4N8NA

Crystal structure of mycobacterial ftsx extracellular domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
102
structure length
102
Chain Sequence
LDRVESQVFLTEDVSANDSSCDTTACKALREKIETRSDVKAVRFLNRQQAYDDAIRKFPQFKDVAGKDSFPASFIVKLENPEQHKDFDTAMKGQPGVLDVLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein FtsX
publication title Mycobacterium tuberculosis FtsX extracellular domain activates the peptidoglycan hydrolase, RipC.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Membrane protein
total genus 25
structure length 102
sequence length 102
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18075 FtsX_ECD FtsX extracellular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3040 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4n8nA00
4N8OA 4N8NA
chains in the Genus database with same CATH superfamily
2VKRA 4OZ0A 3T1HJ 5GAHI 3FZ2A 4ZP9A 1X4GA 2CNKB 5GMEA 2A2DA 1S0OA 3DRRB 5HLFB 1TP7A 5G4DA 2ZDPA 1FWKA 1SKWA 1LXNA 4CYUB 5C7PA 1BWEA 4ECSA 4J9KA 1REVA 1F2GA 3BO3A 2A6OA 3K7RA 1LWCA 1J5EJ 3KOAA 3HHKA 1KTQA 4P75A 2SXLA 2LA6A 3MM9A 1J5OA 2F3JA 1UVNA 4X4UA 3U1MA 2CG8A 4DG1B 4KAIA 2R2TA 4C8OA 3POTB 4YP3A 1PAUB 3OTOF 4DZDA 2V94A 4TNOA 3DRYA 1S72S 3MFIA 2LKZA 4G6VB 2XHWA 1UVMA 1BQMB 2HRYA 3AD8C 4PZVA 3BYPA 4WBFA 3KJVB 3FRYA 3HXMA 4O23A 3HVRA 2Z2ZA 1VCTA 5LL6d 4F67A 2QL5B 1IM4A 2E1CA 5HBMA 4NXMF 4DX6A 2VPWB 2VDHA 3WC0A 3ITHA 4KFBA 3KLFB 4ZPCA 2CA9A 2BRKA 3T5KA 4LVOP 3JB9k 1I6JA 2K3IA 2LQ5A 2W2NP 1NB2A 5KG1A 4CTAA 2KXNB 2JLEA 3PV8A 3OHBA 1ZBTA 5D3GA 2HZCA 2CVIA 1K1SA 2ZWOA 3EZ5A 1IKWB 1U1RA 2ZHOA 3MEKA 2F9JA 2OFGX 3QBCA 2CVEA 5F8NA 2ROGA 3IC1A 5GVQA 1X9SA 4M5NA 2ZH9A 4HHUA 3E01B 5H9EK 2PMHA 1NSKL 5CYJA 1VJQA 4GKKF 2MGZA 3D0HE 4JI1F 1FO1A 4ECZA 2EXUA 3I0SA 2H9ZA 3SCLE 4J9NA 3P8BB 1R8HA 3C2PA 5THWA 5F41A 2XULA 3EZUA 1QAIA 3QIPA 1R7IA 4CNZA 3RB6A 2NSBA 3FQKA 1FDNA 4DR4F 2HIQA 2PE8A 1C0TA 2ALZA 1HNWF 3I56S 3OT9A 1QAXA 1QTNB 5LM7E 2CJAA 2DGSA 2HHVA 5D4PA 4ZVTB 2ZNZA 5JUMA 3MCNA 4GVBB 4C6AA 4RUHA 1TKZA 5K8PA 3LP2B 4GRSA 5J2PB 1C4AA 4NEYA 1AW0A 1YQHA 5KFZA 1FRJA 3BDEA 4NMXA 2APOA 3QZ7A 1WOSA 2B4PA 2XTJP 2PD1A 5HVHA 4WZMA 1U1KA 1SC3B 1EETA 5F0WA 3PRBA 4WE1B 3DOKB 1ZTWA 3CCSS 3R7BB 2FTRA 5L1KA 1U6BA 1HIYA 2FJBB 1WJ9A 1S0MA 1LK7A 5C2CA 5H9FJ 5EUHA 1S1WB 1RGVA 4P74A 2QA4G 2WB4A 2OFHX 1VRQC 5IT0A 1CULB 4PAAA 2XYHB 1S77D 5U47A 1RQ0A 4ZLLA 4FPRA 4NLXA 4WIIA 3UE2A 1UAWA 4DL3A 1VBKA 4JI5J 4YDDB 2C2ZB 2ZH7A 2FVPA 1K0TA 4DF8A 2J9DE 3W64A 4QOTA 2LP4A 5KG7A 2MJNA 1FK9B 3K0JA 1NK5A 2OTLS 2MY8A 5CYQB 3J7YU 3WBZA 2DNHA 2VFTA 4NCAA 2HMIA 1NU4A 5FDLA 1N6QB 1P1LA 4C2MA 1WHXA 3OSPA 3MR3A 4I2QB 1CJKA 4O3QA 1RZMA 1U6FA 1VHIA 4HL9A 1N88A 2NXNA 2DHHA 2GCFA 1RT5A 1JJCB 4RW9B 1S9FA 4PKDB 2ZWPA 4F36A 4A8QA 2ZHAA 4QPXA 3HFKA 3BQ0A 4CLTA 2VPYB 5HK4A 1B4SA 1Q82T 4NRTA 3GWCA 3TNVA 3UCUP 3ILLA 1UZDA 3BYRA 5KFKA 2FB0A 3BGLA 1UETA 5LXYA 4JBCA 2KM8C 2YNGB 1G6BA 2M9KA 3RZAA 1KVIA 1VLOA 2I5JA 1VC5A 1FEEA 4X62J 2KZMA 2CAJA 1ZS6A 4JI2F 2M2BA 2W9CB 2D41A 2HGNA 4TKTA 5E41A 1RKIA 2HWTA 4AXIA 3NAHA 3BN4A 1HFEL 4CLKA 4Q5VA 4L73A 3P49B 4C11B 2F63A 3TAMB 4NYOA 5HLFA 2QFIA 1N48A 2VL1A 2Q1LA 4RW7A 3QSIA 2JL9A 4CYUA 4A8KA 2O01C 4ITSA 1G3OA 4WP3A 4WFNQ 3IS9A 1SQGA 2YQ3A 1HBUA 1YJTA 5E3QA 5AT1B 4M95A 1YJWS 3OFEA 3HP6A 1IBLJ 2KYZA 4ZPBA 2LDYA 5L9XA 4DG1A 3AOAA 3POTA 1K44A 2HNZA 3TRGA 1WC6A 3CCQS 3NS6A 3QGHA 4J37A 4E0DA 2ROPA 1VC6A 4YHHF 4B3TF 2X1FA 1NH8A 1ROFA 3K5LA 2QJ3A 1BQMA 2IVYA 2KRRA 4DSKA 1LK5A 2ASLA 3K5NA 4EBEA 3KJVA 4HYKA 1PJ5A 1HBOA 4NZ0A 1JLAB 1S79A 2CRLA 4UUWA 4LVNP 2Y0BB 3LALA 2D3ZA 4NLVA 1OSCA 1HD1A 2YXLA 2UUCF 3PR4A 3TUIC 2MZTA 2Z4PA 2XZWA 3KLFA 1IR0A 2ZBCA 2R8KA 2Y8YA 2MTLA 3HVTB 2OSQA 4ZPTR 3GQCA 4FNIA 4J9VA 4P7TA 3ZZYA 4XPEA 3VAMA 4FYYB 3SFUA 4F26A 4F50A 1IKWA 3BEGB 4RX6A 5IZHA 4DR6J 2X3GA 1O8BA 4NLTA 1ICEB 3NAIA 1LWXA 2ACYA 3CUNA 5DS7A 3FCVA 1RWXB 2HG4A 4RU9A 3EX7B 3E01A 1N5VA 1QSYA 2DRDA 4I69A 1NJYA 3UDCA 4HTJA 3CMES 1Q5YA 4Y6IA 1P8GA 2XYGB 3KLGB 4CNYA 4XTTA 5A2QY 3MAAA 1WEXA 5ETTA 1U8WA 3CDWA 2YKQA 2LFVA 1UVJA 3Q8RB 1T94A 2PA3A 2V68A 4MIWA 2BVZA 2IIHA 5IWAJ 4K4ZA 1YHQS 1YBAA 4G1QB 1HYSB 2YWFA 3FC9A 3I5CA 2A2CA 4NYPA 1PC5A 4M63A 1XJWB 3O1LA 5LOQA 2WK4A 1RSCA 4GVBA 4AL6A 1HR0F 3JTPA 4Q0BB 2QTWA 5J2PA 5E2QA 1WHYA 2QRRA 1UMJA 3EPIA 2OD4A 1VQNS 3EE3A 2CJXB 2DGQA 2P5VA 5JVHQ 3M2RB 2KZZA 1RI7A 2J8SA 2IVMA 5ETPA 3SCKE 2BZ2A 5KFHA 2DR7A 4F4AA 4LIRA 3ZZPA 4WE1A 3DOKA 2GAGC 4X4TA 2F4VF 4KHPJ 3D9BA 1GTEA 3CD6S 3DC2A 4PQAA 3JSBA 4ICLB 4LFCF 3PO4A 4DLEA 3GFZA 4NXNJ 3A13A 3H5UA 4BCAA 3KK2B 1GXLA 2V8DA 1GAOA 2Z56B 1ZZNA 1CULA 2VASA 4WTYA 1X5OA 1HBNB 5AXNA 3HPOA 3PIOQ 3CXCR 4OYPA 2X1AA 3L7OA 7FDRA 5MAOA 1UEUA 1OIAA 1R8BA 2XY6A 3NGKA 5DGAA 1N5QA 2W4DA 3H2UB 1NJIT 2P6TA 3IFEA 1FK9A 5D4OA 1DTTB 3BB5A 2ZM6J 2MQMA 1I1GA 3KUEA 3NL0A 2DY1A 3MI7X 2FJEB 3MM7B 1REGX 1N6QA 2V2VA 1T7PA 2CZ4A 2JRSA 3DN9A 3KHHA 2CNOB 1U1OA 3J80Y 2ASJA 1HNZF 4OI3A 2CQ4A 4I2QA 2IA6A 1UVIA 3RRHA 5A8KB 1XMQF 9ATCB 3BJYA 1VQPS 3QRPA 2FYXA 1HD0A 2OSRA 4N77A 2XMJA 2HS0A 4ZCKA 3UD5A 1VRTA 4NWBA 3V6DA 2M7SA 4CO0A 3BN7A 4KPCA 2HHHF 2KB2A 1RT3A 2XSJB 2CPXA 1SJQA 2K3KA 4DV2J 4KB7A 1X4DA 1R27B 1IVZA 3UDLA 3AXMA 1AT1B 1TMMA 4YS2A 1S0VA 2DGOA 5A8RA 2YNGA 4Y34A 1X4AA 1PILA 1FFGB 2NYHA 3C8YA 2WVFA 3JQKA 4DX5A 5KFSA 2W9CA 2DY9A 3UDVA 3H25A 3ZTPA 2DHXA 3MFHA 3HCXA 2K2PA 4PXEA 1VQ6S 2QLWA 1IKXB 1TV6B 4UY85 2CPEA 2YWEA 3TAMA 2XQCA 1X4FA 2VICA 5E3PA 2RVJA 2HHWA 4DR2F 2YPZA 3B8HA 1WI8A 2CWXA 3NEKA 1HPZB 4HDGA 5HAOA 1HL6A 3OXFA 2HHQA 1IQTA 4J5OA 2KO1A 4WWSA 2H54B 4MH8A 2R2UA 2AGPA 3W7BA 2IC3B 2GV1A 2BYCA 2HHXA 2ZDOA 1KHVA 3S8SA 4FYVB 4OHXA 4KO0B 3BQ1A 2ILYA 4RW4B 2ZKUA 4B9SA 4HH1A 2YX1A 1WHWA 1WC3A 5ETLA 2Y1RI 1C2PA 4F25A 2G2ZA 4ERDA 4R0JA 3W62A 3O8WA 1KP6A 3JSYA 2ZHBA 1JLAA 2F4FA 3DRPB 1BC6A 2C3MA 3KLVA 1S57A 1L3SA 2HK2A 5D6GA 4ECQA 4PQUA 3UVJB 1EKSA 2R7WA 4IQXA 2LLZA 3GZ7A 2JHEA 4H4KC 3GR1A 4KR0B 2XS7A 1S97A 1VQSA 3HVTA 3FMBA 4QBUA 2BBEA 5F0UA 4ZVSB 5J2NA 3FRZA 3M05A 3NP5A 3F44A 2A1BA 3E3XA 1SL1A 3U1NA 1MWQA 2QLJB 2I9SA 1TL5A 5JJBA 4O0IA 2W2PP 5KFIA 1YJ9S 1FJEB 4UQTA 3H4DA 4DL7A 4Q43A 2V6AA 4DPWA 2DCUB 2BE7D 1EIYB 2A18A 2BQUA 3HMJG 3FBBA 3RR7A 1RE1B 1SCJB 1RTHB 3MM8A 1IUJA 4B9TA 2G0IA 1A7GE 3WX4A 2LCWA 4M5DB 3RJMB 1TL3B 3R5DA 2F1FA 4RR5A 1IR1A 2ERRA 1FKPA 2V69A 3VAIA 1T02A 2B9XA 4A8FA 1RJJA 4A8SA 4G1QA 3PW2A 4MK7A 2BA9A 1HYSA 5IT4A 4X65J 1YJRA 2Z0GA 4DR1F 5H9FK 5K9FA 3HSZA 2RS2A 2JZ5A 2IFXA 1A9NB 1IBCB 2EK1A 3IWNC 2VG7B 2VJUA 1N52B 5KFDA 2OLWA 1UL3A 1N36F 1UKUA 2VOPA 2V9KA 2M4MA 3M2RA 3CO0P 4KH0B 2Y3YA 3SDEB 1LFWA 3K8VA 2FVRA 4YB1P 4M8LA 2RE1A 4ZN3A 3CCLS 3LP0A 4NPOA 1V9OA 1FRKA 2CG4A 3I0RB 4EI2A 3MD3A 4QIFA 2XY5A 2UVUA 3D6HB 3RW7A 3J7AN 3KK2A 3HHLA 3CMAS 3RGIA 2ZH3A 1JJHA 5GAHU 2ZH2A 3MCMA 4FKYA 2JFDA 1HBNA 1OMSA 2WAQD 3UDEA 2MLYA 4C0OC 5KFQA 4KHMA 1WKJA 4I7FB 4F3QA 2GNKA 4QWCA 3JSMA 2ZITA 5GAEI 4AXJA 4MAKA 3HVWA 5L38A 2WTFA 1FRHA 1DTTA 2IM1A 2VFRA 4DSLA 3AFGA 3LAKA 2DR6A 3VV2B 1FX4A 1YK9A 5IS2A 3MAHA 2Z8QA 2B8QA 3D2WA 3TQEA 3TJAA 3QMQA 5FLXY 2AJQA 2HAIA 3BBBA 4JP8A 2WONB 3THPA 3KFWX 1JXEA 1N0UA 2VV5A 2JVRA 3LTOA 4O4RA 3G4SS 3OL9A 3VGTA 3DNCA 4B3RF 4EZ9A 2KVIA 5IV3A 1AUSL 2RU9A 4NXMJ 2XSJA 4OFZA 2MKHA 2OIHA 3CC2S 3BR8A 4C8YA 2W7AA 5DO2A 2PA8D 3GPAA 3ICLA 4OHWA 3MXHP 4NRUA 3UN3A 1IKVA 4O0NA 1X4HA 4MKAA 5HMXA 1QVFR 1Z4UA 3J81Y 4USKA 4NX9A 2RDJA 2Q6BA 2DEJA 1TKTB 5E3AA 5FIIA 4WZQA 1FD2A 1IKXA 1TV6A 3FSXA 2CFXA 4CWBA 3CJ8A 3O6QA 1TUGB 3QLHB 5K5MA 2MHNA 4PXCA 2VBXA 4OZ2A 5F8MA 3CT9A 1ELOA 4JI1J 1EAYC 2HS4A 3MR6A 4USTA 1QLNA 4TYBA 1KBRA 4MYTA 4LFBF 2GS8A 1UEVA 1RADB 1JXLA 3NCRA 1N54B 4HLBA 3MUMP 4PPDA 4DR4J 4EEYA 2DNKA 4DV6F 5DRKA 2IC3A 1HNWJ 3IWLA 1T9WA 3PHTA 3OVBA 3M6UA 2CJYB 1DHMA 4KO0A 4RW4A 1TL7B 2XO6A 3AD9C 4AD6A 1GXTA 4DQPA 1JXVA 5E33A 3I5AA 2D3UA 4HACB 4RBTA 2FJVA 3IAS9 2M52A 2Y0SD 1WG4A 2R7TA 5B0FA 1T11A 1M1KT 3Q2TC 4ZVQB 2AGOA 2KDOA 2N4DA 4EO6A 2CIMA 3QAUA 2MXYA 2JFKA 3T6BA 1URRA 3DI6B 2J0SD 4IRKA 3PDNA 5D0EA 1HI1A 5LSLA 2J0XA 5L8RC 4MKYA 1B7FA 2IMOA 4DR5J 1SIWB 2AW0A 2MSTA 1CJVA 2XMKA 3UVJA 4ZVHA 2HVZA 2G13A 3V4IB 5D0GA 1BQNB 3TA1A 1F0XA 2D9OA 2R7RA 4YR0A 2E7XA 2MKCA 3RAXA 5B09A 5A6WA 4DR7J 4PPZA 3KWMA 3D1OA 2ZBRA 3MCSA 1Q8KA 2C28A 4ATNA 3G96A 3VWSA 2LVWA 2Z2MA 2CJBA 1EP4A 4OX9F 3DFEA 4DL5A 1IBKJ 1MROB 3NLCA 3HO1A 4FDFA 4JB8B 3C15B 4E2FB 4PABA 5ETRA 3R1LA 4NLRA 4CO4A 3GIJA 3QWPA 1F2HA 3BBFA 1M5PC 1IR2A 3HKWA 4IH7A 3PEJA 1RTHA 4DBQA 4DX8H 2OMOA 1S1XB 5CD4H 2L3MA 3IM8A 5D78A 4EBCA 5ETNA 5KFBA 4M5HA 3B4MA 4USUA 1ZH5A 4ZPDA 1TL3A 1Z1ZA 3A8KA 3PRVA 1BLUA 3F41A 1IXKA 2N82B 2MKYA 3CJ3A 1T9UA 1KSPA 2RD5C 2FDNA 4I6WA 1QSLA 3C46A 4C3MA 2HVEA 2RNEA 4KSEB 1RWPB 2LECA 4K2JA 5E7OB 3MEGB 3US5A 2F40A 3FBEA 5KFVA 3CDAA 2RMLA 3BZQA 1AXQA 1F6TA 1JK9B 2VG7A 3DMJB 5CXTA 2B5JB 2X1BA 2XB2D 3VAGA 2VONA 2G0CA 1FXRA 1RHJB 5L1LA 2GVDB 1SV5B 3L7PA 3ZTQA 1YJVA 3V81B 3DDIA 4ZCLA 3SDEA 1W2BR 1P9QC 3KG0A 2R2SA 5D0RA 1E6YB 4DUTA 2ZH8A 1WDDA 3SQGB 1HI8A 4ZHRB 1VK8A 3M7VA 3I0RA 4RNNA 2W7OA 1J5EF 2H5EA 1D09B 3EVMA 3N01A 1HNVB 3NXZA 2O1PA 3R6GB 3D6FB 1K8AT 4C0HA 2XZTB 2UVWA 4ED8A 2QMUB 4DFMA 1OS5A 1S6OA 1WOOA 4UZBA 4DS4A 3MEDB 4I7FA 2AJ4A 2NR0A 4LBHA 1C1CA 5EHHA 4OYBA 4CRJA 7AT1B 1A0OB 1J27A 1OSDA 3S01A 1SQEA 4LFAJ 4I56A 4Y2KA 2ADCA 2NYIA 3Q24A 1YDLA 4YHHJ 2EWHA 1Q16B 3DRXA 1NCLA 4OI0A 4YUDA 3RAQA 1B64A 1FFSB 1N56A 2WONA 3DLGB 1FDDA 2VZ9A 1FKAF 2OAUA 2W9AA 1F5CA 4KRWA 1DQ8A 2UUCJ 1I51B 1FI4A 1WF1A 5KG4A 2RH3A 2FJXA 2MQNA 2J9DA 1JNRB 2ZEJA 2GJIA 4ALZA 4B9NA 2O66A 1OQ6A 4OYOA 4BBYA 3OV7A 1NHUA 3BDPA 1Q8BA 5DG8A 4QWEA 4TVAB 4HT7A 4L74A 2GW8A 1AA1B 1RAAB 2QLBB 3KK3A 4WFAQ 4O3OA 2E1RA 5C5JA 3T3FA 5HQ8A 3CSKA 2PI5A 1RT2B 4OJGA 1TKTA 4IFYA 5BYRA 2EC0A 3JYTB 3K5MA 1NJWA 2GIQA 4AFFA 3U7JA 3PW5A 2PSZA 3M1VB 1B70B 3EDRB 1WDTA 3QLHA 2RUGA 3NMAA 3TJ9A 2KFZA 1U4BA 2FPHX 2VQFJ 1QVGR 4FYXB 2RQ4A 4ED1A 4C8KA 2CQ1A 1RCOB 3HI9A 3QFHA 4FF3A 4DI6A 1NK0A 4QQBA 2RSQA 4HI2A 1T8EA 4FF1A 2IJRA 3FSYA 4A48A 1HBMB 5EGYA 3DLEB 2NUHA 4HKQA 4EZ6A 2CQGA 4Z2XA 1LV5A 5HROB 3FK4A 4F4WA 4LQ3A 4V19X 3VAFA 3PW7A 1TL7A 2R42A 5K14B 3TQ1A 1SVDA 4NMLA 4HACA 1DY3A 4UOCA 1FCAA 4IRDA 4LF8J 4JV5J 1XEZA 3KDNA 3HM9A 2WVDA 1U2FA 2EFQA 2HHUA 3PX0A 4X64J 3OL8A 4NLWA 2LQ9A 4OJ3A 4KGVB 2G2OA 2XM3A 3AAWB 2QT7A 3W9IA 3QT8A 2HZVA 1DTQA 2OEJA 3LPYA 1R6VA 2EK6A 4IO1A 4JOUA 2XS5A 5DQHA 1B0TA 4ZOSA 3GJTB 1U0HB 3IBFB 2J6SA 3KHRA 4OYWA 2BQ3A 2LA4A 1OY9A 1SUQB 1BQNA 3V4IA 4YY3J 3W5YA 3T6JA 3TYTA 2YWGA 4JI5F 3MPYA 5F8JA 1GMUA 5KFEA 2FQQB 3D0IE 3M30B 2PMWA 1F1BB 3RRKA 3ZZTA 4FYWB 2B4UA 1W2IA 3KXDA 3AHPA 3ZZOA 2BM1A 2IM0A 2C2MB 1HWUA 4FKXA 4JI4F 3ELHA 4B17A 3A3NB 4EO8A 1NK8A 4DQRA 3MM6B 1SC1B 2XLJA 4O3NA 3T41A 1S1XA 4UOGA 4QR0A 1XMQJ 2W8KA 4KQZA 2H5IB 3NS7B 4PWWA 3M9NB 1TK8A 3N6NA 3BPSP 4TY8B 5DGBA 1D3WA 3NNCA 4IFVB 5HP1B 1S12A 3MEGA 1DZ5A 2CPFA 2XSFA 5J1EB 1RWUA 4I1TA 4X62F 1PJ7A 4P73A 2BXJA 4KV8B 3DMJA 3CCMS 2BACA 3O2IA 2FGCA 2OPPB 2VQEJ 2AJ2A 1T05B 3PXGa 4ZVGA 2GVDA 1SV5A 1UP1A 2R7VA 3IBCB 1FJ7A 2VG5B 3V81A 3CCJS 2M8HA 1UVKA 4X4OA 1F5AA 2V50A 2BR0A 2ZOFA 2AHOB 3QNWB 1XR7A 3ILIA 1HHQA 1E6YA 2ASYA 2DK2A 1RU2A 4W90B 4ZHRA 3CGIA 3M2UB 1RHKB 4RWWA 4G65A 5L1JA 3BS9A 4IR1A 1HNVA 3M9OB 2V8PA 4QR2A 3I55S 3QT7A 4C7QA 3GYGA 2IMWP 4FBTA 1IBLF 1QUPA 4XDCA 1X9MA 1O51A 4CLPA 1SJ1A 4OYAA 2YVSA 4KC5A 3OLAA 3EVWA 5CYMB 3I5BA 3MEDA 4QW8A 4RW8B 1D9AA 1NMEB 2B51A 2WBRA 2HPUA 1WNEA 1NK7A 1NDKA 1VMBA 4WP9A 4X84A 2L41A 1NUEA 4DUYJ 2XMAA 2HBRB 4LUBA 1I5OB 4EFAC 3THVA 3MMJA 2R9LA 2E5LJ 4F04B 1CQNA 4O44B 2ZH4A 1NEEA 3A3OB 4C9DA 3MPWA 3DLGA 5BXIA 2UUWA 1CS4B 3I87A 2XI3A 4KJIA 2EW9A 3CJRA 4ZA1A 3MZIA 2NXEA 3R9LA 3DLKB 1W26A 4ID8A 4P2XA 1WG5A 3DLHA 3AY0A 4EU0A 2HIYA 4KTQA 3Q0AA 3UO0A 3VCDA 1WC0A 4CLWA 1UPMB 3CDEA 4BDPA 1WI6A 2OD6A 4DR6F 2HFOA 2MEWA 3DCAA 3K17A 3V4MA 1BGXT 2DGXA 2DNPA 4ZVUB 3KYLA 2FD2A 4H4MB 1CLFA 2ATLA 1RT2A 1PSDA 2CQ2A 3DOLB 3PJXA 4EUVA 1X8DA 1PYOB 3MR7A 3G6YA 3N9UC 3UNYA 1VRUB 5IWAF 2FVSA 2G1DA 3ZFVA 4J90A 1MMDA 3N0VA 5JXSA 3GV7B 1TMJA 5C2GA 2JLFA 2QA2A 2QA1A 4DCPB 3N28A 3BGOP 3QATA 3PVXA 5M2UA 2QL9B 4CO3A 4F0HA 1RTZA 2YWWA 2PEBA 2NLWA 2Y1JA 4DR1J 1LWFA 3QSYB 5E5NA 2JSXA 2AEFA 1SC6A 4OLPA 2QA4S 1HHTP 5K14A 1FJCA 1KFDA 2V8VA 2PC6A 1VLYA 4P6QA 4KHPF 3FGVA 5C24B 4PYAA 2DITA 1QJHA 3CC4S 1FHTA 4I6YA 3IR6B 3WQPA 4YR2A 3BGUA 2XGQA 3Q8QB 3PJWA 4WU2A 4NXNF 3VGVA 3AQPA 3MCOA 4QIEA 5DM6Q 1R0AB 4DMZA 1R89A 4Y00A 3B82A 2BX6A 5KFTA 2NSCA 5KFCA 3R7SB 2HFVA 4Y28C 3VTIA 1RAOA 1RT4B 1SUQA 2W24A 3A12A 2AMCB 2EBEA 4ECVA 1BMQB 3GG0A 4RNMA 1S1TB 1HKAA 2ZFHA 2CADA 4W92B 1HWKA 1VGYA 2UZAA 2ZM6F 3FUYA 3F73A 2H1YA 4GC7A 1BD6A 2B4OA 2M70A 1SJFA 2CDQA 2QLFB 2BJ3A 4DSJA 1Q78A 1LXJA 3T5HA 4DFKA 3MHYA 2PGCA 3MM5B 4FZVA 3UD3P 5LT5A 5ETSA 5CHCB 2BJEA 3VGSA 1F9FA 3MM6A 1RTJB 3LAMA 5GAEU 1XR5A 4JI6J 1TL1B 2XYPB 1H98A 2EEYA 2J5AA 1F3FA 1FERA 4RO0A 2HFSA 5ADZA 1S6QA 2DR9A 1NJZA 1PYSB 3TZZA 4DV2F 3OL6A 1IBMJ 2HQIA 5HVFA 3P96A 1NJXA 1FESA 1MU2B 4TY8A 5LXRA 1TVRB 1FF2A 5CQGA 2NUUG 4GMKA 4LBIA 4IOAQ 1FNMA 5J1EA 3J81j 3M6WA 1K9MT 4R0EA 4PCQA 3R5AA 3K89A 4KV8A 2J0QD 2XMVA 3VHQA 2LQBA 1KWMA 2OPPA 3HULA 1RHQB 3NGDA 8ATCB 3BSOA 3BKFA 2LEBA 2YNFB 1GMVA 2VG5A 3H5SA 3FDSA 4I68A 2HVIA 5L9NA 4MKBA 2BW2A 4CI0B 5CZXA 2XNRA 3W61A 3NOGA 4C3KA 2BJ8A 2RJZA 1CJUB 3M2UA 2KT2A 3C6TB 1NLKL 3PRDA 2JLGA 2EVZA 2ZJPQ 2PIIA 4ED5A 4CT9A 4DS5A 4LFBJ 3GB0A 2LXUA 1X5PA 2KG0A 1QY7A 2W2OP 4J9SA 2Z58B 2CJKA 2MYFA 2HFZA 2OPRA 2ZOMA 3CJ0A 5A0YA 2WOMB 4IH6A 2DKOB 4DPOA 3H59A 4IO9Q 1T3NA 3OPKA 2JEGA 4Y2CA 2EFPA 4WK3A 3EICA 3L9ZA 5KFWA 1ZPVA 2DNOA 2DYAA 2HEKA 1T9TA 4KIAA 1RAJA 2RF2B 3DGPA 4Y3CA 4B9VA 2XLKA 1X5SA 2AZ3A 2V34A 2YPYA 2BMBA 1YRXA 1EHWA 4I4BA 4PUOB 2R8IA 3DLKA 1YGYA 3M4XA 1JLQB 2BOAA 1SBRA 3JS9A 5KFYA 1BWVA 2YH1A 2D9PA 1FEHA 4LIWA 4TU7A 1KR4A 1Q53A 1WEYA 4NI2B 3JAMU 2FLOA 4K4UA 5F8HA 1S9GA 1U47A 2EPIA 5HJXA 1KONA 3LPEA 4LRBA 2E5HA 4H4MA 2BDPA 4LSLB 2DRBA 3AOBA 3DOLA 3CNQP 5D77A 3T1YF 4FYDA 3Q2SC 3Q8YA 1RU1A 3UCGA 1VRUA 4DQIA 2CQPA 3LW5C 2XGPA 3TEGA 3B4DA 3GU0A 2BJ7A 1R3NA 1OPIA 4B3MJ 2OUGA 5AJ3J 3NGTA 4X65F 3JXOA 3CVKA 1FA0A 4OMFG 3G6XA 1N34J 3MUVP 2BE2B 2UV8A 3MF5A 1AYEA 2WZ1A 4KGKA 3ZO7A 1U09A 3M8PA 2OTJS 1BHNA 5HO4A 2IYGA 1DLOB 1XIQA 4PXBA 4V1Ak 5C24A 2K8GA 3JQMA 5KOXA 5L46A 1DQ9A 3RBEA 2VHGA 3LWLA 3FZBA 4N5SA 4I6AA 4C8LA 3U27A 3R97A 1S6PB 5KFGA 2VDIA 3GILA 3OR2B 2VA2A 2DISA 5HQMA 2HHSA 1G7CB 1LWEB 1LW2B 1RT4A 1OWXA 3G8SA 2Q66A 3KK1B 1S49A 1S1TA 4UOHA 1KVKA 1Y11A 4ZK7M 2IYIA 2WSCC 2AQ4A 3DLLQ 1IWAA 2I8EA 2UU9F 2Q6CA 3CCTA 3W65A 1MNEA 2DIUA 1RAGB 1UW4A 4R5PA 3FBFA 2JOQA 3QRRA 2CQBA 2HQ3A 2DPJA 3Q8VA 1KHWA 2C3UA 4FS1A 2GJFA 3Q89A 3EVOA 5BYSA 1MN7A 3RAMA 2V67A 2DHAA 2MZQA 4JV0A 2FZGB 4B3SJ 3HZGA 3M6VA 5DDRC 3M8RA 4F0MA 4ENOA 4DL6A 1TL1A 1DQAA 5EN1A 2GHWA 2B43A 4IOCQ 3V5RA 3RR8A 3AA8A 4LRFA 4IDKB 4DLGA 5IOLA 4P72A 4RUBA 2CZVC 4J9PA 1U1PA 5J1PA 3FJ2A 1UZHA 3W5ZA 4C8MA 3QT6A 4PXDA 4U7CA 3M2VA 2GC8A 2YNIB 2POKA 1YI2S 2JX2A 4DN0A 5B08A 3KDOA 1XNRJ 1VQ8S 4R8UA 1KVJA 3MTKA 2BJ1A 2KG1A 3MWBA 1HWLA 4A8YA 1Q8LA 2AEMA 3OJUA 2YNFA 4JYAJ 1WTBA 3P4UB 2O3DA 5FLXU 4NZ6A 4KPYA 3MGJA 3CD5A 5IM0A 3VGUA 2RQMA 1SL2A 4U96A 1NNDA 3C19A 4Y65A 2KXFA 3PKMA 3EJMA 4QR1A 3V6JA 3C6TA 2R8JA 2AYMA 3M8QB 2L08A 3CB4A 1HW9A 4LF2A 2H3EB 2GVZA 4DL2A 4C0BA 4B3OB 4I0WA 4Q8EA 5B0DA 2ZE2A 3GIIA 1GMWD 4J9MA 3KJFB 3MMBA 1FE4A 4CLZA 3CD7A 3TZYA 2VG6B 2ABYA 3CJKB 2JEIA 2JC0A 1DFDA 4Q2LA 5BR8J 1SI9A 2YKAA 4L3KA 2M5YA 3QO9B 3ZTSA 5B0CA 1ZPWX 2WOMA 5KFOA 3J81U 3W63A 2N3OA 2VF3A 4BLGA 3BSCA 5KFAA 4DV4F 2QSFA 5C42B 2FLPA 1XMOF 1VQ4S 1KEKA 3AODA 1VBYA 1WKKA 4DR5F 4RPFA 2IBKA 1R8PA 3EM1A 5CABA 2RF2A 1WWHA 2DNQA 3M6XA 3NG8A 1IWGA 4DR7F 1UEKA 3M8YA 4PUOA 2FUG9 3HFVA 1JLBB 1JLQA 4YOEA 2EI5A 2YTCA 4WTOB 2GA7A 1SC4B 1DBDA 2BM0A 4F2SA 5KG6A 1S7IA 4ELTA 3E2EA 1IBKF 3DM2B 3HDSA 4NI2A 1RHRB 5CCLA 1VQMS 1YRUA 1H0HB 3ILJA 5SUHA 3TZXA 3QGGA 4F0KA 4WYLA 1ZA1B 3A8JA 2NZCA 2FIUA 4CH1A 1VDHA 4LSLA 1FJGJ 4N8OA 4JI4J 4D3GA 2NS1B 3J7Z5 2UVRA 4MK8A 4H4KA 5KG5A 4ELVA 1H2VZ 4DHVA 2MHEA 4QU7A 4DV5J 1K73T 4USHA 4ZITA 3QZ8A 2MKSA 4YR3A 1IN0A 2KRBA 4UUXA 3EMTA 4NYZA 5HQLA 5HMYA 2QC3A 3BO2A 2R7QA 3EXCX 5J2MB 3WIUA 2VPXB 1VQ9S 4LF6F 4OZNA 3PM9A 1X0FA 3R2CJ 3BGRB 2CPHA 1FNXH 4NCGB 3DYAB 3CIZA 1SIZA 2VBYA 2GHVC 2UXBJ 3C16B 2CPDA 1RABB 1RUSA 4FNHA 1DLOA 4WPAA 3D68A 1N0VC 1ZM4A 2LQ8A 2ZC4A 1B0VA 4KKOB 4RUCA 1RKJA 3QIDA 1QDUB 4WCEQ 3DRRA 4K2XA 2V2ZA 1NK9A 3OR2A 1ZZFA 2CQDA 4RJVA 1H7XA 3GJQB 2PMZD 2ZKTA 2PT0A 4USIA 1JKHB 5I3PA 1LW2A 4RU2A 5GMKa 1G2EA 4QU6A 1HNXJ 3KK1A 3MDFA 3VALA 1RACB 2H48B 3SIPB 1IJEB 5DZ6A 2XWYA 3EUNA 5KFJA 3R27A 3CCVS 4Q7AA 1PJ6A 2GFFA 1Q0NA 4LFAF 5F3TA 3OHAA 2DGTA 4DPYA 2UVVA 4UF4A 1GK8A 3I96A 3O5TB 4ES3A 5EWFA 3AA9A 2CWKA 4U6PA 4ID5B 2OELA 4GKJJ 4L76A 3EYZA 4LF1A 1C1BB 2HQGA 1DJ0A 3SQOP 5C25B 5EWGA 4ZVFA 2R8HA 2BV3A 3EDQB 4RBUA 2KH9A 5GADI 3JTNA 4IDKA 2GMHA 1V3RA 4DSIA 2EFNA 5E3RA 2J9EA 4DWIA 3PJ9A 1RHMB 2GIRA 3W60A 3FSIA 4XDDA 4A8XA 3BPDA 1KLNA 3D5MA 1JLEB 4K5RA 2RUSA 1NAQA 3M8WA 4P2FA 3DHXA 5I42B 2LU2A 2YNIA 1ITPA 4Z37A 1XWLA 5D4NA 3HT3A 3T9NA 2HHTA 4ECTA 3OVSA 1M90T 2HVHA 4U8YA 4EYHB 3W3SA 3HSJA 5I4MA 1Y00A 1M5KC 4ILLA 4WIQA 3TARA 2BKPA 3N6LA 3G2XA 1RYRA 3RW6A 1T9YA 1Q79A 3LO3A 2NXUA 4WFXA 2FHKA 2HK3A 1FWPA 2VQFF 4OYXA 3JSRA 2RRNA 1Z2ZA 3BH6B 2VFUA 4M5JA 3PY8A 1YBUA 3CPWR 2Y1IA 1U6ZA 2KFNA 4B3OA 5KFXA 5DZ7A 2QSWA 4ED3A 3AB4B 1LWCB 2ILZA 3M8ZA 2GZOA 4DN9A 3EGNA 1NHKL 2E5JA 2V63A 3CJKA 3LP2A 2MB0B 1J5OB 2DNMA 3AOCA 4CM0A 4LF8F 4JV5F 1YZ6A 2WBMA 2DNZA 2ZH1A 1RBOB 4P2SA 4XAKA 3TZWA 1FTCA 4X64F 4NLPA 4WFYA 3O44A 5K8NA 2B9EA 3RRGA 4DF4A 4ECUA 5C42A 2OGUA 2DXFA 4Q45A 2YH0A 3LA0A 3SFGA 4WFBQ 4EBDA 1S7HA 4GO5X 1S1VB 1U24A 4I67A 2KXHA 1F60B 1U1LA 1FRMA 1E6VB 2RIJA 2XZDB 1NK4A 5GAGI 4P2MA 4YY3F 5GMDA 5AXLA 3I31A 1S1WA 1X4BA 1I3OB 4UY8T 1M5VC 3LANA 5HBMB 4C97A 1JLBA 2G1HA 3D1QA 3G8TA 5M2PA 4L3NA 4WFZA 3ITHB 4DV0F 2EBGA 4E98A 1XN9A 1UFKA 3PX4A 4X4RA 2QZ8A 2IA0A 3W9HA 3DM2A 2C22A 2OO4A 4EYIB 1JMTA 1Y7PA 2J0WA 5CYQA 4LRAA 3QRQA 5J2QB 3EGZA 1C4CA 4NEZA 2L9DA 1QAJA 2AX0A 3CCZA 3VR1A 1JLFB 4QIVA 2AF6A 3TAPA 2ZZNA 3HK2A 2LEPA 4PWDB 1VYAA 1NRKA 2XCPA 4RW9A 1TFWA 3E8OA 3VQTA 5HVGA 3R2DJ 2ATCB 3CJQA 4XK8C 3A8EA 1XC9A 3HLUA 3G6ES 4NCBA 5J2MA 2OEKA 4K4WA 1OO0B 2V4QA 2QG9B 2CQIA 1VHFA 1O5JA 2WSFC 2V2QA 1EJ7L 1P6TA 3NS5A 2VQEF 2MKJA 1C0TB 3IM9A 2FVQA 3DYAA 4OHZA 4OI2A 4WYWA 2QMWA 3E51A 3HX9A 4OX8A 3D67A 4ED4A 1P9YA 3OSNA 4CDIA 3BO4A 4YB5A 1TKZB 4K8RA 3NMRA 1R0CB 3SSSA 2HNDB 2E66A 3D3CJ 3QPIA 4KKOA 3TW0A 2K7JA 1UJ4A 1WC5A 2DO4A 4C11A 2DNRA 3H8YA 1RDRA 3GR0A 4K4VA 4WXWA 3KTQA 1B99A 4U67Q 4DZ6A 2L48A 1VR6A 4NLOA 1Q7YT 1RA7A 4NA1A 4X2BA 2MZRA 1RK8A 1FTRA 4CH0S 2AD9A 3ZXWA 2GO9A 2QGFB 4DUYF 1B3TA 4G3IA 2AJ0A 4LT6A 2C2DA 1Q1KA 4AL5A 2E5LF 3LH2S 4ID5A 2MZSA 3MUTP 5AE3A 3GSDA 2DCLA 1C1BA 5IXUA 4QZVB 4KGXB 4X4PA 1KTVA 2ZD1B 5KFNA 2B0GA 4ZIWA 2HMIB 4FXWA 1WC4A 3L3CA 3FEYB 4ECRA 4IQMA 4DV7J 3UFCX 2F5GA 3K57A 2GO8A 4LQ9A 4PEOA 2ZBPA 5KTQA 4LR7A 4DU8A 2OPQB 1N33J 4M5LA 2J6TA 3FVYA 3UD4P 1CQMA 1L3TA 3BBCA 1S9EB 1UTAA 1YJ7A 2RQKA 4JI8J 2UXDF 4NZ7A 3QAEA 1GT8A 1X4EA 2QIFA 1KQKA 1YIJS 5JMNA 3HHEA 5AXMA 2R7UA 4LF4J 3K5PA 4DUZJ 4IH5A 4LF9J 1XMBA 3OXLA 3WHIA 2I5JB 5DJBA 1BUXA 2FY1A 1MWZA 4NA3A 4BWJA 2N4CA 5EDWA 3KLGA 3UR3C 3T1YJ 4ECYA 1RA6A 2D3O1 4LR9A 3MMCB 4PRFA 4RW7B 3KUGA 3BR9A 1PGZA 2KJWA 3IS9B 4RWXA 2KL8A 1W7WA 1HBUB 3WDOA 3PTWA 4E8UA 3OLBA 1KKHA 4DEZA 2QLXA 4Q0BA 3MECB 1HA1A 3QGIA 2JWNA 4ZJQA 4NLSA 4CQ1A 2OPSB 1D8ZA 3N5BA 3B6BA 2HNZB 5AE1A 2X1GA 4Y0FA 1QE1B 2FVCA 5MLCV 4W4MA 1W25A 5KG2A 3CCUS 1TR0A 1S1VA 2M0GB 1D0EA 4HVZA 5I3UB 1JQGA 2JEJA 4BC9A 1E6VA 4ICLA 1TAUA 1HBOB 3GYXB 4U95A 2R7SA 2NCKL 3IXQA 2AP6A 4FPIA 2B8PA 2IAJB 2KN4A 3HHNB 4L72B 2V0NA 5HMZA 4V19J 4M5IA 4AE5A 4A8WA 2QN6B 3M32B 1WSRA 2JDJA 4HTIA 4F4KA 1HW8A 2VH7A 3SV3A 2KTQA 3I4HX 2CDRB 4ETZA 2E5GA 1YRTA 3R1HA 1YVFA 4WF9Q 3NGSA 3G82B 2UU9J 4AQYJ 4WJBA 2Z30B 1RAHB 5J2QA 4F2RA 2HS3A 3MM7A 4N8NA 4JI6F 5DDQC 4C48A 5RUBA 4FN5A 5D15A 2DEIA 3BKUA 1JLFA 1PKUA 5A8KA 4ANCA 4U9RA 4OLOA 2XMMA 4N76A 1NPRA 2HQFA 4PWDA 2L9WA 1IBMF 3A1YG 4TQRA 3DDNA 1CJTB 3MAAB 1TKXB 1VK3A 3ONQA 4K4YA 1S76D 1MW7A 1D8YA 1JB0C 4FF4A 2VODA 2HBQB 2XHCA 3PCOB 1PYTA 3DLBA 3KMSA 2GHPA 1HWIA 4FVCA 4P52A 2C2OB 3TA0A 1P27B 5AE2A 2P9GA 1S99A 5EX0A 4FP9A 1SKUB 1WSVA 2HURA 4C8NA 3SSRA 2FJDB 2PN6A 4OL8A 3NGRA 3NCQA 2HNDA 4LJMA 4CZCA 2CXEA 6FD1A 1L5UA 3FQLA 4URGA 4NA2A 3HD2A 2XS2A 2YKNB 4YQWA 1D9DA 3IR7B 4CLYA 4DQSA 2UXCF 4JI7F 2E7WA 1KN6A 3NGUA 1UW9A 1TFYA 2MPUA 3RBZA 1PG5B 2D3OR 2W2QP 6FDRA 2R8GA 1HPZA 3OW2R 2J7WA 2XO7A 2UP1A 4C4WA 4U8VA 3A3PB 5DLFA 3ZZZA 4ED6A 2C3PA 2V8GA 4LREA 4KBIA 1N32J 2J7KA 1RT1B 3SZ2A 2PO4A 4KGZB 4WP8A 3SBMA 1EKRA 3CW2C 5I3QA 1ZM3A 1PO6A 2HQDA 5IT9Y 4P7VA 3FEZA 5CAAA 4Y2AA 3HT0A 2IRXA 2UUAF 3RYLA 2ZD1A 1OY8A 1SXLA 4DV4J 3DRPA 1XMOJ 3IRXB 1R8AA 3U1LA 3CJTA 3CMQA 3VF0B 1CEZA 2GQCA 4D3HA 5DM7Q 1GTHA 4USMA 2DNGA 4NLDA 3DRSB 2MQOA 3GJRB 1I94J 3OVAA 4NE9C 4RW6B 1GEHA 1VS3A 4YB6A 3FCHA 3L4BC 2OPQA 4PG6A 1YBTA 1WTFA 3PYEA 4IUFA 2VFSA 1VRTB 1Y0HA 2EKNA 1VBXA 3V6DB 4OZ1A 4ILMA 2RDDA 4FXVA 3PFEA 1S9EA 3PYGA 1RT3B 2RRBA 1RTDB 2WB1D 4C98A 2AJFE 3H2LA 3TJ8A 1UJ5A 3EWGA 1V3ZA 3BGFA 3DXSX 5A8RB 2G0JA 2MJUA 1T9XA 3P5TL 2GMJA 3I32A 1UJ6A 2QYCA 2IM2A 1AFIA 3VAKA 2V5HG 2G4BA 4YN3B 2MKKA 2D7SA 4Q44A 1SPBP 3ZTRA 3OJSA 2QFJA 4B3MF 3IRWP 1HWJA 2KT5A 2ZNYA 5AJ3F 2J8AA 1WC1A 2IVFB 3FNNA 4M5DA 3TUPA 2HWIA 4YDXA 1T95A 1ZM9A 3MMCA 5HJYA 3D66A 3PO5A 5B0AA 1VFJA 1FDAA 1N34F 4QIGA 5G0RB 1WG1A 2Y8WA 3NBPB 4X4QA 4NASA 3WIVA 3QJLA 4LF6J 1UWBB 2ZBQA 1U26A 4QIWD 2F65A 1DRZA 1X60A 3MECA 2ZOGA 2H4YB 5KFPA 4ZPVR 2MKIA 2OPSA 4J9QA 3VQSA 2MSSA 3UN2A 1EARA 3A8IA 1Y9OA 4DPXA 2MQQA 1QE1A 1JIHA 4DDFA 1S59A 1CBKA 1PBUA 2D1CA 1PC4A 1VJWA 3UN5A 1QTMA 5I3UA 1RWNB 3VVTA 1H2UX 4CCHA 2QV6A 2HFNA 2Z57B 4O3RA 2I1RA 1X9WA 1GNKA 2IAJA 2PEHA 3OFFA 3CDUA 3GV5B 2U1AA 4PQUB 1N5SA 1KQGB 2YWHA 2RU3A 4O3PA 1C0UB 4WKYA 3M32A 1PIEA 4FS2A 5FJ4A 2J7UA 4Z7CA 4ZMMA 3ENVA 1VC0A 1FRIA 2JC1A 4ZS6A 1KOHA 1GH8A 4YEAA 1U2CA 4J9RA 3OUYB 1S6UA 3G82A 3K5OA 5J2NB 4B3SF 5KG0A 2YNHB 1FXDA 2XMWA 4JI0F 1RWKB 4CO1A 1SB6A 1WOPA 1Y5IB 5IQQA 1NDCA 3KLIB 2HQCA 2V2KA 4YFUA 1PAEX 4URSA 1YLXA 2KJVA 3MURP 2JJ4D 4JI3F 2B3TB 3ETMA 4ECWA 1Q86T 2V9WA 4UW2A 3MM8B 1FX2A 3PIPQ 1CJTA 3GTYX 2KKHA 2UUBJ 4PYDA 3MAQA 1TKXA 2BANB 3LWMA 2H4WB 2YX4A 2I2YA 4DL0C 1YX2A 3W1YC 2VPZB 3IN5A 1XNRF 5CZVA 1FKPB 1RWMB 1S10A 3TANA 5EWEA 4WXOA 2VD3A 5GADU 4A8OA 1CG2A 1SJRA 3OTEA 2COLA 3GIMA 5KG3A 4JYAF 2CNLB 2WVBA 2JVOA 4ZDNA 5DDOC 1NZAA 3G6VA 1S1UB 1RTIB 3IGNA 2VKZG 4DOZA 3LGHA 3N5FA 1MN9A 1UVLA 1LEOA 3W8GA 2IY5B 5LSOA 4DFJA 3AB2B 2IDEA 2PFFB 4OZ3A 2B9YA 2BUNA 3U02A 2YKNA 1CSJA 3CC7S 1P1TA 8AT1B 1HNIB 4AYBD 3ENAA 1FDBA 1OJ4A 1RBLA 3LP0B 3ISZA 3RB4A 4MFBB 2M3DA 3P45B 3UQSA 5B0BA 1CC8A 2PI4A 3KNGA 4CH7A 1NSPA 3HHLB 1GFWB 1FXLA 5BR8F 4FXDA 2LMIA 4KH1B 5B0GA 3HJVA 4K4XA 4IG3B 3LGNA 5BJRA 4K50A 1RT1A 1ZAXA 2GX8A 3K59A 1WF2A 4TQSA 1M5SA 3G9CA 3JSMB 3H7HB 3TVZA 3X3UA 1N4LA 5ETVA 4TXSA 4ZVEA 2DR5A 3SXLA 2FC8A 1BE4A 2F8EX 2Q79A 1Q8IA 3KG4A 3PKYA 1Y4ZB 4NOHA 2IBOA 1QUVA 1WD6A 3DI6A 2AT1B 2E44A 3IRXA 4OX7A 4X66J 5HANA 5A76A 3OTCA 3DRSA 2WCXA 3ETOA 2P2CB 4RW6A 4F4XA 4U7UD 1X31C 2IRYA 3ADAC 3PFOA 3TVKA 4ECXA 3ZNUA 2M8DB 2HGMA 2YX7A 2BJ9A 2HSEB 1UA0A 3H98A 2VBZA 4KYZA 5GAGU 1RTDA 3MD1A 4DV0J 2I6WA 4DR3F 2HAFA 3W2VB 4L6V3 4ZLJA 1GQEA 2ASDA 2HLTA 3HZEA 2KU7A 1FJGF 1MROA 2YQ1A 3M9MB 3C15A 1VQKS 1IKVB 1S5ZA 2E9TA 2WW8A 5IFMA 1IJFB 4DV5F 2XMUA 3WX8A 1DURA 3PYDA 1Q81T 1SJ3P 4IKAA 9RUBA 2KT3A 3EGVA 1PCAA 5JVGQ 4EGLA 2QO3A 3UNGC 4MIAA 3FBCA 1O0PA 5G0RA 2GGPB 3NBPA 3RB0A 1LQ9A 1PBAA 2WVCA 3X1LB 4K0KJ 3GONA 2UXBF 3AJ2A 4RNFA 3SV4A 2CQHA 3IMQJ 1UWBA 4OZLA 3CJ5A 1YSJA 2B5JA 3KHGA 2CPIA 3HFZB 2RDIA 2R3VA 4GVLA 4JUZA 5DETA 3JAMY 5HN0A 2IDLA 2MLXA 5FD1A 2XCAA 2WHOA 1LFPA 1YWXA 3MR2A 1EX8A 3SQGA 2IRUA 5DDPC 4ELUA 4USJC 3DGVA 1M1GA 2ZH6A 1HNXF 2QYGA 3UWTA 2CQ3A 5LMNJ 3PR5B 4R25A 2BEFA 1SJ4P 1CJVB 2VU5A 4LBPA 1C0UA 1X7VA 4F3OA 4MYUA 4KHRA 1LOUA 4NLYA 2DNNA 4GKJF 2ZBIA 1U1MA 4HT5A 4UZCA 3K2YA 3OUYA 2OH2A 3CCES 3OQ2A 1U02A 4DU7A 1APSA 2DR8A 1EP4B 1EZZB 2YNHA 4MMOA 1MLAA 2YKOA 2DD8S 1UA1A 4F4ZA 4ZKAA 3KLIA 5D8HB 3K58A 2H65B 2XG8A 3IGVA 4U7UK 1QSSA 3C6UB 3D7SB 4HR2A 3HD1A 2OP5A 2AEJA 5LJ3Y 1RLCL 3DU6A 1YZ7A 4NL5A 4TLRA 1Q4RA 2AZ1A 2BANA 1YJNS 4NLQA 3QT5A 3T19A 2V4JB 1LNQA 1RWOB 4HHHA 1NK6A 1OQ3A 4GC6A 1AB8A 4OI4A 2B7CB 4LF5J 1MG7A 2CPYA 4OI6A 1VISA 1VQLS 3M8SA 1G1XA 2B7BB 2UXDJ 2XLIA 1ZAVA 4ZPAA 2P6SA 3HHDA 2ZUAA 3P6YC 1S1UA 1TAQA 1RTIA 1KRPA 1Z2LA 1D9FA 4ZP8A 3ZZUA 2N7YA 3JYTA 3EGWB 1SKRA 3D4JA 4RBVA 4G1PA 3HHLD 1XK8A 1RB0A 3WZ0A 2F7VA 4LF7F 4DV1J 3M1VA 1N8RT 1JJ4A 8RUCA 1HNIA 3GP9A 5D0HA 2ZC3A 4KE5A 5B7WA 3SEOA 3NWGA 1YITS 3HSGA 4QWDA 2LEAA 3RU0A 4OHVA 4MFBA 3F56A 2P9EA 4PWUA 1WELA 2KHCA 2VC1A 3MOJB 2VUGA 2FHJD 4ZJOA 3G71S 1HBMA 6AT1B 2HGLA 3DLEA 3RTVA 4IG3A 1VI7A 4ZVRB 3J7A1 3TVYA 5HROA 3MEEB 5KFRA 3L09A 1C1CB 3OR1B 1XR6A 3DLJA 2R7XA 3GIRA 3MOZA 3PZPA 1JJ2R 2DH8A 3PYFA 4TN2A 3AH6A 5F9NA 2AWZA 3HVAA 2LU1A 4N56A 2FHJA 3UR0A 3OTOJ 2LXFA 1H6KX 2P8IA 3EPGA 1KD1T 1NB7A 5AXKA 5KT2A 4OQJA 4QYZJ 5A2QU 5F9LA 2HRTA 2FGOA 5EX3A 1RHUB 2EG1A 4O4GB 4UQGA 4I2PB 2RHQB 3NOCA 1U0HA 2D69A 4WK1A 2A3JA 4DFPA 2OJ3A 2O5DA 1O6XA 1KNZA 3V2UC 4DV3F 1ZAWA 1XNQF 3IA0A 3SMZA 2MQLA 3R7NB 1S0NA 2ZJRQ 1R0BG 3M30A 4MKVA 3N6MA 1NKEA 3W2VA 2E7VA 2V8HA 2CUYA 3GFHA 1L3VA 2OEMA 5HI7A 3NWRA 2IJFA 3TAQA 3CJ2A 3MPDA 1ZM2A 3KK3B 2GQ2A 2I38A 2PFDA 2W2MP 3W2WB 1RAIB 3I4PA 2HWHA 1KLMB 1DAXA 2K7KA 4IFYB 1FT8A 4JV1A 2B6AB 2W7PA 1QM9A 3GLJA 3V6HA 2AYGA 2RT3A 1V3SA 2AX1A 3VZHA 5CD4A 2C1EB 1B0PA 4QPTA 2XBPA 3IG1B 3IAM9 3NCPA 4QYRA 1WUUA 3S1TA 3THTA 1S4EA 4UT4A 4GKKJ 1YTYA 2GGPA 2HNYB 3MMAB 4QW9A 5LMUF 4IFVA 4PG8A 3LQVA 3IO1A 5HP1A 3AQOA 3ZZRA 4ZN1A 4XPCA 3VZIA 3JQJA 1JX4A 4F7VA 4A8MP 2G2YA 2Y9HA 1IKYB 2HW3A 2AYBA 2V4RA 4OI1A 3KJQB 1T05A 1J2VA 4MJKA 4USVA 5A8WB 4DX7A 5IV4A 3ZC4A 3J80U 3QYYA 1FVSA 3FKBA 4M5KA 4K4SA 1X4CA 4ZLNA 1Y10A 3G8QA 4ES2A 3I6PA 2AGQA 3GE9A 1U25A 5HMWA 4OYIA 1DTQB 2UXCJ 4JI7J 3VAJA 1K47A 2DXEA 4MT1A 3K8WA 1OYDA 2DPIA 1SL0A 1D1UA 2WRMA 5CYMA 2ZZMA 1M0SA 4NLGA 4RW8A 4Y2MA 4PG4A 3I9ZA 1X5TA 3QJPA 3WC2A 3IR5B 1V5VA 5LJ5Y 1HMVB 2CYYA 4K5SA 3W5XA 2GQQA 4B02A 2XC9A 2Q3PA 4DV7F 1R8CA 4O44A 3D6MB 4QWAA 2YWKA 2XWXA 4RNOA 2A10A 4G1IA 1SQFA 3BSNA 2UUAJ 1RYSA 1N33F 1CS4A 3L95X 1GX6A 3HKZD 3C6UA 4Q8FA 4AL7A 2X3DA 2RHSB 3JTOA 3DOMB 3PACA 1FE0A 3HJFA 2DH7A 2XEXA 4JI8F 3GV8B 3VVUA 3TI0A 2V4JA 1VQOS 2FHOB 3R5JB 4H4OB 4ANEA 3OXGA 1U1NA 4ETXA 1HQUB 4LF4F 1CPZA 1EQMA 4DUZF 4CP5A 2QE5A 4LF9F 2W4PA 2ADBA 3P5BP 2RRAA 4CLLA 1U45A 3OTDA 4WKRA 3ET6B 3OTBA 3TX8A 1HARA 2ALYB 3CF5Q 4BC7A 2OHDA 3T1HF 1AUDA 3R3TA 1UFLA 4F8RA 1KOOA 2PDAA 2MZ1A 3CO9A 2YY3A 3ZZ0A 5LSRA 2K06A 5ETMA 1JNZB 1FWLA 4S0MA 4B9UA 4JI2J 3GCWP 1SH2A 4J7CA 4XO0A 4DCOB 5B0EA 3D6TB 1BY9A 2DGVA 4XIUA 1SH0A 3KMQA 1VQ7S 2IHR1 2DHGA 2NXJA 2HBZB 2C2KB 2R7OA 5KT3A 3EZOA 2DO0A 1N5YB 2DT9A 3RBXA 2VFVA 3OD2A 4ZVPB 2QL7B 5HATA 3MEEA 2MY7A 3OR1A 2F8HA 2W9BB 3CTRA 3H0PA 3CJSA 3LOUA 4TLQA 3TO8A 4CLSA 5F8GA 3CULA 1U48A 4B08A 1U0SA 2NPFA 5KFMA 2AKWB 1NH7A 2IPOB 4B3TJ 3DHWC 4A4JA 2FLNA 2EKYA 2NPIA 5DG7A 2BOPA 3D28A 1R0AA 4O4GA 1KDNA 1TTHB 4I2PA 4ZCMA 1TK5A 5KFFA 1VQ5S 4DXLA 1MWYA 1YG0A 7FD1A 4N47A 4K7QA 1FD8A 2GMLA 4YMEA 1EQ0A 3AJ1A 2AU0A 3W8PA 2C2RA 3H42A 4X4NA 2B9WA 1JLGB 3VAHA 3H5XA 4AQYF 5KOWA 1U8SA 4AUKA 2DB1A 3MM5A 1T0TV 3Q23A 1RTJA 3OFGA 2CQCA 3W2WA 3DDKA 2KI2A 3CJ4A 4OV6A 5F3ZA 1NKCA 2AIRB 1KLMA 4IG0B 4JI0J 1M5HA 3H2VE 4HHJA 4DSEA 3CWJA 2B6AA 3MPUB 3R5CA 4ZVOB 2HZAA 4CM2A 3H20A 4CLFA 4JI3J 3IG1A 3D54A 4RUAA 3FCWA 4CLUA 4OYMA 1FVQA 5ETQA 2C42A 1MU2A 3ENQA 2HNYA 3MMAA 3KLHB 1TVRA 1T3OA 5KT6A 3KNAA 3B78A 1WHVA 2JH3A 1IKYA 1V6HA 4ED2A 3RB3A 1NXIA 3HHLC 4UTGA 1LWFB 1A6LA 3LP1B 2D74B 3BSAA 5A8WA 2CZ9A 4IYQA 4N41A 2E1MC 2NXCA 3CD0A 4JV2A 4PG7A 5H1SV 1HR0J 3QFWA 3NNAA 1Q5VA 2W25A 5T14A 3GFYA 4O3SA 1BXNA 4EWTA 3H4BA 1RWWB 2FZCB 4CT8A 4J9UE 5KT7A 2KFYA 2J9CA 1CJUA 1L3KA 3OFHA 4RZRA 3GIKA 4ZPWR 2ZVSA 4OV1A 4ED7A 1BQXA 1U2RA 3J7ZT 1VOMA 2LYVA 4M1KA 5K8MA 4YB7A 3IBWA 2F4VJ 1OYEA 1YJUA 1HQ2A 1RWVB 3GJSB 2NREA 3QJJA 1SH3A 1LW0B 4LFCJ 2B56A 1N32F 3J7YI 2VIHA 3BH7B 1U49A 1V5IB 1NDLA 4ED0A 3I9V9 1MMLA 2YQ0A 4ES1A 1HMVA 3C14B 5J1NA 3D1HA 4HH0A 1GMWA 2WSEC 2A6MA 2YKMB 1RT7B 2QX0A 3DU5A 2AYEA 4OJHA 3O3LA 4B9MA 1I94F 2C3OA 4QJVA 5DLGA 4DL4A 3HF5A 3ENWA 5KT4A 1H72C 3R6LB 4MIBA 2C3YA 1HNZJ 2DIVA 3DOMA 1UPPA 2E9RX 4EK2A 1RCXB 1S6QB 2E1PA 1T03B 3W9JA 4URQU 3D0GE 5KFUA 3UPFA 4ZCIA 4H4OA 2M88A 5F8IA 2YKPA 3CCWA 1HQUA 4K59A 2HHHJ 2BRLA 4LRDA 4RNHA 3AD7C 3TR5A 2EC2A 1H2TZ 4DR3J 3QWUA 2B4VA 3ET6A 2P9CA 1YKWA 4KY3A 5L39A 5SZTA 5IT9U 3GG1A 4M5MA 2CJQA 5BYQA 1RT6B 2CNNB 1RLDA 3H40A 1K0VA 3A4TA 2GIFA 3TX0A 3ISND 2DTJA 3DKDA 3NRBA 4LRCA 1HQEB 3QGPA 1B7YB 1XTZA 4PR6A 3NNHA 1MSWD 1TUVA 2VB6A 3R5BA 2AV5A 3T1AA 1VQYA 1OY6A 1WORA 3CIMA 3CCRS 4AT1B 1TK0A 1FKOB 4QYZK 1ACMB 3EXYA 1H7WA 4ZLPA 3R8YA 2E1AA 3KKFA 3ILOA 4C3LA 3C66A 2KM8B 1ZA2B 5IC4B 2BW7A 1N5YA 2BE2A 4OX6A 3FEXB 2XMTA 4LSNB 1H74A 1TQLA 2XNQA 3TA2A 5T7LB 4A47A 1FFWB 1T9VA 4DR2J 1RISA 1RXOB 4CO2A 4NLUA 1M1HA 5DQIA 4EMDA 3C3LA 2W9BA 2CPJA 2VBWA 2OPRB 4HDHA 5L1IA 3FFIB 5H9EJ 5CH7B 2DNYA 5A0YB 4RLEA 4HEA9 4ER8A 1HLWA 2I0XA 2W4CA 5KAKA 2ZUGA 3TUJC 3IP0A 1S6PA 4TU9A 2W01A 1F9HA 4TU8A 3NY0A 4BS2A 4TYAA 4KT0C 3N79A 1LWEA 3DGPB 1ZYQA 1RP5A 4M94A 4DSFA 4QWBA 2EFVA 3RG6A 4L75A 2E9ZA 3KG1A 1TZ0A 1UWAA 3CDBA 4F3MA 4J9OA 1KC8T 3MTJA 2CJ9A 4ZIVA 1Q7LB 1JLGA 1F3VA 1U1QA 3UW1A 3KLEB 1JLCB 2DGUA 2HYIB 1FRXA 2FY8A 5HSPA 4IRCA 2ZZTA 3AXKA 2C2EA 4N7TA 2RKIB 2DNLA 1JWWA 1S9GB 4GO7X 3UI3A 1H3DA 3R5GA 3CE8A 3AJDA 1M5OC 2RAQA 4IG0A 2IM3A 2XY7A 1WKLA 3BF4A 2KYXA 2UUBF 1LKZA 1XERA 4P10A 3RUBL 2WVEA 1Q95G 2DHSA 2WW4A 4F4YA 2DVIA 3BQ2A 3PG9A 2DXDA 1H73A 1NO8A 2K1RB 4LMZA 2L9NA 1NSQA 3G87A 1KFSA 3KLHA 2HVDA 2QEXS 3PW4A 4P9SA 3CEDA 1AZSB 5M2RA 3S7RA 2N7CA 4ANDA 3RBDA 2ZJQQ 1S4FA 1ZETA 3KJNB 4ZP7A 5HL7Q 2R2RA 2ROEA 2HHPA 3LP1A 1FNOA 2FJWA 3BREA 4B9LA 1Y5LB 2BE9B 3M8PB 1N36J 2FHMA 3MPVA 3T9ZA 3Q22A 4DPUA 1SKSA 3BKTA 4M5GA 2ZVIA 3FMWA 4LF7J 3SYZA 3OL7A 3M8QA 3LUYA 4FVMA 1KS2A 3PNIA 4LSZB 4OIXA 3TUZC 2H51B 3KUHA 1XBWA 5D4LA 1K1QA 5CA5A 1REVB 4ZJLA 3SCJE 1LW0A 4DCJB 2VG6A 4F02A 4MK9A 1EB0A 2VC0A 3MM9B 1NPKA 1Y3JA 1HI0P 1GX5A 3QO9A 2HRUA 3PX6A 5F8LA 1NHVA 1UFWA 3C14A 2DGWA 2NQPA 1NPPA 2CQ0A 2YKMA 4R5PB 2RS8A 1RT7A 2RB7A 4X66F 1GXUA 3SI8A 3PHEA 1OPZA 2GAHC 2BABA 4DPTA 2BKOA 2U2FA 3D3BJ 1QAYA 2FJAB 1H38A 4IR9A 4MTPA 2JNJA 3TOQA 1CVJA 2CPZA 2DRAA 1KQFB 4QCLA 3B54A 3AT1B 1TUWA 1Y3KA 2Q43A 1UCNA 2DBBA 1IM6A 4KFBB 2W8LA 1VBZA 1T03A 2HKEA 4CO5A 4K4TA 2UUTA 4RKUC 4DQQA 4DV3J 2R4FA 1XNQJ 4FBUA 4B3RJ 3TEHB 3M2VB 4CTAB 2DJWA 2E29A 2MDAA 3IWXA 1WEZA 5D3GB 2KVQE 5E3CA 5DQGA 5IQ6A 2LXIA 2X51A 3PW0A 4R8UB 3QQCD 2MZJA 2UV8G 1MMNA 2N3LA 5KFLA 2HLUA 3I82A 3MR5A 3T5JA 1RT6A 4J91A 2XI2A 3F0NA 5ETOA 3HSDA 2J76E 2W1BA 5IC6B 4FF2A 5K8OA 1HQEA 2RQCA 4Q2MA 3GFXA 2MGZB 1F9EB 2GJ2A 5IM0B 4TY9A 3I0SB 3ULHA 3T5LA 4K0KF 1FKOA 1NDPA 4X4VA 1U7LA 1XQIA 3BV8A 2Y1LB 3QIPB 1S48A 2GVZB 2LQJA 3BGRA 3DXBA 3SCIE 3V6KA 3W66A 4BHQA 4RL1A 1RAFB 1R6YA 2ZE2B 2RILA 4NCGA 4A46A 4LSNA 3MMBB 5LMUJ 5T7LA 3C16A 3G86A 2G9OA 1NSAA 3Q83A 5T41A 1FRLA 1TKDA 4OZ5A 5DG9A 1G4CA 1VIOA 3Q86A 4DV6J 2HBYB 2YBVA 3N4WA 3FFIA 4KGMA 1KQSR 2JEFA 4Z7YA 3ZNJ1 2FLLA 3ZTOA 4BWMA 4C8ZA 1DARA 5K20B 4I64A 4ZP6A 1EETB 4DJBA 4WU3A 5LMNF 1CC7A 1URNA 2MLZA 3UCZP 5A6PA 1WACA 2BKNA 3GSIA 1JKHA 4P71A 2F9DA 1X0PA 4OYZA 3PEHA 3L7UA 1TELA 1AROP 2LDIA 4OZJA 2ACMA 5E0OA 4USWA 2H5JB 3LGMA 3P3DA 2E5IA 2IJNA 3KLEA 2CKWA 1JLCA 1RBAA 4J9LA 4UOFA 4W98A 1ZOTA 2EFGA 4ILRA 3TP2A 2ZH5A 2EG2A 1NKBA 4OHYA 2HFUA 2MQ8A 1TL4A 1RAEB 3LF0A 5ETKA 1R31A 5ITHA 2BQRA 2RKIA 3NKYA 2OKQA 2OI2A 3SSQA 1F5BA 3BM7A 5FDLB 5C25A 4OX9J 1IQZA 1VIXA 2MMYA 2VJVA 1HHSA 2Z2LA 1WF0A 4IOBA 1CJKB 2NZ4A 5CCMA 4CIOA 2EFOA 1NZ8A 3Q8PB 4Y2IA 1RT5B 4H54A 2FC9A 2FZKB 3TWZA 2J6UA 1JLEA 2VOOA 4LF5F 2Z2YB 2K1RA 1N5TA 4X4SA 5I42A 3OBIA 2A0FB 2VA3A 2C2NA 1AFJA 3H90A 1ULRA 1AZSA 1NM2A 2O67A 2X7IA 1Y5NB 1ZTTA 5KT5A 2AJ1A 1R43A 1NBEB 4PG5A 4HI1A 3H5YA 3GCXP 4LR8A 3GYNA 2DH9A 3S6EA 1TU0B 2KHDA 2F8MA 3Q8UA 2OMLA 3ISNC 1QD1A 3KHLA 2QMXA 2BJDA 1L3UA 4DV1F 3GMGA 3Q8SB 2MQPA 4OJ1A
chains in the Genus database with same CATH topology
1NK6A 1OQ3A 2VKRA 4DFMA 4GC6A 4OI4A 2B7CB 4OZ0A 1OS5A 1S6OA 5C25B 5EWGA 5GAHI 2CPYA 3FZ2A 4ZP9A 1X4GA 4DS4A 4ZVFA 3MEDB 4I7FA 2AJ4A 4OI6A 2NR0A 1C1CA 5EHHA 2R8HA 1VQLS 3M8SA 2A2DA 1G1XA 2BV3A 4RBUA 2KH9A 2B7BB 3DRRB 1S0OA 5HLFB 1TP7A 5GADI 3JTNA 4IDKA 5G4DA 2GMHA 1ZAVA 4ZPAA 2XLIA 2P6SA 2ZDPA 1V3RA 1SKWA 1OSDA 1LXNA 2EFNA 5E3RA 3S01A 1SQEA 3HHDA 4DSIA 2J9EA 4DWIA 2GIRA 1S1UA 1TAQA 3FSIA 3P6YC 1RTIA 1KRPA 1Z2LA 1BWEA 4I56A 4ECSA 4ZP8A 3ZZUA 4XDDA 4Y2KA 4A8XA 4J9KA 1D9FA 1KLNA 2ADCA 1REVA 1F2GA 3BO3A 3D5MA 1JLEB 2N7YA 2NYIA 4K5RA 3JYTA 3K7RA 1NAQA 3Q24A 2EWHA 1LWCA 1Q16B 3EGWB 3DRXA 3KOAA 3DHXA 4OI0A 1SKRA 3HHKA 4RBVA 4G1PA 3HHLD 1KTQA 1XK8A 4YUDA 5I42B 2SXLA 3WZ0A 2F7VA 2LU2A 2YNIA 2LA6A 3MM9A 3RAQA 1J5OA 4LF7F 2F3JA 1UVNA 4Z37A 4X4UA 3M1VA 3U1MA 1N8RT 1JJ4A 1B64A 1XWLA 2R2TA 4DG1B 4KAIA 1N56A 4C8OA 2WONA 1HNIA 5D4NA 3HT3A 3POTB 3DLGB 1FDDA 2VZ9A 3T9NA 2ZC3A 4KE5A 5B7WA 4YP3A 3OTOF 4ECTA 3OVSA 1FKAF 2OAUA 2HHTA 2V94A 2W9AA 3SEOA 1F5CA 4TNOA 1M90T 3NWGA 1YITS 4KRWA 2HVHA 3DRYA 4QWDA 1S72S 2LEAA 4EYHB 3W3SA 3RU0A 4OHVA 1DQ8A 4MFBA 3F56A 2P9EA 4PWUA 3MFIA 1WF1A 5KG4A 2LKZA 1Y00A 5I4MA 2RH3A 1M5KC 4ILLA 4G6VB 1WELA 2KHCA 2VC1A 2MQNA 2XHWA 3TARA 2FJXA 1UVMA 1BQMB 2VUGA 3MOJB 2UXBF 3N6LA 2J9DA 1JNRB 4ALZA 2FHJD 2GJIA 1RYRA 4B9NA 2O66A 1OQ6A 2HRYA 4BBYA 3OV7A 3RW6A 3G71S 1HBMA 2HGLA 1NHUA 3DLEA 3KJVB 1Q79A 3FRYA 1VI7A 3LO3A 4IG3A 3RTVA 2NXUA 3BDPA 4WFXA 3HXMA 4O23A 1Q8BA 5DG8A 4QWEA 2FHKA 3HVRA 3J7A1 4HT7A 3TVYA 5HROA 3MEEB 5KFRA 2VQFF 5LL6d 3L09A 3JSRA 2GW8A 1C1CB 3OR1B 4F67A 2RRNA 1XR6A 1Z2ZA 3KK3A 1IM4A 4WFAQ 4O3OA 3DLJA 2E1CA 2VFUA 2R7XA 3PY8A 3MOZA 5HBMA 3PZPA 1JJ2R 2DH8A 2E1RA 4NXMF 3CPWR 2VPWB 4TN2A 3WC0A 2Y1IA 3AH6A 1U6ZA 5F9NA 5C5JA 2AWZA 5HQ8A 3T3FA 3HVAA 2LU1A 3ITHA 4KFBA 4N56A 4ZPCA 3KLFB 3CSKA 2PI5A 4B3OA 2BRKA 2FHJA 3T5KA 5KFXA 4LVOP 3UR0A 3JB9k 1I6JA 1RT2B 4OJGA 2K3IA 2LXFA 2LQ5A 1TKTA 2QSWA 4ED3A 4IFYA 1H6KX 3AB4B 5BYRA 2EC0A 3EPGA 1KD1T 3JYTB 3K5MA 1NB7A 1LWCB 2ILZA 1NJWA 2GIQA 5KG1A 4DN9A 5AXKA 4CTAA 5KT2A 4OQJA 4QYZJ 2KXNB 2JLEA 3EGNA 5F9LA 2E5JA 2FGOA 5EX3A 3CJKA 2EG1A 3LP2A 2MB0B 4O4GB 4AFFA 3OHBA 1ZBTA 4UQGA 3PV8A 2DNMA 1J5OB 3U7JA 3PW5A 4I2PB 5D3GA 2HZCA 2PSZA 3M1VB 2CVIA 4LF8F 4JV5F 1K1SA 3QLHA 3EZ5A 2WBMA 2RUGA 1IKWB 2A3JA 4WK1A 4DFPA 1U1RA 2OJ3A 2O5DA 3NMAA 2ZHOA 3MEKA 2DNZA 2ZH1A 4P2SA 4XAKA 1KNZA 1FTCA 3V2UC 2KFZA 2F9JA 4X64F 4NLPA 2OFGX 1U4BA 4DV3F 4WFYA 1ZAWA 2FPHX 3O44A 5K8NA 3RRGA 1XNQF 1QVGR 4DF4A 2CVEA 3IA0A 4ECUA 2ROGA 3IC1A 5GVQA 1X9SA 3SMZA 5F8NA 5C42A 2RQ4A 4ED1A 4C8KA 2MQLA 2CQ1A 4Q45A 2YH0A 3SFGA 4WFBQ 4EBDA 3HI9A 1S0NA 4FF3A 1S7HA 4GO5X 2ZH9A 1S1VB 1U24A 1NK0A 4I67A 2ZJRQ 2KXHA 4QQBA 2RSQA 3M30A 1F60B 3N6MA 1NKEA 3E01B 2PMHA 5CYJA 4HI2A 3W2VA 1U1LA 1FRMA 3FSYA 1T8EA 1E6VB 2RIJA 4FF1A 4A48A 2V8HA 3GFHA 1L3VA 1NK4A 1HBMB 5GAGI 5EGYA 4GKKF 3DLEB 2NUHA 2MGZA 4HKQA 3D0HE 5HI7A 2CQGA 4YY3F 4EZ6A 4Z2XA 4JI1F 5AXLA 1LV5A 3TAQA 1FO1A 2IJFA 3CJ2A 4ECZA 5HROB 3I31A 3I0SA 2H9ZA 3SCLE 4F4WA 4LQ3A 1S1WA 4V19X 4J9NA 1R8HA 3C2PA 5THWA 3VAFA 5F41A 3PW7A 2XULA 5K14B 3TQ1A 3EZUA 1ZM2A 1X4BA 3KK3B 1QAIA 2GQ2A 4UY8T 3QIPA 4NMLA 1M5VC 1R7IA 3LANA 4CNZA 5HBMB 4C97A 1JLBA 2NSBA 3RB6A 2I38A 4UOCA 1FCAA 3D1QA 3FQKA 5M2PA 3G8TA 4IRDA 4L3NA 1XEZA 3W2WB 4WFZA 3ITHB 1FDNA 3HM9A 4DV0F 4DR4F 2HIQA 2EBGA 2PE8A 1U2FA 1C0TA 2EFQA 3I4PA 2HWHA 2HHUA 4E98A 1XN9A 2ALZA 1KLMB 1HNWF 1DAXA 3PX0A 3I56S 3PX4A 2K7KA 4X4RA 1QAXA 2QZ8A 4IFYB 2CJAA 2DGSA 2HHVA 3OL8A 1FT8A 2IA0A 5D4PA 4JV1A 2B6AB 2ZNZA 2W7PA 4NLWA 2LQ9A 4OJ3A 5JUMA 3AAWB 2QT7A 1QM9A 4RUHA 3DM2A 2C22A 2OO4A 1TKZA 4EYIB 5K8PA 3V6HA 1DTQA 1JMTA 2AYGA 3LP2B 2RT3A 5J2PB 1V3SA 1C4AA 3LPYA 2AX1A 1AW0A 1Y7PA 3VZHA 1YQHA 2EK6A 2J0WA 1B0PA 4IO1A 4JOUA 5KFZA 4QPTA 2XS5A 2XBPA 1B0TA 1FRJA 3IG1B 4ZOSA 5CYQA 5DQHA 3IAM9 3BDEA 3NCPA 4QYRA 2J6SA 3KHRA 3S1TA 3THTA 5J2QB 2APOA 3EGZA 1C4CA 2BQ3A 1YTYA 2L9DA 1QAJA 2LA4A 1SUQB 3V4IA 1BQNA 3QZ7A 2AX0A 2GGPA 2HNYB 3T6JA 2B4PA 3MMAB 2PD1A 2YWGA 3TYTA 4JI5F 4QW9A 5LMUF 3CCZA 3VR1A 4IFVA 4PG8A 3LQVA 3IO1A 5HP1A 3MPYA 4WZMA 1JLFB 1U1KA 5F8JA 4QIVA 2AF6A 3AQOA 3ZZRA 1EETA 5KFEA 5F0WA 3PRBA 4WE1B 3DOKB 3VZIA 4XPCA 3TAPA 1ZTWA 1JX4A 3CCSS 2ZZNA 3D0IE 4A8MP 2FTRA 3M30B 3HK2A 2LEPA 1IKYB 5L1KA 1U6BA 4PWDB 2HW3A 2AYBA 1NRKA 2XCPA 2V4RA 4RW9A 1TFWA 4OI1A 3RRKA 3ZZTA 3E8OA 3VQTA 2B4UA 2FJBB 1T05A 1J2VA 1W2IA 4MJKA 3AHPA 3ZZOA 1S0MA 2BM1A 1LK7A 4XK8C 2IM0A 3A8EA 1XC9A 3HLUA 5A8WB 5H9FJ 5EUHA 1HWUA 3G6ES 1S1WB 4JI4F 1RGVA 2QA4G 4NCBA 3ZC4A 2WB4A 2OFHX 5J2MA 4B17A 5IT0A 4EO8A 4K4WA 1OO0B 1NK8A 2V4QA 1S77D 4DQRA 5U47A 3MM6B 1RQ0A 2CQIA 3QYYA 1VHFA 1FVSA 1O5JA 2XLJA 4FPRA 4NLXA 4WIIA 2WSFC 4K4SA 3UE2A 1X4CA 1P6TA 1UAWA 4O3NA 4DL3A 3NS5A 2VQEF 2MKJA 3G8QA 1C0TB 2FVQA 3SYZA 4ES2A 3DYAA 3I6PA 4OHZA 2AGQA 4OI2A 4WYWA 4YDDB 2QMWA 3E51A 3HX9A 4OX8A 1S1XA 3GE9A 1U25A 2ZH7A 2FVPA 1K0TA 4DF8A 2J9DE 4QOTA 3OSNA 5KG7A 4QR0A 2MJNA 5HMWA 4YB5A 3BO4A 1FK9B 1TKZB 1DTQB 2W8KA 3VAJA 4KQZA 1NK5A 3K0JA 3NMRA 2OTLS 3SSSA 2MY8A 5CYQB 3J7YU 3M9NB 3K8WA 3WBZA 2DNHA 2VFTA 2DPIA 4NCAA 2HMIA 1NU4A 5FDLA 1TK8A 1SL0A 2HNDB 1N6QB 1D1UA 2E66A 3N6NA 4TY8B 2WRMA 1P1LA 5DGBA 3QPIA 4KKOA 4C2MA 1D3WA 5CYMA 1WHXA 3TW0A 3OSPA 2K7JA 2ZZMA 1M0SA 1UJ4A 3MR3A 4NLGA 3NNCA 4I2QB 2DO4A 4IFVB 4RW8A 4PG4A 4Y2MA 4C11A 2DNRA 5HP1B 3MEGA 1DZ5A 2CPFA 4O3QA 3H8YA 3I9ZA 4HL9A 1U6FA 1X5TA 2XSFA 5J1EB 3QJPA 3WC2A 1N88A 1RWUA 4I1TA 1RDRA 3IR5B 4X62F 3GR0A 4K4VA 2BXJA 4KV8B 4WXWA 5LJ5Y 2GCFA 1HMVB 2CYYA 4K5SA 3DMJA 3CCMS 1RT5A 2BACA 3O2IA 3KTQA 4RW9B 2FGCA 2OPPB 4U67Q 1S9FA 4PKDB 2L48A 1T05B 3PXGa 4ZVGA 4NLOA 4A8QA 2ZHAA 4QPXA 2GQQA 1SV5A 1Q7YT 3HFKA 1RA7A 1UP1A 4B02A 2XC9A 4NA1A 2R7VA 4X2BA 2Q3PA 4Q0BA 3BQ0A 1FJ7A 2VPYB 4DV7F 2MZRA 2VG5B 1R8CA 4O44A 4QWAA 3V81A 3CCJS 2YWKA 2M8HA 1UVKA 4X4OA 1RK8A 2XWXA 4RNOA 1F5AA 1FTRA 2A10A 2BR0A 2ZOFA 4G1IA 4CH0S 2AD9A 1Q82T 4NRTA 3BSNA 1XR7A 2GO9A 3GWCA 1RYSA 1N33F 3TNVA 1E6YA 3UCUP 4DUYF 2ASYA 2DK2A 4G3IA 3L95X 5KFKA 1GX6A 3HKZD 2FB0A 4W90B 4ZHRA 3BGLA 3CGIA 2AJ0A 3C6UA 4LT6A 4Q8FA 4AL7A 2C2DA 1UETA 3M2UB 1Q1KA 4RWWA 5LXYA 5L1JA 3JTOA 4JBCA 2KM8C 3PACA 2E5LF 4AL5A 2YNGB 1G6BA 3LH2S 3BS9A 1FE0A 4ID5A 2M9KA 2MZSA 3MUTP 4IR1A 3RZAA 3HJFA 1HNVA 3M9OB 1KVIA 5AE3A 3I55S 2DH7A 2I5JA 2XEXA 3GSDA 4QR2A 2DCLA 1VC5A 4C7QA 1FEEA 1C1BA 2IMWP 4FBTA 2KZMA 4JI8F 3GV8B 1IBLF 5IXUA 3TI0A 1QUPA 2V4JA 4QZVB 4XDCA 1VQOS 2FHOB 4H4OB 4X4PA 1X9MA 4JI2F 2M2BA 3OXGA 2D41A 2W9CB 1O51A 1KTVA 2HGNA 4TKTA 5E41A 2ZD1B 1U1NA 1RKIA 5KFNA 4ETXA 1HQUB 2B0GA 2HMIB 4FXWA 2HWTA 4AXIA 3NAHA 1SJ1A 3BN4A 2YVSA 4KC5A 3L3CA 1HFEL 4Q5VA 4LF4F 3OLAA 1CPZA 3FEYB 3P49B 5CYMB 4DUZF 4ECRA 3I5BA 3MEDA 4QW8A 2QE5A 4IQMA 4LF9F 4RW8B 4C11B 1D9AA 3UFCX 3TAMB 3K57A 2B51A 2W4PA 2ADBA 2GO8A 2WBRA 2HPUA 4NYOA 4LQ9A 5HLFA 2RRAA 1N48A 5KTQA 1U45A 1WNEA 2VL1A 2Q1LA 3OTDA 4RW7A 1NK7A 4WKRA 1VMBA 2JL9A 2OPQB 4X84A 3OTBA 2L41A 4A8KA 2O01C 3TX8A 1HARA 2J6TA 4LUBA 3FVYA 3UD4P 4ITSA 1G3OA 1CQMA 4EFAC 1L3TA 3CF5Q 3THVA 4BC7A 3T1HF 3MMJA 4WFNQ 2R9LA 3IS9A 1AUDA 1S9EB 3R3TA 2YQ3A 1HBUA 1YJTA 1UFLA 4F8RA 1CQNA 5E3QA 1KOOA 2PDAA 2MZ1A 4O44B 3CO9A 2YY3A 2RQKA 4M95A 1YJWS 2ZH4A 3OFEA 3ZZ0A 5LSRA 2UXDF 1NEEA 4NZ7A 3QAEA 3HP6A 1GT8A 2KYZA 1X4EA 4ZPBA 1JNZB 2LDYA 2QIFA 5L9XA 4DG1A 1KQKA 4B9UA 1YIJS 4C9DA 3POTA 3MPWA 2HNZA 1SH2A 3DLGA 2UUWA 4XO0A 3TRGA 5B0EA 3HHEA 5AXMA 2R7UA 3I87A 3CCQS 1BY9A 2XI3A 3NS6A 4KJIA 2DGVA 2EW9A 3QGHA 4J37A 3K5PA 4E0DA 4XIUA 2ROPA 4IH5A 1VC6A 4YHHF 4ZA1A 3MZIA 1XMBA 1SH0A 3DLKB 3KMQA 1VQ7S 4B3TF 2X1FA 3OXLA 1NH8A 2IHR1 4ID8A 1ROFA 2DHGA 3K5LA 2I5JB 2R7OA 1WG5A 5KT3A 1BQMA 2IVYA 2KRRA 3AY0A 4EU0A 3DLHA 1LK5A 5DJBA 4DSKA 2ASLA 4KTQA 2DO0A 1N5YB 3Q0AA 3K5NA 3VCDA 4EBEA 2FY1A 1MWZA 4NA3A 4BWJA 2DT9A 3KJVA 4HYKA 2N4CA 5EDWA 1HBOA 2VFVA 1JLAB 1S79A 3CDEA 4NZ0A 3UR3C 3KLGA 4BDPA 1WI6A 2CRLA 4UUWA 2OD6A 3MEEA 4DR6F 4LVNP 4ECYA 1RA6A 2MY7A 3LALA 2HFOA 2D3ZA 4NLVA 1OSCA 3OR1A 2F8HA 1HD1A 2UUCF 3PR4A 2W9BB 3CTRA 3MMCB 3TUIC 3DCAA 3V4MA 2MZTA 2Z4PA 1BGXT 2DGXA 2XZWA 3LOUA 4TLQA 4PRFA 3KLFA 2DNPA 4RW7B 3TO8A 1IR0A 5F8GA 3KYLA 2FD2A 2ZBCA 3CULA 4H4MB 1CLFA 2ATLA 1U48A 3BR9A 1RT2A 4B08A 1PGZA 1PSDA 2KJWA 2R8KA 2CQ2A 3DOLB 3PJXA 2NPFA 4EUVA 3HVTB 5KFMA 2OSQA 3IS9B 4RWXA 1HBUB 1X8DA 3WDOA 1NH7A 3G6YA 4E8UA 3DHWC 4ZPTR 3OLBA 4A4JA 4DEZA 3N9UC 3GQCA 2QLXA 3MECB 2FLNA 2EKYA 2NPIA 1HA1A 3QGIA 4FNIA 2JWNA 5DG7A 2BOPA 3D28A 1R0AA 1VRUB 4P7TA 4O4GA 4NLSA 3ZZYA 4CQ1A 4XPEA 5IWAF 3VAMA 4I2PA 4ZCMA 1TK5A 5KFFA 1VQ5S 2FVSA 3SFUA 2G1DA 4F26A 3ZFVA 2OPSB 1D8ZA 4F50A 1IKWA 3N5BA 1MMDA 2HNZB 3N0VA 1MWYA 5JXSA 3GV7B 1YG0A 3BEGB 5AE1A 4RX6A 2JLFA 2QA2A 2QA1A 3N28A 5IZHA 2X1GA 3PVXA 7FD1A 4Y0FA 2X3GA 1QE1B 4N4