK4 2;  4RJX A;  3AAE B;  1ZHX A;  3C5O A;  4QQ1 A;  2R4P A;  5PRN A;  4FZN A;  2ZFG A;  2IWV A;  5KAI O;  5AFU K;  6PRN A;  2JMM A;  3HW9 A;  4AYE C;  2R8A A;  1GFM A;  4CTD A;  4K3C A;  2LFU A;  4FT6 A;  2W81 C;  3UAQ A;  2R4L A;  3AAA A;  7PRN A;  2QTK A;  2WVP A;  2XE3 A;  4C69 X;  4D5U A;  4RJW A;  1IZN B;  1T16 A;  2J1N A;  2PRN A;  3BRY A;  2F1V A;  2K0L A;  3NJT A;  4FRT A;  2F1T A;  5TIS O;  3WI5 A;  3SYB A;  1THQ A;  3K19 A;  2KZ7 A;  1PHO A;  2R4O A;  4E1S A;  4G75 A;  2Y0L A;  4GF4 A;  4AFK A;  4GCQ A;  2R89 A;  3POR A;  4PR7 A;  2R88 A;  3VY9 X;  4O4U A;  3DWO X;  1Q9F A;  1GFN A;  5DL7 A;  2X9K A;  4G76 A;  1GFQ A;  3A0H O;  4AUI A;  1G90 A;  4B61 A;  5G26 A;  4PUX A;  8PRN A;  1ZHT A;  4E1T A;  4RLC A;  3SZD A;  3SY9 A;  5DL6 A;  3T24 A;  1HXU A;  2POR A;  4AKR B;  3DZM A;  4O3X B;  3KVD D;  1MPF A;  1QJ9 A;  2O4V A;  3POQ A;  4LSE A;  3VY8 X;  5GTI O;  2AXT O;  2OMF A;  4GCP A;  2MHL A;  3RBH A;  2XE2 A;  1BT9 A;  1MM4 A;  4KRA A;  4O49 A;  3WI4 A;  2IWW A;  2WJR A;  3POX A;  2XG6 A;  3T0S A;  4JCH A;  4FQE A;  4N74 A;  3SY7 A;  3LK2 B;  2XMX A;  4Z3T A;  1QJ8 A;  4N58 A;  2XTR A;  3VZW X;  3PQS A;  4C00 A;  5IYU A;  2M06 A;  4FOZ A;  3PGS A;  4AYD C;  3PF1 A;  2ZLD A;  3BRZ A;  4UB8 O;  2KXP B;  1MM5 A;  4O3Z A;  3EMN X;  4XNK A;  2KC0 A;  3AA1 A;  4LSH A;  3UU2 A;  2N2M A;  2KXP A;  1YS5 A;  2MNH A;  5EE2 A;  3BS0 A;  4LSF A;  5E79 O;  3HWB A;  1ORM A;  2WJQ A;  1HXT A;  3SZV A;  4GCS A;  1H6S 1;  2W80 C;  4D65 A;  5ADX L;  4FSO A;  3HOL A;  1T1L A;  2XE5 A;  5JDP A;  3AAE A;  4O3Y A;  4JFB A;  2FGQ X;  3UPG A;  3TZG A;  3A2S X;  4KR4 A;  5ADX K;  3AA7 A;  4AYI D;  2XE1 A;  3AA0 B;  5GV0 A;  4K3B A;  2F1C X;  1Q9G A;  2KDY A;  2Y0K A;  3AA7 B;  3FYX A;  4FMS A;  4FRX A;  4U9C A;  3QRA A;  3AA0 A;  2Y0H A;  4FZL A;  3GP6 A;  3AAA B;  2FGR A;  1ZHW A;  2LHF A; 
#chains in the Genus database with same CATH homology
 4C4V B;  4K3C A;  4K3B A;  4N75 A;  4C00 A;  4C4V A;  4N74 A;  3NJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...