4N8MA

Structural polymorphism in the n-terminal oligomerization domain of npm1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
108
structure length
108
Chain Sequence
RPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural polymorphism in the N-terminal oligomerization domain of NPM1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Chaperone
molecule keywords Nucleophosmin
total genus 21
structure length 108
sequence length 108
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03066 Nucleoplasmin Nucleoplasmin/nucleophosmin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.340 Mainly Beta Sandwich Jelly Rolls Nucleoplasmin core domain 4n8mA00
4N8MA 1NLQA 5EHDA 2P1BA 3T30A 1XE0A 2VTXA 1K5JA 4CA9A 1XB9A 2VTXJ
chains in the Genus database with same CATH superfamily
2R073 3RVHA 1HV0A 4P9JA 4RFT0 4MXVA 4OQ9A 1W6NB 1VPHA 4HN1A 1QF3A 3J8F3 2ZZJA 1L7LA 5I0DA 3VD9A 3IZOA 5F8PA 1UCXA 5FUPA 5I0SA 2DDUA 5FWEA 3WF2A 1F15A 1A78A 2WO1A 1LCLA 3WF1A 2NPIA 4AAXA 4BIOA 2MEV1 3MZHA 3B01A 5L73A 4COYA 3RZKA 5T5JA 2QVSB 1COV3 3UKNA 1VRH3 3HWJA 4JC1A 2QQNA 5FZHA 3OG2A 4IGPA 2EVXA 2A3WA 4RHV2 4ES8A 1SG3A 2XJUA 3DYPA 4Y22A 2HWE1 3ACLA 1SQ4A 3HNBM 2GMEA 2W5FA 2WNUB 2W92A 5EFUA 4NAMA 1LOCA 3P1IA 1U5IA 3N7KA 5HCBA 1VBA3 3F2ZA 5E89A 4JHZA 3N9PA 4P00B 1JOPA 1RUF1 1B35B 1IPSA 3SITA 2AR6A 3AMHA 2MHFA 4MZUA 2ZGTA 2RR13 4IV3A 1DGRA 4MSVA 2P6CA 5FXWA 4XBLA 2ZGKA 3AMQA 2J1SA 4BH9A 4LHNA 1UZ0A 4HSJA 1DGRN 3VD3A 3RI9A 2VOWA 4FFHA 1WW6A 2P1BA 3C7FA 3CO2A 3CJIB 3WHUA 5KHKA 2RS52 1BBT1 3OOXA 3AZWA 1PO21 3TAYA 1RUD2 2B9UA 5D1IA 2RS12 3CJIC 4LKFA 5GJ6A 2YBKA 3GZAA 4Q2FA 2VNVA 1BHGA 1PK6A 2WLPA 3VKFC 1V6JA 3DPRB 5GZGA 3N9LA 2OPWA 4LKDA 1RUH3 4QB1A 2OYZA 3WP3A 5CFCC 4N7IA 2PLV1 2R32A 3NL1A 1UPIA 4DEQA 3MI8A 4FXGB 2ZHKA 3UESA 2I74A 3SCFA 5C8WA 3IBMA 1IS3A 2W08A 3AKTA 1JODA 3ZIWA 2BTVC 1OFNA 4JRAA 4BA6A 2UU8A 1CPNA 4N7UA 2GNDA 3S57A 1LNSA 2XR4A 3OBZA 4GJZA 4AHXA 1DYPA 1AXYA 2ZGRA 2JB8A 3MIEA 4L9BA 4Q4W1 5FY0A 1HRV2 5FZOB 1RUI3 1PGSA 1PIV1 5FZFA 3VKNA 4ATFA 4A41A 4D7YA 3H3UA 5DXDA 2O14A 3CF6E 2XONA 4LE4A 1AR91 1UYPA 2VMIA 1GFF2 3ZR5A 1J59A 3EHKA 1YJLA 5FR3A 2E33A 4UFJA 5FO8B 2VR4A 4JDOA 2HWB2 4UW5A 3H8RA 2W1QA 1TG7A 3LSDA 1JN2P 1GWLA 1TEIA 3MW4A 2DTWA 3HN3A 4R9CA 5J36A 1ZX5A 3M2MA 4COWA 4RS5B 4J1XA 4XTMA 1V9U3 1O59A 2ET7A 3OGRA 5DG2A 3UYJA 4QX0A 5I93A 1MS0A 1MQTB 1H4GA 2CU5A 2QUOA 3E5UA 3HNMA 5FUNA 4HVRA 4QPIB 2XQRA 4M3CA 1OC1A 4LBNA 2ZTNA 4NR1A 4RQPB 1KGYA 3U4SA 4FQ4A 1LOFC 4HG6B 5FPVA 4DFSA 1XQNA 5C8CC 1W6OB 2E7AA 3LDBA 2Y6FA 1QOSA 2ZCWA 5JXJA 1DQ6A 1W6MA 2ZGNA 1URXA 2GNBA 1AHSA 3MLLA 3GZUC 4COUA 2HWD1 4IETA 4NIDA 4CUAA 1ALYA 5CFDC 2VNGA 2R072 1D2QA 4LHLA 1H8VA 5LRRA 1E5IA 1W03A 2VNRA 3M3OA 5IFPA 1NQJA 2YY1A 3NV4A 1QKQA 3R6SA 3WW4A 3ZKYA 5BYNA 4Y5TA 2W52A 4LK7A 1MEC1 5FO7B 4AEKA 2UYAA 4QMAA 5A7NA 1OSGA 1U5ZA 1ULDA 2VBDA 1PGW1 5KHHA 5I8TA 4AEDC 2WFF3 4XE9A 5FZEA 3ATGA 1OVPA 5F9TA 1UL9A 1RMU3 1ZZ8A 1JZ4A 3AP5A 4K9SA 4FPFA 2XWBB 3WF0A 3U78A 1O7FA 1SLBA 1YXWA 3ZXJA 4QQ2A 3WF3A 2QTWB 1CAUA 2B5HA 3ZYBA 4AI9A 4F3JA 3POBA 3MIBA 4CDXC 1NLRA 1RIRA 5FRAA 1AR62 1YIPA 1MS4A 2JG8A 4HOOA 1RUH2 4YW3A 2CNAA 4QXHA 1JYIA 2QNKA 1LEDA 3M3EA 1J3QA 2X5IA 4FPKA 5FP4A 2UY9A 1HXS3 1N1VA 3I4IA 2D40A 3POEA 1UIJA 3R4UA 4FPJA 1NAEA 5L7OC 2C4XA 4O9EA 3WQ1A 1OLQA 2QZ3A 4LO5B 5CFDB 2A6VA 1NA1B 2VMDA 1W3XA 5IT6A 4FPHA 1I3HA 1WBFA 4L97A 3WF4A 4QHBA 2D97A 3ZSLA 1UNBA 1UF2C 2HLEA 1OURA 1NCQC 2ORZA 3C3VA 1T6BX 1UY3A 2V5DA 4KWLA 5E6HA 2JWPA 5CKNA 5IAXA 4LIUA 3NRUA 5FZCA 1KS4A 3K46A 5CFCA 4OLLA 1HW5A 1W28A 4Y26A 4XEZA 1O3RA 5J09A 1SEFA 2XJSA 3K51A 2OX0A 1XE8A 3DGTA 1V9U2 4CEWB 1EV13 3RWNA 3V56A 1J1TA 5DG1A 4OYUA 4G9SB 4C1WA 1V6MA 1OD3A 3OB8A 5JPMB 3I2DA 2XJVA 5F5AA 4ZHNA 3T3YA 3HVDA 4DXTA 1QJY1 2W2IA 3DXUA 5KHIA 4HZFA 1DZRA 5IHRA 1VBC3 1PM4A 2XQXA 2XXZA 4XIKA 3VBFC 1Y9MA 2CDOA 2G1MA 3CKHA 5FZIA 2D6NA 4GJYA 2GN7A 4GWNA 1JS9A 2WO7A 2D44A 3K75B 2WABA 1B09A 2XWJB 4NRPA 3HQRA 4AHZA 3SEPA 4A7YA 2XLAA 3WLUA 1BQPA 1TQ5A 2RDRA 1XSQA 2RHPA 1DQ5A 5HV4A 2OS2A 5F1RA 1JOBA 4B1MA 2AACA 4IQPA 3ZYPA 1QQP2 3J7LA 1ENRA 3LEGA 5HI0A 5KC6A 1JOJA 5DAPA 2A3YA 4QQOA 3SHRA 1DLLA 3QLQA 3WUCA 2XKPA 4QHOA 2BWAA 1PMHX 2AEYA 4B1LA 1FX5A 1DU3D 1AL21 1C5IA 3D5OA 4AF9A 4CA9A 5C3OA 1W9WA 1OUSA 2R043 3MF9A 3IIAA 3IAPA 4XCBA 1GP5A 1LOBA 3NVCA 1VBE3 1YFUA 2D93A 4H14A 4XMAA 4AZZA 3M3CA 1GU3A 1QJX3 2WSVA 4I2OA 3S5QA 4AQTA 4GH4C 4E4HA 4NHXA 5C6CA 1VALA 4XXPA 2BQPA 3RI8A 3WINE 1E5HA 3A23A 4JVAA 2RS51 2YGMA 3MW3A 4PF1A 4Q26A 1JU3A 5L9RA 1A8MA 5JWPA 2BZDA 3AKSA 1I1EA 3BODA 1YUDA 4R9BA 5FWJA 1OT5A 4DOUA 3KGLA 1LU2A 3Q8BA 3H0OA 1QH6A 4PI0A 3ZMNA 2WJSA 4Q4X3 1PZ8A 3B7MA 5FZ7A 2W1SA 3I59A 5A6XA 1ST8A 2E51A 4MYEA 1RL3A 1QU0A 3CLPA 4WZCA 5F2WA 1ND3A 2NZ9A 2FDJA 3PJYA 4O9GA 4OMDA 4LEJA 2ZEXA 3O1UA 2JEMA 1JUHA 3OPTA 4L11A 1D0HA 3FBMA 4HPKB 4EN0A 2E7QA 4KNCA 2BDRA 2JE8A 4NHKA 1QEXA 3WG2A 4E2QA 2DU1A 4YSFA 3UT0A 3VBOC 1GQPA 1OA4A 3HNYM 5F3GA 2GH8A 2VU9A 2AC1A 4JZRA 1A34A 5JOYA 3OJBA 1SBFA 1U0AA 4FPYA 5FJKA 3KT1A 3S30A 2MNGA 4LA3A 1K5JA 2FDFA 3ZN5A 1JZ2A 3C7GA 5GALA 3K3OA 1EV12 3ILNA 3N3HA 3OD4A 4XMIA 1W2NA 1R1A2 3W9AA 4AHWA 1QJEA 3VKOA 2E9QA 4ZPIA 5JI7A 4P9WA 4BPZA 1YEWA 3H1MA 3VBUA 4BB3A 1RUE2 2W95A 5ACA3 2ZHLA 1Q8VA 3GM8A 4NIHA 1W90A 1JMUB 1HDKA 2HWF2 3KZ4C 1OD5A 2RS53 4ONUA 1PVC1 5FXZA 1LODA 4MUVA 2FDHA 4Y20A 2JJ6A 3ZSMA 4CP2A 2A6ZA 4LOTA 2IWGB 4XAAA 3RMYA 4CPBA 2R0HA 4M0NA 4QDRA 3SNMA 3WX5A 2HKXA 3P6BA 1TME1 3WR0A 1W2AX 1UWWA 4TYSA 2Y6HA 4M00A 1SCSA 2FD8A 4Y1UA 2AREA 1CAWA 4Q0UA 1CONA 3DKWA 1H6XA 4RQPC 5C8CB 4BXSV 1MS9A 3PUQA 4QPIC 5GZCA 3PU8A 1GOHA 2UWAA 4C91A 1RVF1 2VW2A 3WQBA 3O1RA 4UFHA 5LEKA 2OQ7A 1XYNA 3SLIA 4DY5A 2WA3A 3VD5A 1AR82 4XTPA 2GU9A 1GMMA 1H8TB 2EIDA 2W91A 1NCQA 2KD7A 3WVJA 1ZRDA 2Q1MA 5H9RA 3TEYA 3VV1A 4MOAA 4OHYA 1UOFA 4A7ZA 4HVOA 1MZ5A 2UY8A 3T2QA 1WMFA 5LY2A 3AP7A 4A4AA 4DUXA 5F3EA 2P3YA 1SPPA 4LJHA 3RJ2X 4XDOA 1DQ1A 1Q8QA 2N7GA 1JYNA 4EROA 4Z2AA 2RM22 1ZBA1 5LB6A 2IVIB 2GAUA 4D7TA 1H2MA 4CDUC 3LFMA 4URTA 1ULPA 3RGBA 1W2TA 4LBQB 2YU2A 4B4RA 3D6EA 5BNOA 2F17A 1FMD3 2V72A 2VW0A 2QQUA 3LOIA 3VDDB 2ZZQA 1ND2C 3A4UA 4LKSA 5J96B 4MHUA 5CU1A 3RJRA 1DCSA 4YW6A 5A7WB 3TN93 3BOPA 5M0TA 3WP6A 1Y43B 3G7DA 4A3XA 3AYCA 3ZPOA 1TZOA 4BQ1A 4Y1XA 4OVEA 3RZMA 3W58A 4UW6A 4O65A 2WAAA 3LWCA 4XBQA 5CVRA 5FYSA 1W99A 3J7NA 4NPLA 4R8HA 3GBWA 2FZ1A 2Q1ZB 5E16A 2GC3A 2VZUA 1JBCA 5KHGA 4XFAA 2DYCA 1L3JA 5FZBA 3RS6A 1V70A 2R1DA 3N7MA 3WDXA 3FLTA 2Q8DA 1OF4A 4TLFA 5A33A 3OTFA 3U07A 4IERA 4N43A 2HEYF 4GMP0 1CD3G 4WM7C 4PDWA 1RYYA 5A3NA 2LM3A 3IN9A 1O91A 4RL7A 3UK9A 2B7YA 3I2JA 5CFDA 1Z0HA 3MO4A 3BTYA 3RMXA 1DFQA 1Q5OA 1OQDA 2R061 5KXEA 2JDZA 3RFRA 3OPZA 2HEWF 2IXJA 2Q5TA 4N43C 1QQP1 2VQTA 2Z4FA 4CYDA 3LE0A 2JDKA 1W6QA 2JD9A 3E1F1 3KSCA 1BCXA 4Q27A 4XCAA 5HCAA 5CG8A 4FTSA 1POV1 2R062 4RGAA 2JDUA 1Q8SA 4FSJA 2LS6A 5LBEA 1C8M3 2F4LA 1EPWA 3PIJA 4QGMA 5EYXA 5FYZA 2JDYA 1DQ4A 1XYOA 2YGLA 3ZYHA 3G6JB 2R042 3FHQA 1S0JA 4QU2A 1R081 3AMPA 3I3BA 4CCOA 5C3QA 1W6QB 4QB2A 2NLRA 3KF3A 5F3CA 1BMV1 2XPJA 2UWBA 1QJY2 4QPGA 2QQKA 1G86A 5JVVA 3TN91 3C2UA 1LGBA 2DCKA 2W0XA 2WS92 3QH7A 2VGDA 4CUGA 2ZAAA 3N9QA 5FK8A 5CISA 1NA1C 4D7SA 1XU2A 1V9U1 2YYOA 1EYBA 3D4KA 1XRUA 4K8FA 5HXMA 4HL0A 1QJU3 1RHI1 2PQQA 5CB7A 2BFUS 3USUB 1CJDA 2K46A 4P9YA 4H2AA 2C6SA 5D2AA 1X82A 2GDFA 5FP9A 5JXHA 2P6HA 3ACHA 2RMU2 3HPNA 1ZBA2 1G9FA 1VJ2A 4YVWC 5I0UA 3RPQA 4AVBA 1M4WA 4OI0A 3IMMA 3VUOA 2R0FA 5FYVA 5K7PA 4M0HA 1EUUA 1GWMA 2A71A 2D3RA 4RR3C 3BIEA 5JSRA 5EJZB 4K3UA 1XPWA 5JZGB 2G19A 2W47A 4M3CB 2J1UA 1WCUA 5CYYA 3DCQA 1EUTA 1CVNA 1C8M1 3H9AA 4YM2A 3OBRA 5AFEA 2JECA 2OQ6A 4XHXA 1PK6C 4R9AA 1G8WA 2Z42A 4DEVA 1J84A 2EF6A 3BVCA 3ZYJB 4XACA 1PMJX 1LR5A 5DN2A 4XJWA 3ORJA 4JDNA 4AI8A 1QY4A 4WBBA 4E4SA 1SACA 4RD7A 4E4ZA 1G9AA 5FMBA 3F95A 5JSPA 4H7MA 1LOGA 4AGGA 1WCKA 1YWKA 4K1YA 4CXYA 2JDMA 2HWD3 1OPMA 1X33A 1PZ9A 3S5AA 5A3PA 1MS5A 1OKOA 5FIXA 1UW8A 4LE3A 2XHNA 4R52A 2Q30A 2JDNA 4AFDA 4KI5M 4V2VA 1ULOA 2BW8A 4IV3C 4E4DX 1ZRIA 5EHDA 4HANA 2R1BA 3J4UH 3BPZA 2EXKA 4IV3B 2YXSA 2A1XA 3NAPC 3P3NA 4LHSA 1MEC3 5DUXA 2IXCA 1OF3A 3OEBA 1MZEA 1DG6A 1PO13 4GZ9A 1NY71 1WCDJ 3CBNA 5FZ9A 5GLWA 3B02A 2VUAA 1TMF1 1UYZA 5H9SA 3RYRA 5F5CA 2RJKA 2DTYA 4EWAA 5LRSA 4S2FA 3AMNA 1UZVA 4CCLA 5H9QA 5AVPA 2EIEA 2JDHA 2VL4A 2WNUA 4IE7A 4RR3A 3IB3A 1VRBA 2K9ZA 1LECA 1Q43A 1QXJA 3SXWA 4AI3A 1HIXA 1PK6B 4K8RB 3VHNA 2BVBA 4Q4V2 4XURA 4FFFA 1GZ9A 3H3ZA 1NCQB 2Y33A 3JBG3 4KG0A 1LGCA 2EXIA 2RR12 4SBVA 3T2TA 4BYYA 1MVQA 2EAAA 2ZAHA 2ZKNA 4KWKA 5F3IA 2G4IA 4YM3A 4G3YC 4RFRB 3UKVA 2EXHA 1JZ8A 1DF0A 3PVEA 2CGNA 4IEVA 3WHTA 4LO6B 2P4EA 1EY2A 2AYHA 2BUKA 4XFGA 1FPN1 1WGPA 4I01A 2C9AA 4FXKB 2PQSA 1IKQA 3INAA 4UOJA 2QQOA 2WDBA 3W21A 4XXAA 3KV9A 1ZREA 4N90A 2PAMA 5C3RA 1YQCA 1RUJ1 1AZDA 3FFQA 4CU6A 2HWB1 5BNNA 4YW1A 2B9VA 3CZJA 1FMD2 4TWTA 1LRHA 2C9KA 2ET1A 3CEWA 4RSUA 5A3UA 3LSEA 1ASJ1 3LD8A 3DPRC 4OUMA 3B00A 1HN1A 2J42A 1XNTA 4HT1T 3WQ7A 1HRV1 2LRPA 2WT0A 2B8MA 4YPJA 1LJ7A 1OOPB 2D6OX 2FCTA 4QX8A 1KEXA 2VMGA 2WINB 4J6GA 4HKOA 3NV2A 4X8PA 4HXCA 5AC91 1OLME 1X9TA 2E32A 1NXD1 1S4CA 2RJ2A 4HBNA 4CCKA 1ZZBA 4DZGA 3KHCA 2ARCA 5FLHA 2XUEA 1OUXA 5DAXA 2VUCA 2DVDA 3HBZA 4TN7A 4YVWA 3NKGA 2WZPP 4HK9A 2CTVA 2WWJA 1ULCA 1V00A 1WA4A 5C9AC 1KD7A 1RUG2 4GD4A 4WM7A 3U75A 4QU1A 2DVGA 3D3AA 5FKBA 5HV0A 4RA0A 5GLTA 4BK5A 3J8F2 5J1XA 2W94A 2O0OA 3HT2A 5F6KA 5JZGA 2E6VA 4RN5A 5KBFA 1D4M3 3TNQA 1UPSA 1W8UA 1DIWA 3ZSEA 1QNWA 1V6NA 1PO22 4K21A 3VDDA 1XNKA 1VRH2 1LOAA 1O5UA 4O7XA 1H30A 1HRI1 4YLZA 1RC6A 3TEWA 4Q4Y1 2ZEYA 4LBMA 1J58A 2VBPA 2IZWA 4XETA 5HBAA 2C0ZA 3JU9A 4PI2A 1ASJ2 1JZ3A 3LGRA 4JAAA 4YZ2A 5FY7A 1GZWB 5BNNC 4Y1YA 3HR9A 1YFYA 1RUF2 2PHTA 3LIHA 1ZNPA 4HSLA 3VZMA 1FI2A 2R6QA 1D0GA 4NIIA 5FFOC 3O12A 2WQZC 3ZO0B 4CDQB 1O5LA 2VMEA 1XNBA 1SFNA 4E2GA 5A3OA 3J8F1 1SCRA 4YM1A 1NX9A 4LA2A 4L99A 2ARBA 5I8SA 2OUJA 1NLSA 4CP0A 2HWE2 1Y9QA 3WNLA 1LHOA 1UZZA 2CWSA 3ZM8A 3Q9OA 3ZPYA 4AXOA 1ONAA 2F6BA 1LTEA 4ASLA 3LB9A 2RS32 4YZ4A 5FZ0A 1RJ8A 3ES4A 2J1AA 2AGSA 2K0GA 3KMHA 4QX5A 4QXCA 1H1MA 5IYYA 4XF0A 5L7OA 2MEV2 3KCCA 3U4XA 2B42B 2Y8KA 4Z07A 2HWC3 1RMU2 2CSGA 4QX7A 4A6OA 2HH9A 2IFRA 3KQRA 4QXBA 1OH3A 2DCJA 3PURA 3PTRB 3N7JA 3TOJA 1WLDA 5KXCA 1SLTA 3WD5A 1LENA 2A6WA 3V0BA 1COV1 1H2NA 5FPZA 1HB3A 5A6ZA 5DDJ2 1UD1A 5J98B 2PHDA 1NY72 2GNTA 3RRDA 3UGHA 2GSYA 1NCRC 1K5MC 3GGLA 4ATEA 2A3XA 3L9JT 1WD3A 1A6CA 4QDSA 3POYA 4QKFA 2XGXA 4UI9L 3WV6A 4D3WA 1X7NA 1MR5A 2DV9A 4UFKA 1DYKA 4XZUG 4BMEA 4AG4A 4XUNA 1ULGA 2H0VA 4B7KA 1O3TA 1NA1A 3WNKA 5DZEA 2GMPA 2VZPA 3AJZA 3IPVA 3MIGA 4JKKA 2ZA9A 2IXHA 3HEIA 2YG0A 5BNPB 4CCCA 3PVOA 2LROA 1UKRA 2ZEWA 4BQWA 3MPPG 4CEWA 4JGYA 5JOWA 2RR11 5E8AA 5FXXA 4DUWA 1PGW2 2GP3A 1JI6A 1HQLA 2XBO2 1ZZ6A 5C4WC 1UOJA 3AP4A 1UXZA 3ZMOA 2W87A 4XQDA 1MEC2 2O1QA 3ACGA 5FMOS 4X6RB 2PLV3 1MQTC 1Q3EA 1HN0A 4Q0PA 5A70A 2FCUA 4ZZ8A 2HJIA 2WNUC 1N47A 3DEMA 4BLJA 4MGYE 3KVAA 5BUVA 4P9XA 3W5MA 4GWMA 5LA0A 3SISA 3GJBA 2WLQA 5FMOL 3WDTA 4I0WB 4JCKA 4ZU5A 3I2OA 1KRIA 3I3MA 3IM0A 1OA3A 4GMP1 2W68A 2ZHMA 1IQAA 1ZM1A 3DUIA 3VB9A 1S0DA 4RHV3 4XJAA 4JKLA 3VZOA 2OZ6A 1VAVA 1GV9A 1DGLA 1KDMA 1VMHA 2PMWB 2BGCA 2X10A 2WSUA 2XJPA 3GXUA 4Q8KA 1Y7BA 1O3SA 1ENQA 2DCZA 1GQHA 1RTVA 2YV8A 3Q8AA 2A70A 1AYN1 1ULEA 1UXXX 2JENA 2ZMKA 1AX0A 1AF9A 1Q8OA 3O1VA 4Q0QA 3IIIA 2D7FA 1UY1A 2J1TA 4QPGC 3CDZB 3IPVB 5A7OA 1AL23 4NAOA 4BQ4A 1RJ7A 2IVJA 2ZGMA 3CMGA 4QQLA 2XL7A 4JTOA 5IW0A 2R16A 3TN92 3B3QE 1ZBA3 2NMNA 4AFCA 4AFAA 3HIFA 1PGL1 4G4FA 4LULA 4AVCA 1AYM1 2QDNA 1R082 3PIGA 2CL2A 2VH9A 1GYKA 5T50A 2MPFA 1N3PA 4E9KA 4OHVA 3RYKA 2W46A 2ZGSA 4ASMB 5A3LA 1LHVA 4BQ5A 5JDBA 2RMU3 2XLGA 4ISQA 2PAKA 1N1SA 3VD7A 4QGNA 1ZA7A 2BFUL 2WC2A 1PX4A 5FY5A 2VVFA 4L92A 3OF1A 1OA2A 5CNAA 3ENRA 2ADDA 4FAHA 1BVP1 4K1ZA 2IC1A 3ASIA 3IWZA 5A3WA 4CXXA 5JUVA 5FZ8A 1XJAA 2QJVA 1H0BA 2ZX0A 4FBFA 3NNLA 4XF3A 4ZKTB 4BISA 2D5FA 3HD8B 2FMDA 1W6MB 3MLKA 1HXS2 5FAXA 5T54A 5FZLA 4BU2A 1KFUL 5BNNB 2TEPA 2DUOA 2Q8OA 2YBSA 4CEYC 2JG9A 3PVNA 3QD6A 4N9IA 5FP3A 5JAXA 2IUWA 3H7YA 4FTEA 3ZFGA 3MV01 5J7MA 2QCSB 4W50A 4LO8A 1OQEA 1LESA 5I0RA 4Y1VA 4MLOA 5FPXA 1GKBA 1CZVA 2WZ8A 5ABJC 1MS1A 1RUD1 3JB8A 3VL9A 3H8XA 3I2KA 1BBT2 1K5MA 4XC9A 4LBLA 4NIAA 5GZFA 5L36A 2RS13 3ACIA 3CIHA 4OHWA 3O7OA 4LPLA 5FYHA 3ZN6B 1EPZA 1W05A 3JCIA 4L2NA 2VQ0A 2D3SA 4LLOA 1CN1A 2BNMA 3W59A 1BK1A 4GA9A 4P5HA 5FXVA 3V64A 3D0SA 3J26N 3JXSA 1PO12 3HJRA 4M4RA 3CL1A 4UFMA 3OPWA 3AP9A 5ERLA 5T5LA 1QJU2 4AHYA 4ARXA 2WN3A 4CDQC 1C28A 2OVUA 3KT7A 5K4LA 4WVWA 3VLBB 1CGPA 3AL5A 3KV4A 2QQLA 4ET7A 1AXZA 3LFIA 4GQ7A 1AL0G 1LHNA 1ZYBA 2BEOA 2VY0A 2E53A 3BCWA 1FNZA 5C4WA 1S2KA 1UYXA 3ZXGA 4CZSA 5IVEA 4AI2A 4JGYC 3OGVA 3WY6A 4CU8A 3R0RA 5FMDA 4LXLA 4PIYA 1TNRA 4CP1A 4XFBA 1VE0A 4DRVA 3LPGA 3EJKA 4CVUA 3ROUA 2E26A 1IS4A 1OI6A 5B4XA 2X5IC 2XJRA 4A2UA 3T4HB 4E2SA 5IVBA 2YU1A 4N8MA 1ND2B 4BQYA 5FYUA 4AYUA 2SLIA 1FOD3 4X8NA 4PLMA 1C8NA 1JHNA 1VBB1 3PUIA 2FZ2A 1K45A 3KQ4B 3OY8B 3WDVA 3AYDA 3LEKA 3PUSA 4Y24A 3E6BA 3WDUA 2AEZA 3UKTA 1I6XA 2RDNA 1WD4A 2OT7A 3MICA 3I2FA 4KQ7A 2QKDA 2BJSA 2WN2A 5FV3A 1Z7S3 1ENXA 4IL7A 1RINA 2JIGA 3JZVA 4Q4W3 3LA2A 2ZMLA 1RUI1 4EE2A 3FL7A 2GMMA 5FUIA 3WNPA 2D6MA 2XG3A 2JKXA 1RUC1 2XVLA 4GKYA 5F39A 4PQQA 4NROA 2ZGQA 4IV1B 4AE2A 2EIBA 4EN6B 3B9CA 2OXBA 2I45A 2TNFA 3K4AA 2VD7A 3OYWB 3POGA 3DF0A 3V0AB 1W6OA 1WZXA 2EIGA 2XMLA 1UN1A 4JX0A 2QQWA 4MO3M 4QKNA 1MZFA 4IEOA 1CX1A 4LBQD 5FKCA 1F31A 4CCEA 5JIAA 2XBO1 1JYTA 3LKJA 2PHFA 1UY0A 2VMHA 1BEV1 3M4FA 3IDEA 2WWUA 3VKMA 4ES9A 1LB2A 1LOFA 1MQTA 5FYBA 2C26A 4KGQA 2OIIA 2QQJA 2ZBJA 3AFKA 4KU7A 2WNVB 1MACA 1D4M2 1F5JA 1GOFA 2BOJA 3POIA 4JQRA 4QX3A 5CAZA 5IVCA 4YGDA 4NE9A 3JBG2 4ZONA 1AX1A 1RUC2 2R7EB 4RR3B 2GNMA 1RGSA 2WNVC 5FZMA 4DMIA 1GUIA 1OKQA 2DVAA 4I09A 3V65A 5GLZA 4DRRA 3R4DB 4EQVA 5GZEA 4NN0A 5FP8A 2YZ4A 4LQRA 1W0NA 1VB2A 1DZQA 4R9DA 1ASJ3 2B45X 2Y6JA 5LBBA 4C0BA 3KHBA 4V1PA 2ES3A 2XJTA 3BGAA 4Q4X1 4XUPA 4JTNA 1Y3TA 4AAPA 3IT8A 1RUJ3 5IWFA 3RZLA 4OHZA 2JG8B 4W6XA 2GN3A 3BOWA 4UFIA 1VP6A 3ETQA 4PLNA 1SLCA 3C7OA 2PA7A 3N4MA 2HWF3 4N53A 1POV3 5LBFA 4XFFA 3T2PA 1QGLA 3APBA 5BNPC 3OGSA 1FPN3 4R4ZA 3O1TA 4YYOA 3VBSB 4PDWB 1VBE2 4LBKA 1SLIA 4XABA 4XAEA 3ZR6A 5LATA 2PYTA 4AOCA 3OBAA 4A7KA 2RS31 2DFBA 3KCXA 1GZWA 3ECQA 1F5FA 4UWDA 4EZ4A 3BN6A 4H7LA 1BEV3 2XDVA 4GKXA 4OMCA 1P8JA 3H1YA 3VBOA 3GHMA 3EXUA 3O1OA 3MGUA 1O6UA 1GICA 1W8NA 1TNFA 2VAUA 3VGIA 2CDPA 3LF7A 2VULA 1G9BA 4D94A 3ZLIA 1QJU1 1RHI3 4CE8A 1NT0A 2LW8A 4NRQA 1ZRCA 3BB6A 2RVAA 1IGOA 4I3GA 4YW2A 4GB33 4UYBA 2PHRA 2Y60A 5FP7A 3O1SA 2O8OA 3M8LA 4ISRA 2Y0OA 5LA1A 2LUWA 3VD4A 2I2SA 4TZDA 3TWIA 1TVGA 4WM7B 1S0IA 1XOYA 4LR4A 2AH2A 1WW5A 4Q4Y3 5JSOA 1HRI2 3RYPA 3KS7A 2VECA 4QD2A 3USUA 1TME3 4AEMA 5LA9A 2L9LA 1XBFA 4YVWB 3PMSA 5EWSA 5FZKA 3JUUA 3OCPA 1GBGA 2XL9A 4QX2A 5FTTC 3HBKA 3WNNA 2YB7A 1UKGA 4K7JA 1NE6A 4AGVA 5CA6A 5FO9B 2DVBA 1KJRA 1OLMA 4LK6A 4Y22B 1IOAA 3VBSA 5JR2A 5J37A 1GR3A 2VM9A 4YFWA 1UX7A 4UT5A 1AR71 3H42B 4CXWA 1MPXA 1H9WA 4M01A 5BNQA 1KITA 2WZR1 3OY8A 5BNOC 1H9PA 1RUG1 4N53B 4J1WA 1R091 1N3OA 1KFXL 3AJYA 3ON7A 4FPLA 2LALA 1GP4A 2GZWA 4H55A 2VOKA 4QM8A 4IE5A 2GH2A 3T1MA 3T0DA 2HWC1 1O3QA 3B5LB 5EIYB 2PHUA 1RUNA 3GBFA 2ETEA 4P14A 3ACFA 1JHJA 4EWEA 5FPUA 1US2A 5DUWA 1AX2A 1O4ZA 3JD71 4OHXA 3VZJA 4D6SA 5C9AA 1X8MA 2SBAA 5A3MA 1GANA 2OZJA 3NNGA 3VBRB 3POSA 2X8KA 4UBHA 5DPNA 3SKVA 3AVSA 3KB5A 2NM1A 1Y4WA 4OQ8A 2VC9A 3PJQA 3R05A 2A73B 3HQXA 4IEPA 1XYPA 3ST7A 3TNPB 4HMZA 5DZGA 1YFXA 4NWWA 3A7QA 4DUVA 4E27A 2PAEA 3N36A 1O8SA 4O61A 2Z79A 1C1FA 5FQ0A 1A3KA 2ERFA 5GKAC 5JCTA 3FZ3A 1RUJ2 3LOBA 5HCFA 1PX3A 1QIQA 3AX4A 1DGWX 3THPA 5T3NA 3I2IA 4N43B 4A44A 1GZTA 3HT1A 1R1ZA 3O5SA 2WRAA 1YQ8A 4PF5A 3A0NA 2NYYA 3EB7A 3FWEA 4CP9B 2PHXA 4EYUA 2YC4A 3N9NA 4GWIA 4NVPA 1VAKA 2ZX2A 1M06G 4YW4A 5FZGA 1ND2A 2B39A 5ABJA 3H7JA 3HOBA 3OUJA 1H4HA 2VPVA 5LASA 3B9IA 3ILFA 4NJ4A 2XB6C 4FFIA 4BXFA 1BJQA 4JV4A 3CHXA 4W4ZA 1VAMA 3TBDA 5C33A 5FJHA 2VOTA 4WZFA 1H8TC 1UY4A 3WXPA 2DUQA 4YG0A 4FPOB 1HQNA 4JGZA 1I5PA 3VDCA 1C4RA 1B35A 3NKTA 5JXGA 3Q8FA 1W39A 1DYOA 3TRSB 1X8EA 3A22A 4W6YA 1ND3B 1TMF2 4CCNA 2R071 1SBEA 1I5ZA 1SDDB 1VR3A 2HWB3 2OUHA 5FLJA 2QFEA 1YRZA 2VXRA 1WMEA 3BI3A 5J48A 3ES1A 3THCA 2XVKA 3KGZA 4IEWA 1QMJA 2J1VA 3VDBA 1CAXB 3LA7A 5T55A 3NJXA 2Y6KA 4XDQA 2VOVA 3B94A 4YRDA 3ZYFA 3WW3A 1WMDA 4KBZA 3POFA 3T08A 5GZDA 5IVFA 3WG3A 1UAIA 3BTZA 2V5YA 4GIQA 3Q8EA 4LNVA 5BPXA 5CADA 4ZU7A 3NO8A 5DQ0A 1AYM3 4AW7A 3QACA 1BZWA 1F2NA 1HLCA 1Q56A 1VBA1 4DY3A 5FOBB 3RZGA 5FCCA 4IV1C 3T30A 4RS5C 2ZKLA 4Y5SA 3WUDA 4CUBA 1AR92 5TSWA 5C5TA 1VMFA 5DDJ1 5BY5A 1GWKA 3I2GA 2RJLA 5GLUA 3NMBA 3IDBB 4KL1A 2CAUA 3A0KA 1QOOA 2HWD2 4SLIA 5SV5A 4WVVA 4HKWA 3MPBA 4BJ0A 1AYN3 3EO6A 1HRI3 1W0OA 4QQHA 5DAQA 4MGKE 4EN8B 4UF0A 4B7EA 2RMU1 2WAOA 2RDSA 1BBT3 2ZJCA 5T52A 3HMYA 5LEJA 1S2EA 1PO23 4IXLA 5ANQA 1ZBE2 1H2LA 4PHZA 2HWC2 3C7HA 1XXNA 3B93A 2VUJA 3H50A 4YZ5A 1ZZ7A 5A7PA 4NHLA 1J3PA 1KXGA 3U0ZA 1V6IA 3SC7X 5JOXA 1SFPA 1GNYA 1PVXA 1R092 2JG9B 3WW1A 5K0UC 5A6YA 4YGEA 4JGZB 5JPNB 2YPDA 2WS91 1POQA 2Q4SA 3UNPA 3RDIA 1EP0A 3VZLA 3WZ1A 1PZ7A 2RS11 1GOGA 4QGLA 5D8AC 3GDBA 1W6PB 4K40A 2FQPA 4META 1Q8PA 4B4QA 3M3QA 2QE3A 2QZ2A 5ABJB 4D8MA 5I8YA 2QQMA 1J3RA 2CV6A 2RM23 3VZKA 4XJUA 3SCHA 1CWPA 4XF1A 4Q4W2 2G9FA 4Q4Y2 4DPNA 1CIYA 4AQ6A 3ZDSA 1D2SA 1KJLA 1GP6A 3O0XA 2IFWA 2IXIA 4GH4A 1OBNA 3POWA 1TMF3 2WNOA 2WNEA 4BM8A 1REFA 4L8QA 2JX9A 5FMCA 4TTGA 2NMOA 5FYCA 2PLV2 1FV3A 2VG9A 3DV8A 3K3NA 4S2GA 4XQ4A 1XE0A 2ENRA 1WBLA 1F35A 2CGOA 5EYYA 1GNHA 4IESA 1Z7S2 2WZR2 1BXHA 1EAH3 4OI1A 4TSVA 5A1AA 2ZX4A 4AEJA 1AR72 2X09A 4AL9A 5LK7B 1RB8G 1UU5A 2NP0A 4FP2A 3ME2A 1QJX2 2LTNA 1X9PA 3PUAA 3NAPA 1UQXA 2P37A 2VZTA 2WO2A 4PDWC 2X05A 1JXNA 1D7PM 3FLPA 4QPWA 5AC92 1IKPA 2RG4A 3FX3A 4NRMA 5C5UA 3K2OA 2X53S 4FPGA 3U10A 2Y6LA 4D6RA 4DQAA 2VCAA 1G9CA 1UMIA 2WYSA 2BVVA 5A7SA 1RUOA 4KU8A 2IXKA 4LBJA 3VZNA 3WEZA 2ILMA 3AC0A 3EQEA 4FT8A 3AP6A 2YMZA 4KWJA 5JI9A 1FOD1 2VQUA 5D8AA 5HXVA 2WR9A 1E5SA 4WVMB 2YBPA 5FYYA 2D6PA 4Q4X2 4OUSA 3PTYA 1QQP3 4CU7A 2QQVA 5DZFA 2JG9C 1NUKA 4BQ2A 1SLAA 2FDIA 4MXWB 3ZSJA 4DS0A 1S0GA 1NKGA 3LAGA 4UBGA 1YQ5A 1XSRA 1HJGA 3KM5A 5FY1A 1YLLA 2P2KA 2GALA 3NJYA 4XF9A 3ZYRA 2WFF1 1YC61 3UJOA 4AGRA 5JMOA 3AXDA 4C90A 1PHMA 2TUNA 4RHV1 5LW9A 3V0AA 3OYWA 2BPA2 4BK4A 4LIVA 1ZBE3 5A7QA 1APNA 3PMEA 1FT9A 1POV0 3DECA 3ZYIB 4P5YA 2UYBA 5J3UA 3UGGA 5IFTA 2YUEA 1IS5A 3M70A 1J83A 1BLZA 4BLIA 1YQ6A 1H2KA 2CWMA 2VTXJ 5EZWA 1WLTA 1RVF2 2D98A 4LHKA 4OI2A 2WT1A 5FREA 3AM2A 4Y20B 1SMVA 2YHJA 3KV6A 2C5DA 4GB32 4HK8A 4JDMA 1E57A 2PHLA 1UO9A 2XHKA 4CEWC 2WUHA 3PVBB 5I0TA 3SCGA 5IJRA 5K8SA 3VN4A 4XYXA 5IUQA 2VTXA 4LO7A 3WP5A 5DABA 3UETA 3VBUB 4Q4V3 5EP9A 4JRLA 4IEZA 5EJ3A 2EA7A 4DIQA 1ZVFA 3NSTA 5CZKA 3MF6A 3L2YA 2Y34A 4XUQA 2G9GA 1XB9A 5T5OA 3ITQA 1MZ6A 3AZVA 1IHMA 4OULA 5FZ3A 4C0HA 1H6YA 3ALQA 2VZVA 2QDRA 1PM7A 4UW4A 4AFBA 4MGSA 3DL3A 4OFGA 2PN5A 4FOVA 1AR63 2HWF1 4Y33A 4YW5A 4FQZA 3WCSA 1D4M1 1QJZA 1L7RA 3M7AA 3UJQA 1WUVA 1YIFA 1LU1A 3WCRA 3E5XA 5KHJA 4AEDA 5C4WB 3RZHA 1DGWA 1NCRB 2FMYA 2UWCA 1EV11 5FOJB 4YZ3A 3DN7A 3LEIA 4U2AA 3BIWE 4DB5A 3OGGA 1JZ7A 5FZ6A 4XQWA 4CDWB 1U5XA 1UYYA 4COZA 4MGQA 1WLWA 4C1XA 1W8FA 1WA6X 2BNOA 3FHAA 2VZ1A 4MHRA 2QQIA 2JXAA 3ZFEA 1JYVA 2VO5A 2WFF2 4GALA 1VBD2 1PMIA 1RUD3 1H1AA 2TBVA 5IVJA 4NHYA 3MV11 1G7YA 3HN1A 1K5MB 1G6NA 4Q8LA 2W1WA 4QPYA 2GP5A 1LEMA 2D3PA 4X6QB 1LOEA 2PELA 1OQ1A 1VLNA 1X50A 3I49A 1SHWB 1PO11 3Q8CA 2YDEA 1NYWA 3QCWA 3QH6A 1MS3A 1AJOA 2IXLA 3NWKA 2E31A 4N9HA 1JZ6A 1NE4A 1CJPA 4QQPA 3THTA 1FOD2 2WZEA 1GNZA 5GM0A 5KWRA 2W9XA 5L19A 5G04L 5FPLA 1RHI2 4P02B 2VZOA 2QBXA 1US3A 3ZN4A 4EWDA 3AB0A 4HLTA 4PIXA 3MLJA 3UL2A 1BVVA 3ZXLA 4FO9A 2HEVF 3SH5A 4BCUA 5LBCA 1STMA 4A3ZA 2CY6A 2K2SA 5FZ1A 2V73A 4QAWA 4EJRA 4S2HA 1HB1A 4XZPA 2ATFA 1UIKA 1SBDA 1QJX1 3MIDA 3VHRA 5IK4A 1XNAA 4KWUA 1S0CA 2F4PA 1OHFA 3CU7A 2WIIB 1W06A 5LZ6A 3I3DA 2VZSA 2XUMA 5CFCB 4FOQA 5C3PA 1T6GC 1V0AA 2HBUA 4HFSA 3S0MA 3AKRA 4B29A 4LOSA 1YQ2A 4NHMA 4XJ9A 3RNSA 3U11A 1QNYA 5CEHA 3WG1A 2Q8CA 1B35C 1N1TA 1VBB3 4I02A 4XILA 3VBHB 3JQWA 4YW7A 2FCVA 4OZOA 5FPAA 2ZGUA 3WDYA 4AR2A 1N1YA 1JTZX 2WKKA 3RG0A 3BU0A 2YROA 3SEEA 1O8PA 1PNGA 3RZZA 4YARA 4TLGA 1VBC2 3N7LA 5GLVA 1ZZCA 2WZR3 4CDXA 2A5ZA 4B8EA 2C24A 5A1FA 1C3HA 4COVA 2OA2A 3WNOA 4BDVB 3FMGA 4YM0A 2J1RA 3E5QA 3GZTB 4UFLA 3CZUA 4ZXEA 3NNJA 1CAVA 3FE5A 5DUUA 4J25A 4CSWA 1JYXA 4CP9A 1QOTA 2ZGPA 3MW2A 5D21A 1V6KA 1CAVB 4HETA 4QKDA 3JD73 5FLIA 5FZ4A 2P3IA 5DUVA 4A42A 3PDQA 3ZFFB 4WVZA 2WL1A 1WMXA 5KR7A 5FQ0B 4Q1RA 1HXS1 1Y9GA 3I8TA 3EMRA 4BZ4A 4CDXB 4AK3A 2JKBA 4CUCA 1JW6A 3VKLA 1AXKA 3ILRA 2E7TA 2VVEA 4P08A 1F4HA 1WCQA 3NJVA 4F7ZA 1YCIA 2H6BA 2DBNA 3RQ0A 1OXCA 2BOIA 3VBFB 4CCJA 3IKWA 1W0PA 1VBD1 4CDWC 1HB2A 5F2SA 2RV9A 1AYM2 2BGOA 3T09A 2JDAA 2UURA 3SKJE 5IK7A 3MUY1 4IEUA 4ZZ5A 5JR7B 1WKYA 1ZRRA 4FAGA 3T0AA 2ADEA 3NNMA 1RUH1 3T0BA 3WW2A 3BALA 5ACA2 1JU4A 1NQDA 1DZTA 1W9YA 1NZIA 4XFHA 1RVF3 3RWKX 1S1AA 2VCBA 3ELNA 5HCHA 3KVBA 5EXOA 4Y4RA 3LDKA 4KMQA 4Y5Z0 2CAVA 2VCCA 2V4VA 2P5BA 1HV1A 2AENA 1AYN2 3OBTA 4IE0A 5A33B 3OD0A 3RZJA 4AVTA 1BK0A 2AUYA 1GZCA 4QX1A 3ZX7A 3POJA 1LULA 3ZXAC 4D6QA 3W5NA 4MGIE 4IGQA 3K77A 3T4VA 1ZRFA 1FV2A 1OOPC 1TME2 2Y26A 4XJ8A 1S0EA 3K4ZA 3VHOA 1YI9A 3VBUC 1D4VB 4CRQA 3O1MA 4OI4A 1DBNA 1NCRA 1UU4A 4AQ2A 5L7OB 2VQAA 5DDJ3 2A6XA 4AEDB 1LKNA 5E1RA 4DXRA 2XOMA 3TEXA 2YC0A 4YG3A 4M3CE 2VJXA 1OH4A 4XUTA 2GC0A 3GNEA 5A32B 3OEAA 4CU9A 2ZABA 4CDUA 1R1A3 1AR83 2NN8A 2VCMA 2WFPA 3I2HA 4Q1PA 2WWSA 1YO8A 1QDCA 2Z5WA 4LBQA 5IATA 3PUHA 2VUDA 4GB31 1CZSA 1OLRA 4PQ9A 1RUE3 3USSA 1HJFA 5FY9A 3WNMA 1FXZA 4DINB 3AYAA 4EV0A 1RXFA 2VE1A 2Z2SB 3I97A 5DAVA 2D5HA 1SFYA 4QWNA 5EQUA 3ZFFA 3WOGA 1QDOA 3J9SA 4BE3A 3T2OA 1JZ5A 4IEYA 4IW3A 3AZYA 4BWOA 5AVAA 3KD4A 1PNFA 4FI9A 1CR7A 3AFGA 5G05L 4Z8BA 3CQOA 4C8DA 4IEQA 3JQXA 4GAZA 4W6WA 1H8TA 4Q5OA 1MVEA 3LEMA 3URFA 2P3KA 5FYIA 3SQOA 4EN9B 1J1LA 3L2HA 2YPJA 5JLVA 2Q0AA 1R093 4P9GA 3VBHC 5FBZA 4S2DA 1WLCA 5A1LA 2ZPXA 5FYTA 2ZEZA 1OVSA 4LLFA 1EAH2 4PJYA 4JHTA 3LQCA 5KXDA 1U12A 5A6QA 3THDA 3ZXKA 5BNOB 2BNNA 3H8UA 1COV2 1NZCA 2ZX3A 3H8OA 4UAPA 2KM2A 3VBHA 3CNAA 1CIWA 4RGGA 2VZQA 3VBOB 2FBEA 1W8ZA 1VMJA 2Y6GA 5A80A 3BTAA 1JUIA 1RMU1 5H9PA 1VRH1 3KV5A 2ARAA 3WNXA 4AI0A 4BHPA 1R083 1IZ3A 3GYDA 1RUF3 3O1PA 4NO4A 5CKMA 3N9OA 2J1EA 4KG8A 2VMFA 1WW7A 1KQRA 1PVC3 5D8AB 3AK0A 2KA3A 5DMYA 4A6SA 2RDQA 2ZMNA 3AYEA 3B69A 4NWVA 4QDQA 4Z2WA 1Z7S1 2W39A 5F5IA 3ZFFC 3FJSA 1S0BA 1ODNA 2VNOA 1CESA 4OCTA 1AL22 4V2WA 4M3CF 4ZU4A 2ZXQA 4N53C 2PFWA 1DHKB 1W8OA 4JGZC 4NOTA 1YYNA 2Q8EA 3WG4A 4ZXKA 3GCWA 2ZHNA 4IV1A 2DCYA 2AZ5A 1LAJA 1FYUA 1S0FA 1YI7A 4Y4YA 3ZKUA 4GXLA 5C8CA 3VBFA 3MFAA 1CAWB 4MX3A 4CTEA 5L9BA 5LA2A 5C7GA 2WQ4A 4LBOA 4MXWA 2I07B 3ZDVA 3OSDA 2CYFA 2RE9A 4MVTA 4MG2A 3T1LA 3AZXA 1W9SA 3ZXDA 4WVMA 2WNVA 2R30A 2E63A 4CCDA 1EAH1 2WT2A 2BU9A 4K6BA 3PL0A 1REDA 3I59B 1WWYA 5K0UB 4DXSA 5JXIA 5CBLA 3TYJA 1JYCA 4IE6A 1QXPA 3ZFEB 4XIOA 4L0PA 4B3NA 2WBKA 2EXJA 1C5HA 3IAQA 3KT4A 3I54A 4E8DA 1UZYA 3FN9A 1W8WA 2Y64A 4NPRA 1AR93 4P9LA 4YVSC 5C3SA 2NQYA 4MV2A 3DKQA 3U1XA 4WM8A 1UY2A 4JQTA 3S7IA 4XDPA 4LO4B 5SV8A 3NQHA 3TB0A 1YFWA 1IG0A 5FZAA 3AZZA 1O4TA 1ZBE1 3W20A 5F5QA 3LPFA 4YVSA 2PHWA 2JDPA 5DAWA 5EV7A 3MHZA 3J7MA 3PHMA 1PIV3 4XPVA 3AKQA 3K48A 3VDAA 1QXRA 4Z82A 3MDPA 2PTMA 2VZ3A 4Q29A 2WQ8A 2Y0IA 4YGCA 3PNAA 4JKMA 5CG9A 4Y1ZA 4MH0E 4IEXA 4F8AA 1K42A 5IK8A 3IMNA 1FATA 1MS8A 5F37A 2BV4A 5IK5A 1W04A 1W9FA 1FMD1 5EJ1B 4NPMA 2VTFA 5EPAA 3ZN6A 4ORFA 1VBA2 3J7HA 2D43A 5HPOA 1FAYA 3ZVXA 4LT5A 1W6PA 1OOPA 2HBTA 1AR61 5FY8A 5FY4A 3UGFA 1GSLA 1FPN2 1G9DA 4YNIA 4Z1VA 3JBG1 1V6OA 4DXZA 3ZFGC 3P5BA 3ZIXA 1RITA 4LORA 3LA3A 5JZGC 4KH9A 1XNDA 4XF4A 2VZRA 1AJKA 4CEYA 3ZFGB 3D82A 1CZTA 2YFZA 3QOPA 4PBPA 4IE4A 4QB6A 2ZX1A 1ZA4A 4FFGA 4I0AA 1BEV2 1CQ9A 4Q4V1 3N9MA 2VOXA 4FP3A 4Q0VA 3FHIB 4QXKA 1IPJA 4NMIA 3MBWA 4IUGA 3VHPA 2XH6A 3LIGA 1ULFA 4AVAA 1YJKA 3I3QA 3AVRA 3DYOA 3KCYA 3EYPA 5T5PA 1VIWB 3DXTA 4FOWA 3BUCA 3LZZA 4LUKA 3FUOA 2QQPA 1QJFA 1JH5A 4XW3A 1AR73 1CAXA 2GC2A 2A7AA 4OZXA 4DNYA 1REEA 1HRV3 2P17A 3X29B 1TE1B 5C71A 4MADA 5CKQA 1C57A 2WA4A 3VBSC 1XU1A 5AC93 5F32A 1RUC3 1U5YA 2KXLA 4FPCA 5I91A 1OMIA 3VBRC 2ARXA 2DU0A 4YG6A 4Z92B 2DURA 5FK7A 3FLRA 2BWCA 5FDBA 4XHBA 2VMCA 4YWAA 3GZEA 1VBB2 2VBBA 4R4XA 2Z69A 1UMZA 4QT6A 4E8CA 4IGOA 3KLSA 4XBNA 3OGJA 4PT6A 3M3IA 1S55A 1UU6A 5F7UA 1A8DA 2XBO3 1RXGA 5K9YA 4A45A 2JE7A 3MYXA 4HKLA 3WDWA 1AUYA 1UOBA 1UZWA 3MIHA 1BKZA 2XJQA 3E6DA 1IS6A 4HN0A 4LITA 1S2BA 5IVYA 4AWDA 2XVGA 5C70A 1LHWA 3FBYA 1C8M2 1YNAA 3LDRA 1WW4A 1CX4A 2W3JA 4DO0A 1DP0A 1H1IA 4PIZA 2PXJA 2FHRA 5ACA1 5JMCA 4W8JA 2JD4A 5B4NA 4XJZA 3AKPA 4W65A 1PIV2 4GH4B 4BMBA 1HQWA 1Z78A 2ZS6B 3MEPA 5ANNA 3MFCA 2H6CA 2DVFA 3AL6A 2BBVA 3D0JA 1QJY3 3NJZA 3E6CC 2BGPA 3JD72 3S6PA 2DUPA 3SMHA 2HYKA 3QBQA 3CJXA 1X36A 3P3PA 3ZFEC 2V09A 2J22A 4GWJA 4U36A 1F8VA 4I0BA 2DCTA 2EAKA 2VVDA 4RYDA 1SDWA 5E88A 3VBRA 4AFMA 1N3QA 3ZOIA 4I30A 3V0BB 4QHZA 1DLCA 2OKXA 4KGGA 2O8QA 4MGZE 4UXAA 3IDAA 2WO3A 5A3TA 3TEZA 2KR2A 3K4DA 3NNFA 4HONA 1DDLA 1XNCA 2CHHA 2XLFA 3KWVA 4PCRA 3SH3A 5C9AB 1LHUA 2HYXA 4WM8B 2DF7A 2EICA 1ACCA 1CAUB 3MUZ1 4WV8A 3ETPA 4RQPA 4XVHA 2RS33 3GF6A 3KF5A 1W3VA 3ZXEA 1VB4A 4ARYA 1BMV2 3D8CA 5LCWL 4AI1A 3WSOA 1SLLA 2A75A 1DQ2A 2VXJA 2GC1A 2R041 3BKZA 1VBC1 3OUHA 4ZS2A 5K0UA 2ZGOA 3VL8A 4BIFA 4HVQA 5ISLA 3N35A 1HKDA 1YHFA 4ZS3A 5FBJA 3ZXFA 4FVVA 1LGNA 4YZ1A 1GQGA 4F83A 2B46X 3VDDC 1ENSA 4UF0B 4ASKA 5LY1A 5F6LB 4QPGB 1L7QA 3H1WA 2D6LX 3EBRA 4M4PA 2EALA 1UOGA 2X5IB 4AVSA 4CDUB 2JE9A 1SZBA 1AVBA 4CPBD 2CGPA 4TXWA 4D0QA 2P34A 5A32A 4MGTA 2Q1FA 1IG3A 3FC0A 1NOVA 1ZZ9A 3O0WA 4H3WA 1W2UA 2W1UA 4INDA 2B4KA 3NAPB 2BP6A 4JGYB 1UMHA 5B2GB 5FZOA 5BNPA 3DYMA 3SH4A 3UV9A 4WM8C 2FDGA 4LUMA 1VBD3 1XC6A 1W9TA 2C1FA 2G9ZA 3FFZA 4QKBA 1PGL2 4FCAA 4CCMA 2VW1A 2J7MA 4KBBA 4EZHA 4PLOA 3FUQA 3WP4A 3WQ0A 1VBE1 1OPOA 5BXXA 1IPKA 3I3EA 4QPIA 5JIUA 5JOZA 2OPKA 1DQ0A 2JG8C 4P9IA 1RUG3 4CDWA 5IVVA 4BQXA 1F4AA 2D6KA 5FPBA 2R063 2X29A 3HAGA 3NV1A 1FNYA 3OUIA 4XUOA 4YGBA 4BOWA 4NIGA 3DPRA 5CIRA 4B4PA 4XFCA 4RGKA 2ZOEB 5IAVA 1BYHA 1ND3C 3ZYGA 4UW3A 2R49A 4AVVA 3GJAA 1NG0A 1W2OA 2A6YA 3MIFA 4LMFA 1NLQA 4YFZA 3BPSA 1F9KA 5APAA 1KS5A 1T2XA 4FPEA 4ITCA 5FZDA 4AQSA 3H3LA 1JYWA 1IQDC 1KDKA 4LTAA 4QM9A 3AXEA 5AFBA 5L9VA 3C7EA 1HB4A 2YC2A 3IDCB 4BQ3A 3M1HA 2RM21 2ZGLA 4GMP3 3NW4A 5A7WA 1PVC2 1C1LA 1XE7A 2V4AA 1NXMA 2WS93 2WYFA 2Y38A 3JB4C 2MEV3 5LK5A 2JIJA 4CEYB 2H0BA 3GALA 1RUE1 3S7EA 3AMMA 4URAA 5KXBA 1QWRA 3BYWA 4ZY9A 1ODMA 3U37A 2BBAA 3GHNA 2DWRA 2P3JA 4HPKA 3BTXA 1R1A1 1AR81 1E5RA 1W8TA 1QH7A 2OW4A 4NUBA 2YFUA 1W8HA 1HX6A 2BRTA 3ABZA 2HWE3 4RS5A 3GCXA 5LWBA 1UX6A 1I9RA 1SPPB 4CDQA 3E97A 2DBIA 4XFIA 4K20A 3RSJA 3BU7A 2BERA 2DFCA 3C8XA 2FDKA 2XKOA 3LCPA 3PU3A 4PBOA 1K3IA 1R64A 1WCSA 2BYVE 2JB4A 3NV3A 4GULA 3PLQA 4IDZA 4D69A 5KC5A 4I3PA 2ZACA 3GBGA 1K12A 3ZSKA 2JICA 3WT3A 4Y3OA 4EN7B 3R4SA 5BV6A 3A21A 3I7DA 3U14A 1RUI2 4FTBA 1OFSA 3O14A 5FYMA 3CJIA 3O0VA 2ID4A 4Q0SA 4LKEA 4XOGA 1QHDA 1CPMA 1V6LA 4OUEA 4YVSB 1O4YA 2ORXA 4FOYA 3HQUA 1GLHA 1W6NA
chains in the Genus database with same CATH topology
4N8MA 1NLQA 5EHDA 2P1BA 3T30A 1XE0A 2VTXA 1K5JA 4CA9A 1XB9A 2VTXJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N8M A;  1NLQ A;  5EHD A;  2P1B A;  3T30 A;  1XE0 A;  2VTX A;  1K5J A;  4CA9 A;  1XB9 A;  2VTX J; 
#chains in the Genus database with same CATH topology
 2R07 3;  3RVH A;  1HV0 A;  4P9J A;  4RFT 0;  4MXV A;  4OQ9 A;  1W6N B;  1VPH A;  4HN1 A;  1QF3 A;  3J8F 3;  2ZZJ A;  1L7L A;  5I0D A;  3VD9 A;  3IZO A;  5F8P A;  1UCX A;  5FUP A;  5I0S A;  2DDU A;  5FWE A;  3WF2 A;  1F15 A;  1A78 A;  2WO1 A;  1LCL A;  3WF1 A;  2NPI A;  4AAX A;  4BIO A;  2MEV 1;  3MZH A;  3B01 A;  5L73 A;  4COY A;  3RZK A;  5T5J A;  2QVS B;  1COV 3;  3UKN A;  1VRH 3;  3HWJ A;  4JC1 A;  2QQN A;  5FZH A;  3OG2 A;  4IGP A;  2EVX A;  2A3W A;  4RHV 2;  4ES8 A;  1SG3 A;  2XJU A;  3DYP A;  4Y22 A;  2HWE 1;  3ACL A;  1SQ4 A;  3HNB M;  2GME A;  2W5F A;  2WNU B;  2W92 A;  5EFU A;  4NAM A;  1LOC A;  3P1I A;  1U5I A;  3N7K A;  5HCB A;  1VBA 3;  3F2Z A;  5E89 A;  4JHZ A;  3N9P A;  4P00 B;  1JOP A;  1RUF 1;  1B35 B;  1IPS A;  3SIT A;  2AR6 A;  3AMH A;  2MHF A;  4MZU A;  2ZGT A;  2RR1 3;  4IV3 A;  1DGR A;  4MSV A;  2P6C A;  5FXW A;  4XBL A;  2ZGK A;  3AMQ A;  2J1S A;  4BH9 A;  4LHN A;  1UZ0 A;  4HSJ A;  1DGR N;  3VD3 A;  3RI9 A;  2VOW A;  4FFH A;  1WW6 A;  2P1B A;  3C7F A;  3CO2 A;  3CJI B;  3WHU A;  5KHK A;  2RS5 2;  1BBT 1;  3OOX A;  3AZW A;  1PO2 1;  3TAY A;  1RUD 2;  2B9U A;  5D1I A;  2RS1 2;  3CJI C;  4LKF A;  5GJ6 A;  2YBK A;  3GZA A;  4Q2F A;  2VNV A;  1BHG A;  1PK6 A;  2WLP A;  3VKF C;  1V6J A;  3DPR B;  5GZG A;  3N9L A;  2OPW A;  4LKD A;  1RUH 3;  4QB1 A;  2OYZ A;  3WP3 A;  5CFC C;  4N7I A;  2PLV 1;  2R32 A;  3NL1 A;  1UPI A;  4DEQ A;  3MI8 A;  4FXG B;  2ZHK A;  3UES A;  2I74 A;  3SCF A;  5C8W A;  3IBM A;  1IS3 A;  2W08 A;  3AKT A;  1JOD A;  3ZIW A;  2BTV C;  1OFN A;  4JRA A;  4BA6 A;  2UU8 A;  1CPN A;  4N7U A;  2GND A;  3S57 A;  1LNS A;  2XR4 A;  3OBZ A;  4GJZ A;  4AHX A;  1DYP A;  1AXY A;  2ZGR A;  2JB8 A;  3MIE A;  4L9B A;  4Q4W 1;  5FY0 A;  1HRV 2;  5FZO B;  1RUI 3;  1PGS A;  1PIV 1;  5FZF A;  3VKN A;  4ATF A;  4A41 A;  4D7Y A;  3H3U A;  5DXD A;  2O14 A;  3CF6 E;  2XON A;  4LE4 A;  1AR9 1;  1UYP A;  2VMI A;  1GFF 2;  3ZR5 A;  1J59 A;  3EHK A;  1YJL A;  5FR3 A;  2E33 A;  4UFJ A;  5FO8 B;  2VR4 A;  4JDO A;  2HWB 2;  4UW5 A;  3H8R A;  2W1Q A;  1TG7 A;  3LSD A;  1JN2 P;  1GWL A;  1TEI A;  3MW4 A;  2DTW A;  3HN3 A;  4R9C A;  5J36 A;  1ZX5 A;  3M2M A;  4COW A;  4RS5 B;  4J1X A;  4XTM A;  1V9U 3;  1O59 A;  2ET7 A;  3OGR A;  5DG2 A;  3UYJ A;  4QX0 A;  5I93 A;  1MS0 A;  1MQT B;  1H4G A;  2CU5 A;  2QUO A;  3E5U A;  3HNM A;  5FUN A;  4HVR A;  4QPI B;  2XQR A;  4M3C A;  1OC1 A;  4LBN A;  2ZTN A;  4NR1 A;  4RQP B;  1KGY A;  3U4S A;  4FQ4 A;  1LOF C;  4HG6 B;  5FPV A;  4DFS A;  1XQN A;  5C8C C;  1W6O B;  2E7A A;  3LDB A;  2Y6F A;  1QOS A;  2ZCW A;  5JXJ A;  1DQ6 A;  1W6M A;  2ZGN A;  1URX A;  2GNB A;  1AHS A;  3MLL A;  3GZU C;  4COU A;  2HWD 1;  4IET A;  4NID A;  4CUA A;  1ALY A;  5CFD C;  2VNG A;  2R07 2;  1D2Q A;  4LHL A;  1H8V A;  5LRR A;  1E5I A;  1W03 A;  2VNR A;  3M3O A;  5IFP A;  1NQJ A;  2YY1 A;  3NV4 A;  1QKQ A;  3R6S A;  3WW4 A;  3ZKY A;  5BYN A;  4Y5T A;  2W52 A;  4LK7 A;  1MEC 1;  5FO7 B;  4AEK A;  2UYA A;  4QMA A;  5A7N A;  1OSG A;  1U5Z A;  1ULD A;  2VBD A;  1PGW 1;  5KHH A;  5I8T A;  4AED C;  2WFF 3;  4XE9 A;  5FZE A;  3ATG A;  1OVP A;  5F9T A;  1UL9 A;  1RMU 3;  1ZZ8 A;  1JZ4 A;  3AP5 A;  4K9S A;  4FPF A;  2XWB B;  3WF0 A;  3U78 A;  1O7F A;  1SLB A;  1YXW A;  3ZXJ A;  4QQ2 A;  3WF3 A;  2QTW B;  1CAU A;  2B5H A;  3ZYB A;  4AI9 A;  4F3J A;  3POB A;  3MIB A;  4CDX C;  1NLR A;  1RIR A;  5FRA A;  1AR6 2;  1YIP A;  1MS4 A;  2JG8 A;  4HOO A;  1RUH 2;  4YW3 A;  2CNA A;  4QXH A;  1JYI A;  2QNK A;  1LED A;  3M3E A;  1J3Q A;  2X5I A;  4FPK A;  5FP4 A;  2UY9 A;  1HXS 3;  1N1V A;  3I4I A;  2D40 A;  3POE A;  1UIJ A;  3R4U A;  4FPJ A;  1NAE A;  5L7O C;  2C4X A;  4O9E A;  3WQ1 A;  1OLQ A;  2QZ3 A;  4LO5 B;  5CFD B;  2A6V A;  1NA1 B;  2VMD A;  1W3X A;  5IT6 A;  4FPH A;  1I3H A;  1WBF A;  4L97 A;  3WF4 A;  4QHB A;  2D97 A;  3ZSL A;  1UNB A;  1UF2 C;  2HLE A;  1OUR A;  1NCQ C;  2ORZ A;  3C3V A;  1T6B X;  1UY3 A;  2V5D A;  4KWL A;  5E6H A;  2JWP A;  5CKN A;  5IAX A;  4LIU A;  3NRU A;  5FZC A;  1KS4 A;  3K46 A;  5CFC A;  4OLL A;  1HW5 A;  1W28 A;  4Y26 A;  4XEZ A;  1O3R A;  5J09 A;  1SEF A;  2XJS A;  3K51 A;  2OX0 A;  1XE8 A;  3DGT A;  1V9U 2;  4CEW B;  1EV1 3;  3RWN A;  3V56 A;  1J1T A;  5DG1 A;  4OYU A;  4G9S B;  4C1W A;  1V6M A;  1OD3 A;  3OB8 A;  5JPM B;  3I2D A;  2XJV A;  5F5A A;  4ZHN A;  3T3Y A;  3HVD A;  4DXT A;  1QJY 1;  2W2I A;  3DXU A;  5KHI A;  4HZF A;  1DZR A;  5IHR A;  1VBC 3;  1PM4 A;  2XQX A;  2XXZ A;  4XIK A;  3VBF C;  1Y9M A;  2CDO A;  2G1M A;  3CKH A;  5FZI A;  2D6N A;  4GJY A;  2GN7 A;  4GWN A;  1JS9 A;  2WO7 A;  2D44 A;  3K75 B;  2WAB A;  1B09 A;  2XWJ B;  4NRP A;  3HQR A;  4AHZ A;  3SEP A;  4A7Y A;  2XLA A;  3WLU A;  1BQP A;  1TQ5 A;  2RDR A;  1XSQ A;  2RHP A;  1DQ5 A;  5HV4 A;  2OS2 A;  5F1R A;  1JOB A;  4B1M A;  2AAC A;  4IQP A;  3ZYP A;  1QQP 2;  3J7L A;  1ENR A;  3LEG A;  5HI0 A;  5KC6 A;  1JOJ A;  5DAP A;  2A3Y A;  4QQO A;  3SHR A;  1DLL A;  3QLQ A;  3WUC A;  2XKP A;  4QHO A;  2BWA A;  1PMH X;  2AEY A;  4B1L A;  1FX5 A;  1DU3 D;  1AL2 1;  1C5I A;  3D5O A;  4AF9 A;  4CA9 A;  5C3O A;  1W9W A;  1OUS A;  2R04 3;  3MF9 A;  3IIA A;  3IAP A;  4XCB A;  1GP5 A;  1LOB A;  3NVC A;  1VBE 3;  1YFU A;  2D93 A;  4H14 A;  4XMA A;  4AZZ A;  3M3C A;  1GU3 A;  1QJX 3;  2WSV A;  4I2O A;  3S5Q A;  4AQT A;  4GH4 C;  4E4H A;  4NHX A;  5C6C A;  1VAL A;  4XXP A;  2BQP A;  3RI8 A;  3WIN E;  1E5H A;  3A23 A;  4JVA A;  2RS5 1;  2YGM A;  3MW3 A;  4PF1 A;  4Q26 A;  1JU3 A;  5L9R A;  1A8M A;  5JWP A;  2BZD A;  3AKS A;  1I1E A;  3BOD A;  1YUD A;  4R9B A;  5FWJ A;  1OT5 A;  4DOU A;  3KGL A;  1LU2 A;  3Q8B A;  3H0O A;  1QH6 A;  4PI0 A;  3ZMN A;  2WJS A;  4Q4X 3;  1PZ8 A;  3B7M A;  5FZ7 A;  2W1S A;  3I59 A;  5A6X A;  1ST8 A;  2E51 A;  4MYE A;  1RL3 A;  1QU0 A;  3CLP A;  4WZC A;  5F2W A;  1ND3 A;  2NZ9 A;  2FDJ A;  3PJY A;  4O9G A;  4OMD A;  4LEJ A;  2ZEX A;  3O1U A;  2JEM A;  1JUH A;  3OPT A;  4L11 A;  1D0H A;  3FBM A;  4HPK B;  4EN0 A;  2E7Q A;  4KNC A;  2BDR A;  2JE8 A;  4NHK A;  1QEX A;  3WG2 A;  4E2Q A;  2DU1 A;  4YSF A;  3UT0 A;  3VBO C;  1GQP A;  1OA4 A;  3HNY M;  5F3G A;  2GH8 A;  2VU9 A;  2AC1 A;  4JZR A;  1A34 A;  5JOY A;  3OJB A;  1SBF A;  1U0A A;  4FPY A;  5FJK A;  3KT1 A;  3S30 A;  2MNG A;  4LA3 A;  1K5J A;  2FDF A;  3ZN5 A;  1JZ2 A;  3C7G A;  5GAL A;  3K3O A;  1EV1 2;  3ILN A;  3N3H A;  3OD4 A;  4XMI A;  1W2N A;  1R1A 2;  3W9A A;  4AHW A;  1QJE A;  3VKO A;  2E9Q A;  4ZPI A;  5JI7 A;  4P9W A;  4BPZ A;  1YEW A;  3H1M A;  3VBU A;  4BB3 A;  1RUE 2;  2W95 A;  5ACA 3;  2ZHL A;  1Q8V A;  3GM8 A;  4NIH A;  1W90 A;  1JMU B;  1HDK A;  2HWF 2;  3KZ4 C;  1OD5 A;  2RS5 3;  4ONU A;  1PVC 1;  5FXZ A;  1LOD A;  4MUV A;  2FDH A;  4Y20 A;  2JJ6 A;  3ZSM A;  4CP2 A;  2A6Z A;  4LOT A;  2IWG B;  4XAA A;  3RMY A;  4CPB A;  2R0H A;  4M0N A;  4QDR A;  3SNM A;  3WX5 A;  2HKX A;  3P6B A;  1TME 1;  3WR0 A;  1W2A X;  1UWW A;  4TYS A;  2Y6H A;  4M00 A;  1SCS A;  2FD8 A;  4Y1U A;  2ARE A;  1CAW A;  4Q0U A;  1CON A;  3DKW A;  1H6X A;  4RQP C;  5C8C B;  4BXS V;  1MS9 A;  3PUQ A;  4QPI C;  5GZC A;  3PU8 A;  1GOH A;  2UWA A;  4C91 A;  1RVF 1;  2VW2 A;  3WQB A;  3O1R A;  4UFH A;  5LEK A;  2OQ7 A;  1XYN A;  3SLI A;  4DY5 A;  2WA3 A;  3VD5 A;  1AR8 2;  4XTP A;  2GU9 A;  1GMM A;  1H8T B;  2EID A;  2W91 A;  1NCQ A;  2KD7 A;  3WVJ A;  1ZRD A;  2Q1M A;  5H9R A;  3TEY A;  3VV1 A;  4MOA A;  4OHY A;  1UOF A;  4A7Z A;  4HVO A;  1MZ5 A;  2UY8 A;  3T2Q A;  1WMF A;  5LY2 A;  3AP7 A;  4A4A A;  4DUX A;  5F3E A;  2P3Y A;  1SPP A;  4LJH A;  3RJ2 X;  4XDO A;  1DQ1 A;  1Q8Q A;  2N7G A;  1JYN A;  4ERO A;  4Z2A A;  2RM2 2;  1ZBA 1;  5LB6 A;  2IVI B;  2GAU A;  4D7T A;  1H2M A;  4CDU C;  3LFM A;  4URT A;  1ULP A;  3RGB A;  1W2T A;  4LBQ B;  2YU2 A;  4B4R A;  3D6E A;  5BNO A;  2F17 A;  1FMD 3;  2V72 A;  2VW0 A;  2QQU A;  3LOI A;  3VDD B;  2ZZQ A;  1ND2 C;  3A4U A;  4LKS A;  5J96 B;  4MHU A;  5CU1 A;  3RJR A;  1DCS A;  4YW6 A;  5A7W B;  3TN9 3;  3BOP A;  5M0T A;  3WP6 A;  1Y43 B;  3G7D A;  4A3X A;  3AYC A;  3ZPO A;  1TZO A;  4BQ1 A;  4Y1X A;  4OVE A;  3RZM A;  3W58 A;  4UW6 A;  4O65 A;  2WAA A;  3LWC A;  4XBQ A;  5CVR A;  5FYS A;  1W99 A;  3J7N A;  4NPL A;  4R8H A;  3GBW A;  2FZ1 A;  2Q1Z B;  5E16 A;  2GC3 A;  2VZU A;  1JBC A;  5KHG A;  4XFA A;  2DYC A;  1L3J A;  5FZB A;  3RS6 A;  1V70 A;  2R1D A;  3N7M A;  3WDX A;  3FLT A;  2Q8D A;  1OF4 A;  4TLF A;  5A33 A;  3OTF A;  3U07 A;  4IER A;  4N43 A;  2HEY F;  4GMP 0;  1CD3 G;  4WM7 C;  4PDW A;  1RYY A;  5A3N A;  2LM3 A;  3IN9 A;  1O91 A;  4RL7 A;  3UK9 A;  2B7Y A;  3I2J A;  5CFD A;  1Z0H A;  3MO4 A;  3BTY A;  3RMX A;  1DFQ A;  1Q5O A;  1OQD A;  2R06 1;  5KXE A;  2JDZ A;  3RFR A;  3OPZ A;  2HEW F;  2IXJ A;  2Q5T A;  4N43 C;  1QQP 1;  2VQT A;  2Z4F A;  4CYD A;  3LE0 A;  2JDK A;  1W6Q A;  2JD9 A;  3E1F 1;  3KSC A;  1BCX A;  4Q27 A;  4XCA A;  5HCA A;  5CG8 A;  4FTS A;  1POV 1;  2R06 2;  4RGA A;  2JDU A;  1Q8S A;  4FSJ A;  2LS6 A;  5LBE A;  1C8M 3;  2F4L A;  1EPW A;  3PIJ A;  4QGM A;  5EYX A;  5FYZ A;  2JDY A;  1DQ4 A;  1XYO A;  2YGL A;  3ZYH A;  3G6J B;  2R04 2;  3FHQ A;  1S0J A;  4QU2 A;  1R08 1;  3AMP A;  3I3B A;  4CCO A;  5C3Q A;  1W6Q B;  4QB2 A;  2NLR A;  3KF3 A;  5F3C A;  1BMV 1;  2XPJ A;  2UWB A;  1QJY 2;  4QPG A;  2QQK A;  1G86 A;  5JVV A;  3TN9 1;  3C2U A;  1LGB A;  2DCK A;  2W0X A;  2WS9 2;  3QH7 A;  2VGD A;  4CUG A;  2ZAA A;  3N9Q A;  5FK8 A;  5CIS A;  1NA1 C;  4D7S A;  1XU2 A;  1V9U 1;  2YYO A;  1EYB A;  3D4K A;  1XRU A;  4K8F A;  5HXM A;  4HL0 A;  1QJU 3;  1RHI 1;  2PQQ A;  5CB7 A;  2BFU S;  3USU B;  1CJD A;  2K46 A;  4P9Y A;  4H2A A;  2C6S A;  5D2A A;  1X82 A;  2GDF A;  5FP9 A;  5JXH A;  2P6H A;  3ACH A;  2RMU 2;  3HPN A;  1ZBA 2;  1G9F A;  1VJ2 A;  4YVW C;  5I0U A;  3RPQ A;  4AVB A;  1M4W A;  4OI0 A;  3IMM A;  3VUO A;  2R0F A;  5FYV A;  5K7P A;  4M0H A;  1EUU A;  1GWM A;  2A71 A;  2D3R A;  4RR3 C;  3BIE A;  5JSR A;  5EJZ B;  4K3U A;  1XPW A;  5JZG B;  2G19 A;  2W47 A;  4M3C B;  2J1U A;  1WCU A;  5CYY A;  3DCQ A;  1EUT A;  1CVN A;  1C8M 1;  3H9A A;  4YM2 A;  3OBR A;  5AFE A;  2JEC A;  2OQ6 A;  4XHX A;  1PK6 C;  4R9A A;  1G8W A;  2Z42 A;  4DEV A;  1J84 A;  2EF6 A;  3BVC A;  3ZYJ B;  4XAC A;  1PMJ X;  1LR5 A;  5DN2 A;  4XJW A;  3ORJ A;  4JDN A;  4AI8 A;  1QY4 A;  4WBB A;  4E4S A;  1SAC A;  4RD7 A;  4E4Z A;  1G9A A;  5FMB A;  3F95 A;  5JSP A;  4H7M A;  1LOG A;  4AGG A;  1WCK A;  1YWK A;  4K1Y A;  4CXY A;  2JDM A;  2HWD 3;  1OPM A;  1X33 A;  1PZ9 A;  3S5A A;  5A3P A;  1MS5 A;  1OKO A;  5FIX A;  1UW8 A;  4LE3 A;  2XHN A;  4R52 A;  2Q30 A;  2JDN A;  4AFD A;  4KI5 M;  4V2V A;  1ULO A;  2BW8 A;  4IV3 C;  4E4D X;  1ZRI A;  5EHD A;  4HAN A;  2R1B A;  3J4U H;  3BPZ A;  2EXK A;  4IV3 B;  2YXS A;  2A1X A;  3NAP C;  3P3N A;  4LHS A;  1MEC 3;  5DUX A;  2IXC A;  1OF3 A;  3OEB A;  1MZE A;  1DG6 A;  1PO1 3;  4GZ9 A;  1NY7 1;  1WCD J;  3CBN A;  5FZ9 A;  5GLW A;  3B02 A;  2VUA A;  1TMF 1;  1UYZ A;  5H9S A;  3RYR A;  5F5C A;  2RJK A;  2DTY A;  4EWA A;  5LRS A;  4S2F A;  3AMN A;  1UZV A;  4CCL A;  5H9Q A;  5AVP A;  2EIE A;  2JDH A;  2VL4 A;  2WNU A;  4IE7 A;  4RR3 A;  3IB3 A;  1VRB A;  2K9Z A;  1LEC A;  1Q43 A;  1QXJ A;  3SXW A;  4AI3 A;  1HIX A;  1PK6 B;  4K8R B;  3VHN A;  2BVB A;  4Q4V 2;  4XUR A;  4FFF A;  1GZ9 A;  3H3Z A;  1NCQ B;  2Y33 A;  3JBG 3;  4KG0 A;  1LGC A;  2EXI A;  2RR1 2;  4SBV A;  3T2T A;  4BYY A;  1MVQ A;  2EAA A;  2ZAH A;  2ZKN A;  4KWK A;  5F3I A;  2G4I A;  4YM3 A;  4G3Y C;  4RFR B;  3UKV A;  2EXH A;  1JZ8 A;  1DF0 A;  3PVE A;  2CGN A;  4IEV A;  3WHT A;  4LO6 B;  2P4E A;  1EY2 A;  2AYH A;  2BUK A;  4XFG A;  1FPN 1;  1WGP A;  4I01 A;  2C9A A;  4FXK B;  2PQS A;  1IKQ A;  3INA A;  4UOJ A;  2QQO A;  2WDB A;  3W21 A;  4XXA A;  3KV9 A;  1ZRE A;  4N90 A;  2PAM A;  5C3R A;  1YQC A;  1RUJ 1;  1AZD A;  3FFQ A;  4CU6 A;  2HWB 1;  5BNN A;  4YW1 A;  2B9V A;  3CZJ A;  1FMD 2;  4TWT A;  1LRH A;  2C9K A;  2ET1 A;  3CEW A;  4RSU A;  5A3U A;  3LSE A;  1ASJ 1;  3LD8 A;  3DPR C;  4OUM A;  3B00 A;  1HN1 A;  2J42 A;  1XNT A;  4HT1 T;  3WQ7 A;  1HRV 1;  2LRP A;  2WT0 A;  2B8M A;  4YPJ A;  1LJ7 A;  1OOP B;  2D6O X;  2FCT A;  4QX8 A;  1KEX A;  2VMG A;  2WIN B;  4J6G A;  4HKO A;  3NV2 A;  4X8P A;  4HXC A;  5AC9 1;  1OLM E;  1X9T A;  2E32 A;  1NXD 1;  1S4C A;  2RJ2 A;  4HBN A;  4CCK A;  1ZZB A;  4DZG A;  3KHC A;  2ARC A;  5FLH A;  2XUE A;  1OUX A;  5DAX A;  2VUC A;  2DVD A;  3HBZ A;  4TN7 A;  4YVW A;  3NKG A;  2WZP P;  4HK9 A;  2CTV A;  2WWJ A;  1ULC A;  1V00 A;  1WA4 A;  5C9A C;  1KD7 A;  1RUG 2;  4GD4 A;  4WM7 A;  3U75 A;  4QU1 A;  2DVG A;  3D3A A;  5FKB A;  5HV0 A;  4RA0 A;  5GLT A;  4BK5 A;  3J8F 2;  5J1X A;  2W94 A;  2O0O A;  3HT2 A;  5F6K A;  5JZG A;  2E6V A;  4RN5 A;  5KBF A;  1D4M 3;  3TNQ A;  1UPS A;  1W8U A;  1DIW A;  3ZSE A;  1QNW A;  1V6N A;  1PO2 2;  4K21 A;  3VDD A;  1XNK A;  1VRH 2;  1LOA A;  1O5U A;  4O7X A;  1H30 A;  1HRI 1;  4YLZ A;  1RC6 A;  3TEW A;  4Q4Y 1;  2ZEY A;  4LBM A;  1J58 A;  2VBP A;  2IZW A;  4XET A;  5HBA A;  2C0Z A;  3JU9 A;  4PI2 A;  1ASJ 2;  1JZ3 A;  3LGR A;  4JAA A;  4YZ2 A;  5FY7 A;  1GZW B;  5BNN C;  4Y1Y A;  3HR9 A;  1YFY A;  1RUF 2;  2PHT A;  3LIH A;  1ZNP A;  4HSL A;  3VZM A;  1FI2 A;  2R6Q A;  1D0G A;  4NII A;  5FFO C;  3O12 A;  2WQZ C;  3ZO0 B;  4CDQ B;  1O5L A;  2VME A;  1XNB A;  1SFN A;  4E2G A;  5A3O A;  3J8F 1;  1SCR A;  4YM1 A;  1NX9 A;  4LA2 A;  4L99 A;  2ARB A;  5I8S A;  2OUJ A;  1NLS A;  4CP0 A;  2HWE 2;  1Y9Q A;  3WNL A;  1LHO A;  1UZZ A;  2CWS A;  3ZM8 A;  3Q9O A;  3ZPY A;  4AXO A;  1ONA A;  2F6B A;  1LTE A;  4ASL A;  3LB9 A;  2RS3 2;  4YZ4 A;  5FZ0 A;  1RJ8 A;  3ES4 A;  2J1A A;  2AGS A;  2K0G A;  3KMH A;  4QX5 A;  4QXC A;  1H1M A;  5IYY A;  4XF0 A;  5L7O A;  2MEV 2;  3KCC A;  3U4X A;  2B42 B;  2Y8K A;  4Z07 A;  2HWC 3;  1RMU 2;  2CSG A;  4QX7 A;  4A6O A;  2HH9 A;  2IFR A;  3KQR A;  4QXB A;  1OH3 A;  2DCJ A;  3PUR A;  3PTR B;  3N7J A;  3TOJ A;  1WLD A;  5KXC A;  1SLT A;  3WD5 A;  1LEN A;  2A6W A;  3V0B A;  1COV 1;  1H2N A;  5FPZ A;  1HB3 A;  5A6Z A;  5DDJ 2;  1UD1 A;  5J98 B;  2PHD A;  1NY7 2;  2GNT A;  3RRD A;  3UGH A;  2GSY A;  1NCR C;  1K5M C;  3GGL A;  4ATE A;  2A3X A;  3L9J T;  1WD3 A;  1A6C A;  4QDS A;  3POY A;  4QKF A;  2XGX A;  4UI9 L;  3WV6 A;  4D3W A;  1X7N A;  1MR5 A;  2DV9 A;  4UFK A;  1DYK A;  4XZU G;  4BME A;  4AG4 A;  4XUN A;  1ULG A;  2H0V A;  4B7K A;  1O3T A;  1NA1 A;  3WNK A;  5DZE A;  2GMP A;  2VZP A;  3AJZ A;  3IPV A;  3MIG A;  4JKK A;  2ZA9 A;  2IXH A;  3HEI A;  2YG0 A;  5BNP B;  4CCC A;  3PVO A;  2LRO A;  1UKR A;  2ZEW A;  4BQW A;  3MPP G;  4CEW A;  4JGY A;  5JOW A;  2RR1 1;  5E8A A;  5FXX A;  4DUW A;  1PGW 2;  2GP3 A;  1JI6 A;  1HQL A;  2XBO 2;  1ZZ6 A;  5C4W C;  1UOJ A;  3AP4 A;  1UXZ A;  3ZMO A;  2W87 A;  4XQD A;  1MEC 2;  2O1Q A;  3ACG A;  5FMO S;  4X6R B;  2PLV 3;  1MQT C;  1Q3E A;  1HN0 A;  4Q0P A;  5A70 A;  2FCU A;  4ZZ8 A;  2HJI A;  2WNU C;  1N47 A;  3DEM A;  4BLJ A;  4MGY E;  3KVA A;  5BUV A;  4P9X A;  3W5M A;  4GWM A;  5LA0 A;  3SIS A;  3GJB A;  2WLQ A;  5FMO L;  3WDT A;  4I0W B;  4JCK A;  4ZU5 A;  3I2O A;  1KRI A;  3I3M A;  3IM0 A;  1OA3 A;  4GMP 1;  2W68 A;  2ZHM A;  1IQA A;  1ZM1 A;  3DUI A;  3VB9 A;  1S0D A;  4RHV 3;  4XJA A;  4JKL A;  3VZO A;  2OZ6 A;  1VAV A;  1GV9 A;  1DGL A;  1KDM A;  1VMH A;  2PMW B;  2BGC A;  2X10 A;  2WSU A;  2XJP A;  3GXU A;  4Q8K A;  1Y7B A;  1O3S A;  1ENQ A;  2DCZ A;  1GQH A;  1RTV A;  2YV8 A;  3Q8A A;  2A70 A;  1AYN 1;  1ULE A;  1UXX X;  2JEN A;  2ZMK A;  1AX0 A;  1AF9 A;  1Q8O A;  3O1V A;  4Q0Q A;  3III A;  2D7F A;  1UY1 A;  2J1T A;  4QPG C;  3CDZ B;  3IPV B;  5A7O A;  1AL2 3;  4NAO A;  4BQ4 A;  1RJ7 A;  2IVJ A;  2ZGM A;  3CMG A;  4QQL A;  2XL7 A;  4JTO A;  5IW0 A;  2R16 A;  3TN9 2;  3B3Q E;  1ZBA 3;  2NMN A;  4AFC A;  4AFA A;  3HIF A;  1PGL 1;  4G4F A;  4LUL A;  4AVC A;  1AYM 1;  2QDN A;  1R08 2;  3PIG A;  2CL2 A;  2VH9 A;  1GYK A;  5T50 A;  2MPF A;  1N3P A;  4E9K A;  4OHV A;  3RYK A;  2W46 A;  2ZGS A;  4ASM B;  5A3L A;  1LHV A;  4BQ5 A;  5JDB A;  2RMU 3;  2XLG A;  4ISQ A;  2PAK A;  1N1S A;  3VD7 A;  4QGN A;  1ZA7 A;  2BFU L;  2WC2 A;  1PX4 A;  5FY5 A;  2VVF A;  4L92 A;  3OF1 A;  1OA2 A;  5CNA A;  3ENR A;  2ADD A;  4FAH A;  1BVP 1;  4K1Z A;  2IC1 A;  3ASI A;  3IWZ A;  5A3W A;  4CXX A;  5JUV A;  5FZ8 A;  1XJA A;  2QJV A;  1H0B A;  2ZX0 A;  4FBF A;  3NNL A;  4XF3 A;  4ZKT B;  4BIS A;  2D5F A;  3HD8 B;  2FMD A;  1W6M B;  3MLK A;  1HXS 2;  5FAX A;  5T54 A;  5FZL A;  4BU2 A;  1KFU L;  5BNN B;  2TEP A;  2DUO A;  2Q8O A;  2YBS A;  4CEY C;  2JG9 A;  3PVN A;  3QD6 A;  4N9I A;  5FP3 A;  5JAX A;  2IUW A;  3H7Y A;  4FTE A;  3ZFG A;  3MV0 1;  5J7M A;  2QCS B;  4W50 A;  4LO8 A;  1OQE A;  1LES A;  5I0R A;  4Y1V A;  4MLO A;  5FPX A;  1GKB A;  1CZV A;  2WZ8 A;  5ABJ C;  1MS1 A;  1RUD 1;  3JB8 A;  3VL9 A;  3H8X A;  3I2K A;  1BBT 2;  1K5M A;  4XC9 A;  4LBL A;  4NIA A;  5GZF A;  5L36 A;  2RS1 3;  3ACI A;  3CIH A;  4OHW A;  3O7O A;  4LPL A;  5FYH A;  3ZN6 B;  1EPZ A;  1W05 A;  3JCI A;  4L2N A;  2VQ0 A;  2D3S A;  4LLO A;  1CN1 A;  2BNM A;  3W59 A;  1BK1 A;  4GA9 A;  4P5H A;  5FXV A;  3V64 A;  3D0S A;  3J26 N;  3JXS A;  1PO1 2;  3HJR A;  4M4R A;  3CL1 A;  4UFM A;  3OPW A;  3AP9 A;  5ERL A;  5T5L A;  1QJU 2;  4AHY A;  4ARX A;  2WN3 A;  4CDQ C;  1C28 A;  2OVU A;  3KT7 A;  5K4L A;  4WVW A;  3VLB B;  1CGP A;  3AL5 A;  3KV4 A;  2QQL A;  4ET7 A;  1AXZ A;  3LFI A;  4GQ7 A;  1AL0 G;  1LHN A;  1ZYB A;  2BEO A;  2VY0 A;  2E53 A;  3BCW A;  1FNZ A;  5C4W A;  1S2K A;  1UYX A;  3ZXG A;  4CZS A;  5IVE A;  4AI2 A;  4JGY C;  3OGV A;  3WY6 A;  4CU8 A;  3R0R A;  5FMD A;  4LXL A;  4PIY A;  1TNR A;  4CP1 A;  4XFB A;  1VE0 A;  4DRV A;  3LPG A;  3EJK A;  4CVU A;  3ROU A;  2E26 A;  1IS4 A;  1OI6 A;  5B4X A;  2X5I C;  2XJR A;  4A2U A;  3T4H B;  4E2S A;  5IVB A;  2YU1 A;  4N8M A;  1ND2 B;  4BQY A;  5FYU A;  4AYU A;  2SLI A;  1FOD 3;  4X8N A;  4PLM A;  1C8N A;  1JHN A;  1VBB 1;  3PUI A;  2FZ2 A;  1K45 A;  3KQ4 B;  3OY8 B;  3WDV A;  3AYD A;  3LEK A;  3PUS A;  4Y24 A;  3E6B A;  3WDU A;  2AEZ A;  3UKT A;  1I6X A;  2RDN A;  1WD4 A;  2OT7 A;  3MIC A;  3I2F A;  4KQ7 A;  2QKD A;  2BJS A;  2WN2 A;  5FV3 A;  1Z7S 3;  1ENX A;  4IL7 A;  1RIN A;  2JIG A;  3JZV A;  4Q4W 3;  3LA2 A;  2ZML A;  1RUI 1;  4EE2 A;  3FL7 A;  2GMM A;  5FUI A;  3WNP A;  2D6M A;  2XG3 A;  2JKX A;  1RUC 1;  2XVL A;  4GKY A;  5F39 A;  4PQQ A;  4NRO A;  2ZGQ A;  4IV1 B;  4AE2 A;  2EIB A;  4EN6 B;  3B9C A;  2OXB A;  2I45 A;  2TNF A;  3K4A A;  2VD7 A;  3OYW B;  3POG A;  3DF0 A;  3V0A B;  1W6O A;  1WZX A;  2EIG A;  2XML A;  1UN1 A;  4JX0 A;  2QQW A;  4MO3 M;  4QKN A;  1MZF A;  4IEO A;  1CX1 A;  4LBQ D;  5FKC A;  1F31 A;  4CCE A;  5JIA A;  2XBO 1;  1JYT A;  3LKJ A;  2PHF A;  1UY0 A;  2VMH A;  1BEV 1;  3M4F A;  3IDE A;  2WWU A;  3VKM A;  4ES9 A;  1LB2 A;  1LOF A;  1MQT A;  5FYB A;  2C26 A;  4KGQ A;  2OII A;  2QQJ A;  2ZBJ A;  3AFK A;  4KU7 A;  2WNV B;  1MAC A;  1D4M 2;  1F5J A;  1GOF A;  2BOJ A;  3POI A;  4JQR A;  4QX3 A;  5CAZ A;  5IVC A;  4YGD A;  4NE9 A;  3JBG 2;  4ZON A;  1AX1 A;  1RUC 2;  2R7E B;  4RR3 B;  2GNM A;  1RGS A;  2WNV C;  5FZM A;  4DMI A;  1GUI A;  1OKQ A;  2DVA A;  4I09 A;  3V65 A;  5GLZ A;  4DRR A;  3R4D B;  4EQV A;  5GZE A;  4NN0 A;  5FP8 A;  2YZ4 A;  4LQR A;  1W0N A;  1VB2 A;  1DZQ A;  4R9D A;  1ASJ 3;  2B45 X;  2Y6J A;  5LBB A;  4C0B A;  3KHB A;  4V1P A;  2ES3 A;  2XJT A;  3BGA A;  4Q4X 1;  4XUP A;  4JTN A;  1Y3T A;  4AAP A;  3IT8 A;  1RUJ 3;  5IWF A;  3RZL A;  4OHZ A;  2JG8 B;  4W6X A;  2GN3 A;  3BOW A;  4UFI A;  1VP6 A;  3ETQ A;  4PLN A;  1SLC A;  3C7O A;  2PA7 A;  3N4M A;  2HWF 3;  4N53 A;  1POV 3;  5LBF A;  4XFF A;  3T2P A;  1QGL A;  3APB A;  5BNP C;  3OGS A;  1FPN 3;  4R4Z A;  3O1T A;  4YYO A;  3VBS B;  4PDW B;  1VBE 2;  4LBK A;  1SLI A;  4XAB A;  4XAE A;  3ZR6 A;  5LAT A;  2PYT A;  4AOC A;  3OBA A;  4A7K A;  2RS3 1;  2DFB A;  3KCX A;  1GZW A;  3ECQ A;  1F5F A;  4UWD A;  4EZ4 A;  3BN6 A;  4H7L A;  1BEV 3;  2XDV A;  4GKX A;  4OMC A;  1P8J A;  3H1Y A;  3VBO A;  3GHM A;  3EXU A;  3O1O A;  3MGU A;  1O6U A;  1GIC A;  1W8N A;  1TNF A;  2VAU A;  3VGI A;  2CDP A;  3LF7 A;  2VUL A;  1G9B A;  4D94 A;  3ZLI A;  1QJU 1;  1RHI 3;  4CE8 A;  1NT0 A;  2LW8 A;  4NRQ A;  1ZRC A;  3BB6 A;  2RVA A;  1IGO A;  4I3G A;  4YW2 A;  4GB3 3;  4UYB A;  2PHR A;  2Y60 A;  5FP7 A;  3O1S A;  2O8O A;  3M8L A;  4ISR A;  2Y0O A;  5LA1 A;  2LUW A;  3VD4 A;  2I2S A;  4TZD A;  3TWI A;  1TVG A;  4WM7 B;  1S0I A;  1XOY A;  4LR4 A;  2AH2 A;  1WW5 A;  4Q4Y 3;  5JSO A;  1HRI 2;  3RYP A;  3KS7 A;  2VEC A;  4QD2 A;  3USU A;  1TME 3;  4AEM A;  5LA9 A;  2L9L A;  1XBF A;  4YVW B;  3PMS A;  5EWS A;  5FZK A;  3JUU A;  3OCP A;  1GBG A;  2XL9 A;  4QX2 A;  5FTT C;  3HBK A;  3WNN A;  2YB7 A;  1UKG A;  4K7J A;  1NE6 A;  4AGV A;  5CA6 A;  5FO9 B;  2DVB A;  1KJR A;  1OLM A;  4LK6 A;  4Y22 B;  1IOA A;  3VBS A;  5JR2 A;  5J37 A;  1GR3 A;  2VM9 A;  4YFW A;  1UX7 A;  4UT5 A;  1AR7 1;  3H42 B;  4CXW A;  1MPX A;  1H9W A;  4M01 A;  5BNQ A;  1KIT A;  2WZR 1;  3OY8 A;  5BNO C;  1H9P A;  1RUG 1;  4N53 B;  4J1W A;  1R09 1;  1N3O A;  1KFX L;  3AJY A;  3ON7 A;  4FPL A;  2LAL A;  1GP4 A;  2GZW A;  4H55 A;  2VOK A;  4QM8 A;  4IE5 A;  2GH2 A;  3T1M A;  3T0D A;  2HWC 1;  1O3Q A;  3B5L B;  5EIY B;  2PHU A;  1RUN A;  3GBF A;  2ETE A;  4P14 A;  3ACF A;  1JHJ A;  4EWE A;  5FPU A;  1US2 A;  5DUW A;  1AX2 A;  1O4Z A;  3JD7 1;  4OHX A;  3VZJ A;  4D6S A;  5C9A A;  1X8M A;  2SBA A;  5A3M A;  1GAN A;  2OZJ A;  3NNG A;  3VBR B;  3POS A;  2X8K A;  4UBH A;  5DPN A;  3SKV A;  3AVS A;  3KB5 A;  2NM1 A;  1Y4W A;  4OQ8 A;  2VC9 A;  3PJQ A;  3R05 A;  2A73 B;  3HQX A;  4IEP A;  1XYP A;  3ST7 A;  3TNP B;  4HMZ A;  5DZG A;  1YFX A;  4NWW A;  3A7Q A;  4DUV A;  4E27 A;  2PAE A;  3N36 A;  1O8S A;  4O61 A;  2Z79 A;  1C1F A;  5FQ0 A;  1A3K A;  2ERF A;  5GKA C;  5JCT A;  3FZ3 A;  1RUJ 2;  3LOB A;  5HCF A;  1PX3 A;  1QIQ A;  3AX4 A;  1DGW X;  3THP A;  5T3N A;  3I2I A;  4N43 B;  4A44 A;  1GZT A;  3HT1 A;  1R1Z A;  3O5S A;  2WRA A;  1YQ8 A;  4PF5 A;  3A0N A;  2NYY A;  3EB7 A;  3FWE A;  4CP9 B;  2PHX A;  4EYU A;  2YC4 A;  3N9N A;  4GWI A;  4NVP A;  1VAK A;  2ZX2 A;  1M06 G;  4YW4 A;  5FZG A;  1ND2 A;  2B39 A;  5ABJ A;  3H7J A;  3HOB A;  3OUJ A;  1H4H A;  2VPV A;  5LAS A;  3B9I A;  3ILF A;  4NJ4 A;  2XB6 C;  4FFI A;  4BXF A;  1BJQ A;  4JV4 A;  3CHX A;  4W4Z A;  1VAM A;  3TBD A;  5C33 A;  5FJH A;  2VOT A;  4WZF A;  1H8T C;  1UY4 A;  3WXP A;  2DUQ A;  4YG0 A;  4FPO B;  1HQN A;  4JGZ A;  1I5P A;  3VDC A;  1C4R A;  1B35 A;  3NKT A;  5JXG A;  3Q8F A;  1W39 A;  1DYO A;  3TRS B;  1X8E A;  3A22 A;  4W6Y A;  1ND3 B;  1TMF 2;  4CCN A;  2R07 1;  1SBE A;  1I5Z A;  1SDD B;  1VR3 A;  2HWB 3;  2OUH A;  5FLJ A;  2QFE A;  1YRZ A;  2VXR A;  1WME A;  3BI3 A;  5J48 A;  3ES1 A;  3THC A;  2XVK A;  3KGZ A;  4IEW A;  1QMJ A;  2J1V A;  3VDB A;  1CAX B;  3LA7 A;  5T55 A;  3NJX A;  2Y6K A;  4XDQ A;  2VOV A;  3B94 A;  4YRD A;  3ZYF A;  3WW3 A;  1WMD A;  4KBZ A;  3POF A;  3T08 A;  5GZD A;  5IVF A;  3WG3 A;  1UAI A;  3BTZ A;  2V5Y A;  4GIQ A;  3Q8E A;  4LNV A;  5BPX A;  5CAD A;  4ZU7 A;  3NO8 A;  5DQ0 A;  1AYM 3;  4AW7 A;  3QAC A;  1BZW A;  1F2N A;  1HLC A;  1Q56 A;  1VBA 1;  4DY3 A;  5FOB B;  3RZG A;  5FCC A;  4IV1 C;  3T30 A;  4RS5 C;  2ZKL A;  4Y5S A;  3WUD A;  4CUB A;  1AR9 2;  5TSW A;  5C5T A;  1VMF A;  5DDJ 1;  5BY5 A;  1GWK A;  3I2G A;  2RJL A;  5GLU A;  3NMB A;  3IDB B;  4KL1 A;  2CAU A;  3A0K A;  1QOO A;  2HWD 2;  4SLI A;  5SV5 A;  4WVV A;  4HKW A;  3MPB A;  4BJ0 A;  1AYN 3;  3EO6 A;  1HRI 3;  1W0O A;  4QQH A;  5DAQ A;  4MGK E;  4EN8 B;  4UF0 A;  4B7E A;  2RMU 1;  2WAO A;  2RDS A;  1BBT 3;  2ZJC A;  5T52 A;  3HMY A;  5LEJ A;  1S2E A;  1PO2 3;  4IXL A;  5ANQ A;  1ZBE 2;  1H2L A;  4PHZ A;  2HWC 2;  3C7H A;  1XXN A;  3B93 A;  2VUJ A;  3H50 A;  4YZ5 A;  1ZZ7 A;  5A7P A;  4NHL A;  1J3P A;  1KXG A;  3U0Z A;  1V6I A;  3SC7 X;  5JOX A;  1SFP A;  1GNY A;  1PVX A;  1R09 2;  2JG9 B;  3WW1 A;  5K0U C;  5A6Y A;  4YGE A;  4JGZ B;  5JPN B;  2YPD A;  2WS9 1;  1POQ A;  2Q4S A;  3UNP A;  3RDI A;  1EP0 A;  3VZL A;  3WZ1 A;  1PZ7 A;  2RS1 1;  1GOG A;  4QGL A;  5D8A C;  3GDB A;  1W6P B;  4K40 A;  2FQP A;  4MET A;  1Q8P A;  4B4Q A;  3M3Q A;  2QE3 A;  2QZ2 A;  5ABJ B;  4D8M A;  5I8Y A;  2QQM A;  1J3R A;  2CV6 A;  2RM2 3;  3VZK A;  4XJU A;  3SCH A;  1CWP A;  4XF1 A;  4Q4W 2;  2G9F A;  4Q4Y 2;  4DPN A;  1CIY A;  4AQ6 A;  3ZDS A;  1D2S A;  1KJL A;  1GP6 A;  3O0X A;  2IFW A;  2IXI A;  4GH4 A;  1OBN A;  3POW A;  1TMF 3;  2WNO A;  2WNE A;  4BM8 A;  1REF A;  4L8Q A;  2JX9 A;  5FMC A;  4TTG A;  2NMO A;  5FYC A;  2PLV 2;  1FV3 A;  2VG9 A;  3DV8 A;  3K3N A;  4S2G A;  4XQ4 A;  1XE0 A;  2ENR A;  1WBL A;  1F35 A;  2CGO A;  5EYY A;  1GNH A;  4IES A;  1Z7S 2;  2WZR 2;  1BXH A;  1EAH 3;  4OI1 A;  4TSV A;  5A1A A;  2ZX4 A;  4AEJ A;  1AR7 2;  2X09 A;  4AL9 A;  5LK7 B;  1RB8 G;  1UU5 A;  2NP0 A;  4FP2 A;  3ME2 A;  1QJX 2;  2LTN A;  1X9P A;  3PUA A;  3NAP A;  1UQX A;  2P37 A;  2VZT A;  2WO2 A;  4PDW C;  2X05 A;  1JXN A;  1D7P M;  3FLP A;  4QPW A;  5AC9 2;  1IKP A;  2RG4 A;  3FX3 A;  4NRM A;  5C5U A;  3K2O A;  2X53 S;  4FPG A;  3U10 A;  2Y6L A;  4D6R A;  4DQA A;  2VCA A;  1G9C A;  1UMI A;  2WYS A;  2BVV A;  5A7S A;  1RUO A;  4KU8 A;  2IXK A;  4LBJ A;  3VZN A;  3WEZ A;  2ILM A;  3AC0 A;  3EQE A;  4FT8 A;  3AP6 A;  2YMZ A;  4KWJ A;  5JI9 A;  1FOD 1;  2VQU A;  5D8A A;  5HXV A;  2WR9 A;  1E5S A;  4WVM B;  2YBP A;  5FYY A;  2D6P A;  4Q4X 2;  4OUS A;  3PTY A;  1QQP 3;  4CU7 A;  2QQV A;  5DZF A;  2JG9 C;  1NUK A;  4BQ2 A;  1SLA A;  2FDI A;  4MXW B;  3ZSJ A;  4DS0 A;  1S0G A;  1NKG A;  3LAG A;  4UBG A;  1YQ5 A;  1XSR A;  1HJG A;  3KM5 A;  5FY1 A;  1YLL A;  2P2K A;  2GAL A;  3NJY A;  4XF9 A;  3ZYR A;  2WFF 1;  1YC6 1;  3UJO A;  4AGR A;  5JMO A;  3AXD A;  4C90 A;  1PHM A;  2TUN A;  4RHV 1;  5LW9 A;  3V0A A;  3OYW A;  2BPA 2;  4BK4 A;  4LIV A;  1ZBE 3;  5A7Q A;  1APN A;  3PME A;  1FT9 A;  1POV 0;  3DEC A;  3ZYI B;  4P5Y A;  2UYB A;  5J3U A;  3UGG A;  5IFT A;  2YUE A;  1IS5 A;  3M70 A;  1J83 A;  1BLZ A;  4BLI A;  1YQ6 A;  1H2K A;  2CWM A;  2VTX J;  5EZW A;  1WLT A;  1RVF 2;  2D98 A;  4LHK A;  4OI2 A;  2WT1 A;  5FRE A;  3AM2 A;  4Y20 B;  1SMV A;  2YHJ A;  3KV6 A;  2C5D A;  4GB3 2;  4HK8 A;  4JDM A;  1E57 A;  2PHL A;  1UO9 A;  2XHK A;  4CEW C;  2WUH A;  3PVB B;  5I0T A;  3SCG A;  5IJR A;  5K8S A;  3VN4 A;  4XYX A;  5IUQ A;  2VTX A;  4LO7 A;  3WP5 A;  5DAB A;  3UET A;  3VBU B;  4Q4V 3;  5EP9 A;  4JRL A;  4IEZ A;  5EJ3 A;  2EA7 A;  4DIQ A;  1ZVF A;  3NST A;  5CZK A;  3MF6 A;  3L2Y A;  2Y34 A;  4XUQ A;  2G9G A;  1XB9 A;  5T5O A;  3ITQ A;  1MZ6 A;  3AZV A;  1IHM A;  4OUL A;  5FZ3 A;  4C0H A;  1H6Y A;  3ALQ A;  2VZV A;  2QDR A;  1PM7 A;  4UW4 A;  4AFB A;  4MGS A;  3DL3 A;  4OFG A;  2PN5 A;  4FOV A;  1AR6 3;  2HWF 1;  4Y33 A;  4YW5 A;  4FQZ A;  3WCS A;  1D4M 1;  1QJZ A;  1L7R A;  3M7A A;  3UJQ A;  1WUV A;  1YIF A;  1LU1 A;  3WCR A;  3E5X A;  5KHJ A;  4AED A;  5C4W B;  3RZH A;  1DGW A;  1NCR B;  2FMY A;  2UWC A;  1EV1 1;  5FOJ B;  4YZ3 A;  3DN7 A;  3LEI A;  4U2A A;  3BIW E;  4DB5 A;  3OGG A;  1JZ7 A;  5FZ6 A;  4XQW A;  4CDW B;  1U5X A;  1UYY A;  4COZ A;  4MGQ A;  1WLW A;  4C1X A;  1W8F A;  1WA6 X;  2BNO A;  3FHA A;  2VZ1 A;  4MHR A;  2QQI A;  2JXA A;  3ZFE A;  1JYV A;  2VO5 A;  2WFF 2;  4GAL A;  1VBD 2;  1PMI A;  1RUD 3;  1H1A A;  2TBV A;  5IVJ A;  4NHY A;  3MV1 1;  1G7Y A;  3HN1 A;  1K5M B;  1G6N A;  4Q8L A;  2W1W A;  4QPY A;  2GP5 A;  1LEM A;  2D3P A;  4X6Q B;  1LOE A;  2PEL A;  1OQ1 A;  1VLN A;  1X50 A;  3I49 A;  1SHW B;  1PO1 1;  3Q8C A;  2YDE A;  1NYW A;  3QCW A;  3QH6 A;  1MS3 A;  1AJO A;  2IXL A;  3NWK A;  2E31 A;  4N9H A;  1JZ6 A;  1NE4 A;  1CJP A;  4QQP A;  3THT A;  1FOD 2;  2WZE A;  1GNZ A;  5GM0 A;  5KWR A;  2W9X A;  5L19 A;  5G04 L;  5FPL A;  1RHI 2;  4P02 B;  2VZO A;  2QBX A;  1US3 A;  3ZN4 A;  4EWD A;  3AB0 A;  4HLT A;  4PIX A;  3MLJ A;  3UL2 A;  1BVV A;  3ZXL A;  4FO9 A;  2HEV F;  3SH5 A;  4BCU A;  5LBC A;  1STM A;  4A3Z A;  2CY6 A;  2K2S A;  5FZ1 A;  2V73 A;  4QAW A;  4EJR A;  4S2H A;  1HB1 A;  4XZP A;  2ATF A;  1UIK A;  1SBD A;  1QJX 1;  3MID A;  3VHR A;  5IK4 A;  1XNA A;  4KWU A;  1S0C A;  2F4P A;  1OHF A;  3CU7 A;  2WII B;  1W06 A;  5LZ6 A;  3I3D A;  2VZS A;  2XUM A;  5CFC B;  4FOQ A;  5C3P A;  1T6G C;  1V0A A;  2HBU A;  4HFS A;  3S0M A;  3AKR A;  4B29 A;  4LOS A;  1YQ2 A;  4NHM A;  4XJ9 A;  3RNS A;  3U11 A;  1QNY A;  5CEH A;  3WG1 A;  2Q8C A;  1B35 C;  1N1T A;  1VBB 3;  4I02 A;  4XIL A;  3VBH B;  3JQW A;  4YW7 A;  2FCV A;  4OZO A;  5FPA A;  2ZGU A;  3WDY A;  4AR2 A;  1N1Y A;  1JTZ X;  2WKK A;  3RG0 A;  3BU0 A;  2YRO A;  3SEE A;  1O8P A;  1PNG A;  3RZZ A;  4YAR A;  4TLG A;  1VBC 2;  3N7L A;  5GLV A;  1ZZC A;  2WZR 3;  4CDX A;  2A5Z A;  4B8E A;  2C24 A;  5A1F A;  1C3H A;  4COV A;  2OA2 A;  3WNO A;  4BDV B;  3FMG A;  4YM0 A;  2J1R A;  3E5Q A;  3GZT B;  4UFL A;  3CZU A;  4ZXE A;  3NNJ A;  1CAV A;  3FE5 A;  5DUU A;  4J25 A;  4CSW A;  1JYX A;  4CP9 A;  1QOT A;  2ZGP A;  3MW2 A;  5D21 A;  1V6K A;  1CAV B;  4HET A;  4QKD A;  3JD7 3;  5FLI A;  5FZ4 A;  2P3I A;  5DUV A;  4A42 A;  3PDQ A;  3ZFF B;  4WVZ A;  2WL1 A;  1WMX A;  5KR7 A;  5FQ0 B;  4Q1R A;  1HXS 1;  1Y9G A;  3I8T A;  3EMR A;  4BZ4 A;  4CDX B;  4AK3 A;  2JKB A;  4CUC A;  1JW6 A;  3VKL A;  1AXK A;  3ILR A;  2E7T A;  2VVE A;  4P08 A;  1F4H A;  1WCQ A;  3NJV A;  4F7Z A;  1YCI A;  2H6B A;  2DBN A;  3RQ0 A;  1OXC A;  2BOI A;  3VBF B;  4CCJ A;  3IKW A;  1W0P A;  1VBD 1;  4CDW C;  1HB2 A;  5F2S A;  2RV9 A;  1AYM 2;  2BGO A;  3T09 A;  2JDA A;  2UUR A;  3SKJ E;  5IK7 A;  3MUY 1;  4IEU A;  4ZZ5 A;  5JR7 B;  1WKY A;  1ZRR A;  4FAG A;  3T0A A;  2ADE A;  3NNM A;  1RUH 1;  3T0B A;  3WW2 A;  3BAL A;  5ACA 2;  1JU4 A;  1NQD A;  1DZT A;  1W9Y A;  1NZI A;  4XFH A;  1RVF 3;  3RWK X;  1S1A A;  2VCB A;  3ELN A;  5HCH A;  3KVB A;  5EXO A;  4Y4R A;  3LDK A;  4KMQ A;  4Y5Z 0;  2CAV A;  2VCC A;  2V4V A;  2P5B A;  1HV1 A;  2AEN A;  1AYN 2;  3OBT A;  4IE0 A;  5A33 B;  3OD0 A;  3RZJ A;  4AVT A;  1BK0 A;  2AUY A;  1GZC A;  4QX1 A;  3ZX7 A;  3POJ A;  1LUL A;  3ZXA C;  4D6Q A;  3W5N A;  4MGI E;  4IGQ A;  3K77 A;  3T4V A;  1ZRF A;  1FV2 A;  1OOP C;  1TME 2;  2Y26 A;  4XJ8 A;  1S0E A;  3K4Z A;  3VHO A;  1YI9 A;  3VBU C;  1D4V B;  4CRQ A;  3O1M A;  4OI4 A;  1DBN A;  1NCR A;  1UU4 A;  4AQ2 A;  5L7O B;  2VQA A;  5DDJ 3;  2A6X A;  4AED B;  1LKN A;  5E1R A;  4DXR A;  2XOM A;  3TEX A;  2YC0 A;  4YG3 A;  4M3C E;  2VJX A;  1OH4 A;  4XUT A;  2GC0 A;  3GNE A;  5A32 B;  3OEA A;  4CU9 A;  2ZAB A;  4CDU A;  1R1A 3;  1AR8 3;  2NN8 A;  2VCM A;  2WFP A;  3I2H A;  4Q1P A;  2WWS A;  1YO8 A;  1QDC A;  2Z5W A;  4LBQ A;  5IAT A;  3PUH A;  2VUD A;  4GB3 1;  1CZS A;  1OLR A;  4PQ9 A;  1RUE 3;  3USS A;  1HJF A;  5FY9 A;  3WNM A;  1FXZ A;  4DIN B;  3AYA A;  4EV0 A;  1RXF A;  2VE1 A;  2Z2S B;  3I97 A;  5DAV A;  2D5H A;  1SFY A;  4QWN A;  5EQU A;  3ZFF A;  3WOG A;  1QDO A;  3J9S A;  4BE3 A;  3T2O A;  1JZ5 A;  4IEY A;  4IW3 A;  3AZY A;  4BWO A;  5AVA A;  3KD4 A;  1PNF A;  4FI9 A;  1CR7 A;  3AFG A;  5G05 L;  4Z8B A;  3CQO A;  4C8D A;  4IEQ A;  3JQX A;  4GAZ A;  4W6W A;  1H8T A;  4Q5O A;  1MVE A;  3LEM A;  3URF A;  2P3K A;  5FYI A;  3SQO A;  4EN9 B;  1J1L A;  3L2H A;  2YPJ A;  5JLV A;  2Q0A A;  1R09 3;  4P9G A;  3VBH C;  5FBZ A;  4S2D A;  1WLC A;  5A1L A;  2ZPX A;  5FYT A;  2ZEZ A;  1OVS A;  4LLF A;  1EAH 2;  4PJY A;  4JHT A;  3LQC A;  5KXD A;  1U12 A;  5A6Q A;  3THD A;  3ZXK A;  5BNO B;  2BNN A;  3H8U A;  1COV 2;  1NZC A;  2ZX3 A;  3H8O A;  4UAP A;  2KM2 A;  3VBH A;  3CNA A;  1CIW A;  4RGG A;  2VZQ A;  3VBO B;  2FBE A;  1W8Z A;  1VMJ A;  2Y6G A;  5A80 A;  3BTA A;  1JUI A;  1RMU 1;  5H9P A;  1VRH 1;  3KV5 A;  2ARA A;  3WNX A;  4AI0 A;  4BHP A;  1R08 3;  1IZ3 A;  3GYD A;  1RUF 3;  3O1P A;  4NO4 A;  5CKM A;  3N9O A;  2J1E A;  4KG8 A;  2VMF A;  1WW7 A;  1KQR A;  1PVC 3;  5D8A B;  3AK0 A;  2KA3 A;  5DMY A;  4A6S A;  2RDQ A;  2ZMN A;  3AYE A;  3B69 A;  4NWV A;  4QDQ A;  4Z2W A;  1Z7S 1;  2W39 A;  5F5I A;  3ZFF C;  3FJS A;  1S0B A;  1ODN A;  2VNO A;  1CES A;  4OCT A;  1AL2 2;  4V2W A;  4M3C F;  4ZU4 A;  2ZXQ A;  4N53 C;  2PFW A;  1DHK B;  1W8O A;  4JGZ C;  4NOT A;  1YYN A;  2Q8E A;  3WG4 A;  4ZXK A;  3GCW A;  2ZHN A;  4IV1 A;  2DCY A;  2AZ5 A;  1LAJ A;  1FYU A;  1S0F A;  1YI7 A;  4Y4Y A;  3ZKU A;  4GXL A;  5C8C A;  3VBF A;  3MFA A;  1CAW B;  4MX3 A;  4CTE A;  5L9B A;  5LA2 A;  5C7G A;  2WQ4 A;  4LBO A;  4MXW A;  2I07 B;  3ZDV A;  3OSD A;  2CYF A;  2RE9 A;  4MVT A;  4MG2 A;  3T1L A;  3AZX A;  1W9S A;  3ZXD A;  4WVM A;  2WNV A;  2R30 A;  2E63 A;  4CCD A;  1EAH 1;  2WT2 A;  2BU9 A;  4K6B A;  3PL0 A;  1RED A;  3I59 B;  1WWY A;  5K0U B;  4DXS A;  5JXI A;  5CBL A;  3TYJ A;  1JYC A;  4IE6 A;  1QXP A;  3ZFE B;  4XIO A;  4L0P A;  4B3N A;  2WBK A;  2EXJ A;  1C5H A;  3IAQ A;  3KT4 A;  3I54 A;  4E8D A;  1UZY A;  3FN9 A;  1W8W A;  2Y64 A;  4NPR A;  1AR9 3;  4P9L A;  4YVS C;  5C3S A;  2NQY A;  4MV2 A;  3DKQ A;  3U1X A;  4WM8 A;  1UY2 A;  4JQT A;  3S7I A;  4XDP A;  4LO4 B;  5SV8 A;  3NQH A;  3TB0 A;  1YFW A;  1IG0 A;  5FZA A;  3AZZ A;  1O4T A;  1ZBE 1;  3W20 A;  5F5Q A;  3LPF A;  4YVS A;  2PHW A;  2JDP A;  5DAW A;  5EV7 A;  3MHZ A;  3J7M A;  3PHM A;  1PIV 3;  4XPV A;  3AKQ A;  3K48 A;  3VDA A;  1QXR A;  4Z82 A;  3MDP A;  2PTM A;  2VZ3 A;  4Q29 A;  2WQ8 A;  2Y0I A;  4YGC A;  3PNA A;  4JKM A;  5CG9 A;  4Y1Z A;  4MH0 E;  4IEX A;  4F8A A;  1K42 A;  5IK8 A;  3IMN A;  1FAT A;  1MS8 A;  5F37 A;  2BV4 A;  5IK5 A;  1W04 A;  1W9F A;  1FMD 1;  5EJ1 B;  4NPM A;  2VTF A;  5EPA A;  3ZN6 A;  4ORF A;  1VBA 2;  3J7H A;  2D43 A;  5HPO A;  1FAY A;  3ZVX A;  4LT5 A;  1W6P A;  1OOP A;  2HBT A;  1AR6 1;  5FY8 A;  5FY4 A;  3UGF A;  1GSL A;  1FPN 2;  1G9D A;  4YNI A;  4Z1V A;  3JBG 1;  1V6O A;  4DXZ A;  3ZFG C;  3P5B A;  3ZIX A;  1RIT A;  4LOR A;  3LA3 A;  5JZG C;  4KH9 A;  1XND A;  4XF4 A;  2VZR A;  1AJK A;  4CEY A;  3ZFG B;  3D82 A;  1CZT A;  2YFZ A;  3QOP A;  4PBP A;  4IE4 A;  4QB6 A;  2ZX1 A;  1ZA4 A;  4FFG A;  4I0A A;  1BEV 2;  1CQ9 A;  4Q4V 1;  3N9M A;  2VOX A;  4FP3 A;  4Q0V A;  3FHI B;  4QXK A;  1IPJ A;  4NMI A;  3MBW A;  4IUG A;  3VHP A;  2XH6 A;  3LIG A;  1ULF A;  4AVA A;  1YJK A;  3I3Q A;  3AVR A;  3DYO A;  3KCY A;  3EYP A;  5T5P A;  1VIW B;  3DXT A;  4FOW A;  3BUC A;  3LZZ A;  4LUK A;  3FUO A;  2QQP A;  1QJF A;  1JH5 A;  4XW3 A;  1AR7 3;  1CAX A;  2GC2 A;  2A7A A;  4OZX A;  4DNY A;  1REE A;  1HRV 3;  2P17 A;  3X29 B;  1TE1 B;  5C71 A;  4MAD A;  5CKQ A;  1C57 A;  2WA4 A;  3VBS C;  1XU1 A;  5AC9 3;  5F32 A;  1RUC 3;  1U5Y A;  2KXL A;  4FPC A;  5I91 A;  1OMI A;  3VBR C;  2ARX A;  2DU0 A;  4YG6 A;  4Z92 B;  2DUR A;  5FK7 A;  3FLR A;  2BWC A;  5FDB A;  4XHB A;  2VMC A;  4YWA A;  3GZE A;  1VBB 2;  2VBB A;  4R4X A;  2Z69 A;  1UMZ A;  4QT6 A;  4E8C A;  4IGO A;  3KLS A;  4XBN A;  3OGJ A;  4PT6 A;  3M3I A;  1S55 A;  1UU6 A;  5F7U A;  1A8D A;  2XBO 3;  1RXG A;  5K9Y A;  4A45 A;  2JE7 A;  3MYX A;  4HKL A;  3WDW A;  1AUY A;  1UOB A;  1UZW A;  3MIH A;  1BKZ A;  2XJQ A;  3E6D A;  1IS6 A;  4HN0 A;  4LIT A;  1S2B A;  5IVY A;  4AWD A;  2XVG A;  5C70 A;  1LHW A;  3FBY A;  1C8M 2;  1YNA A;  3LDR A;  1WW4 A;  1CX4 A;  2W3J A;  4DO0 A;  1DP0 A;  1H1I A;  4PIZ A;  2PXJ A;  2FHR A;  5ACA 1;  5JMC A;  4W8J A;  2JD4 A;  5B4N A;  4XJZ A;  3AKP A;  4W65 A;  1PIV 2;  4GH4 B;  4BMB A;  1HQW A;  1Z78 A;  2ZS6 B;  3MEP A;  5ANN A;  3MFC A;  2H6C A;  2DVF A;  3AL6 A;  2BBV A;  3D0J A;  1QJY 3;  3NJZ A;  3E6C C;  2BGP A;  3JD7 2;  3S6P A;  2DUP A;  3SMH A;  2HYK A;  3QBQ A;  3CJX A;  1X36 A;  3P3P A;  3ZFE C;  2V09 A;  2J22 A;  4GWJ A;  4U36 A;  1F8V A;  4I0B A;  2DCT A;  2EAK A;  2VVD A;  4RYD A;  1SDW A;  5E88 A;  3VBR A;  4AFM A;  1N3Q A;  3ZOI A;  4I30 A;  3V0B B;  4QHZ A;  1DLC A;  2OKX A;  4KGG A;  2O8Q A;  4MGZ E;  4UXA A;  3IDA A;  2WO3 A;  5A3T A;  3TEZ A;  2KR2 A;  3K4D A;  3NNF A;  4HON A;  1DDL A;  1XNC A;  2CHH A;  2XLF A;  3KWV A;  4PCR A;  3SH3 A;  5C9A B;  1LHU A;  2HYX A;  4WM8 B;  2DF7 A;  2EIC A;  1ACC A;  1CAU B;  3MUZ 1;  4WV8 A;  3ETP A;  4RQP A;  4XVH A;  2RS3 3;  3GF6 A;  3KF5 A;  1W3V A;  3ZXE A;  1VB4 A;  4ARY A;  1BMV 2;  3D8C A;  5LCW L;  4AI1 A;  3WSO A;  1SLL A;  2A75 A;  1DQ2 A;  2VXJ A;  2GC1 A;  2R04 1;  3BKZ A;  1VBC 1;  3OUH A;  4ZS2 A;  5K0U A;  2ZGO A;  3VL8 A;  4BIF A;  4HVQ A;  5ISL A;  3N35 A;  1HKD A;  1YHF A;  4ZS3 A;  5FBJ A;  3ZXF A;  4FVV A;  1LGN A;  4YZ1 A;  1GQG A;  4F83 A;  2B46 X;  3VDD C;  1ENS A;  4UF0 B;  4ASK A;  5LY1 A;  5F6L B;  4QPG B;  1L7Q A;  3H1W A;  2D6L X;  3EBR A;  4M4P A;  2EAL A;  1UOG A;  2X5I B;  4AVS A;  4CDU B;  2JE9 A;  1SZB A;  1AVB A;  4CPB D;  2CGP A;  4TXW A;  4D0Q A;  2P34 A;  5A32 A;  4MGT A;  2Q1F A;  1IG3 A;  3FC0 A;  1NOV A;  1ZZ9 A;  3O0W A;  4H3W A;  1W2U A;  2W1U A;  4IND A;  2B4K A;  3NAP B;  2BP6 A;  4JGY B;  1UMH A;  5B2G B;  5FZO A;  5BNP A;  3DYM A;  3SH4 A;  3UV9 A;  4WM8 C;  2FDG A;  4LUM A;  1VBD 3;  1XC6 A;  1W9T A;  2C1F A;  2G9Z A;  3FFZ A;  4QKB A;  1PGL 2;  4FCA A;  4CCM A;  2VW1 A;  2J7M A;  4KBB A;  4EZH A;  4PLO A;  3FUQ A;  3WP4 A;  3WQ0 A;  1VBE 1;  1OPO A;  5BXX A;  1IPK A;  3I3E A;  4QPI A;  5JIU A;  5JOZ A;  2OPK A;  1DQ0 A;  2JG8 C;  4P9I A;  1RUG 3;  4CDW A;  5IVV A;  4BQX A;  1F4A A;  2D6K A;  5FPB A;  2R06 3;  2X29 A;  3HAG A;  3NV1 A;  1FNY A;  3OUI A;  4XUO A;  4YGB A;  4BOW A;  4NIG A;  3DPR A;  5CIR A;  4B4P A;  4XFC A;  4RGK A;  2ZOE B;  5IAV A;  1BYH A;  1ND3 C;  3ZYG A;  4UW3 A;  2R49 A;  4AVV A;  3GJA A;  1NG0 A;  1W2O A;  2A6Y A;  3MIF A;  4LMF A;  1NLQ A;  4YFZ A;  3BPS A;  1F9K A;  5APA A;  1KS5 A;  1T2X A;  4FPE A;  4ITC A;  5FZD A;  4AQS A;  3H3L A;  1JYW A;  1IQD C;  1KDK A;  4LTA A;  4QM9 A;  3AXE A;  5AFB A;  5L9V A;  3C7E A;  1HB4 A;  2YC2 A;  3IDC B;  4BQ3 A;  3M1H A;  2RM2 1;  2ZGL A;  4GMP 3;  3NW4 A;  5A7W A;  1PVC 2;  1C1L A;  1XE7 A;  2V4A A;  1NXM A;  2WS9 3;  2WYF A;  2Y38 A;  3JB4 C;  2MEV 3;  5LK5 A;  2JIJ A;  4CEY B;  2H0B A;  3GAL A;  1RUE 1;  3S7E A;  3AMM A;  4URA A;  5KXB A;  1QWR A;  3BYW A;  4ZY9 A;  1ODM A;  3U37 A;  2BBA A;  3GHN A;  2DWR A;  2P3J A;  4HPK A;  3BTX A;  1R1A 1;  1AR8 1;  1E5R A;  1W8T A;  1QH7 A;  2OW4 A;  4NUB A;  2YFU A;  1W8H A;  1HX6 A;  2BRT A;  3ABZ A;  2HWE 3;  4RS5 A;  3GCX A;  5LWB A;  1UX6 A;  1I9R A;  1SPP B;  4CDQ A;  3E97 A;  2DBI A;  4XFI A;  4K20 A;  3RSJ A;  3BU7 A;  2BER A;  2DFC A;  3C8X A;  2FDK A;  2XKO A;  3LCP A;  3PU3 A;  4PBO A;  1K3I A;  1R64 A;  1WCS A;  2BYV E;  2JB4 A;  3NV3 A;  4GUL A;  3PLQ A;  4IDZ A;  4D69 A;  5KC5 A;  4I3P A;  2ZAC A;  3GBG A;  1K12 A;  3ZSK A;  2JIC A;  3WT3 A;  4Y3O A;  4EN7 B;  3R4S A;  5BV6 A;  3A21 A;  3I7D A;  3U14 A;  1RUI 2;  4FTB A;  1OFS A;  3O14 A;  5FYM A;  3CJI A;  3O0V A;  2ID4 A;  4Q0S A;  4LKE A;  4XOG A;  1QHD A;  1CPM A;  1V6L A;  4OUE A;  4YVS B;  1O4Y A;  2ORX A;  4FOY A;  3HQU A;  1GLH A;  1W6N A; 
#chains in the Genus database with same CATH homology
 4N8M A;  1NLQ A;  5EHD A;  2P1B A;  3T30 A;  1XE0 A;  2VTX A;  1K5J A;  4CA9 A;  1XB9 A;  2VTX J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...