4N8NA

Crystal structure of mycobacterial ftsx extracellular domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
102
structure length
102
Chain Sequence
LDRVESQVFLTEDVSANDSSCDTTACKALREKIETRSDVKAVRFLNRQQAYDDAIRKFPQFKDVAGKDSFPASFIVKLENPEQHKDFDTAMKGQPGVLDVLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mycobacterium tuberculosis FtsX extracellular domain activates the peptidoglycan hydrolase, RipC.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Membrane protein
molecule keywords Cell division protein FtsX
total genus 25
structure length 102
sequence length 102
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18075 FtsX_ECD FtsX extracellular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3040 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4n8nA00
4N8NA 4N8OA
chains in the Genus database with same CATH superfamily
3HCXA 1KWMA 1R89A 5CYQA 3W1YC 1UFLA 3K5NA 2MLYA 2LXUA 2HFOA 3L7OA 7FDRA 5J1PA 1X9WA 2XO7A 3R7SB 4ZVOB 2X1FA 1PBAA 1SH2A 4M5DA 1DQ9A 3MI7X 2VB6A 1NK5A 5HROA 2HWTA 3IMQJ 3EVMA 2MJNA 3RTVA 2PGCA 3DRSB 2Z8QA 3IN5A 5B0BA 3FBEA 1JXVA 2UVVA 2BRKA 2KVQE 4UZCA 1JNRB 2UUTA 1V5IB 1W2BR 4DI6A 1VQ8S 3CCVS 4B3TJ 4DQSA 1P9YA 4ZPWR 4FXDA 2CKWA 2OPPB 2XGPA 3QO9A 1ZTWA 2VPWB 1WELA 1VQLS 3HD2A 2PIIA 4H54A 1WJ9A 3Q8VA 3ZZ0A 4ANEA 1WOOA 5DDOC 2IM1A 4JI3J 4ECZA 2R7SA 3GYGA 2E5HA 1NU4A 2XWYA 2E5LF 4K0KJ 2BJDA 1XTZA 2KXFA 3AODA 5KG0A 4GKJF 1RAFB 3MEEB 4PXEA 4CZCA 4NLTA 4URGA 2CVIA 2EI5A 2ZBQA 2QFJA 4RW6A 4CCHA 4MKBA 4FVCA 2KTQA 4JOUA 2CJAA 1YBAA 4ES1A 1YJUA 2VG5A 4NXMF 1VRUA 3GR0A 4YS2A 2X1AA 2HHUA 4P10A 2BYCA 1FDNA 2B0GA 2JHEA 2ZH8A 4IO9Q 4YDXA 2J76E 4P7TA 4MYTA 1C4CA 2QJ3A 3M2UB 4I4BA 4LF1A 2EFPA 3FFIB 1P1LA 3DYAB 3NOGA 4UOCA 2FVRA 2PEBA 2DYAA 1JKHA 4IH6A 5J2PB 2NREA 4K0KF 3TR5A 2G0IA 2OD6A 3I0SB 3NP5A 4OI4A 3WIUA 4C3MA 5L1KA 3O2IA 3QJJA 4WP9A 2PFDA 1RT2A 3PEJA 2XLJA 4J7CA 4X4OA 3PX0A 1TMJA 4DL6A 3R1LA 1T05A 1WDDA 3LGMA 4P52A 1RTIA 2WZ1A 4YY3F 4WTOB 1XMOF 4NEYA 2W24A 3D67A 4NE9C 1RKJA 2B4PA 2MQNA 2QE5A 4C8NA 1BMQB 1S1WB 5ETKA 5KOWA 4EYIB 1KFSA 4F8RA 3RAQA 3UR0A 3C16B 2W2QP 1RAJA 4LRFA 2M88A 3JS9A 5L9XA 4IRCA 2KYZA 2OI2A 1S1XA 4M5NA 4TQSA 4MK7A 5KFEA 4YHHF 2XY6A 3HK2A 3KDNA 4ZPBA 2HNDA 2ZHBA 3D66A 2NXUA 4OX7A 5KFDA 4RNHA 2EFOA 2JLFA 3I31A 3K8WA 3QWUA 5L38A 1EKSA 3JYTA 1RBAA 2HWHA 3NKYA 4OI0A 2IFXA 3OXGA 2K7JA 3Q22A 3RJMB 5D0GA 1XMQF 2UV8G 3GJSB 3CCES 5GAHI 1BWVA 2VUGA 4OYXA 5AT1B 3BQ1A 2V2KA 1RHUB 4ER8A 3T5KA 2GMJA 1NNDA 1EQMA 2HNZA 2QYCA 4ZN3A 4ZVTB 2B9YA 2DCLA 1RDRA 1G7CB 4KFBA 5A8RB 3D0GE 3OFGA 4WFNQ 1XNRJ 4YB1P 1X0PA 2O67A 2HS4A 4KH0B 4XO0A 3V6JA 5HAOA 3WC2A 3KJFB 5D0HA 5SZTA 2AJ2A 3AJ1A 2KYXA 3HHLC 2AWZA 1K8AT 3C14A 4F4XA 1ZA1B 2C28A 1HW9A 4IOBA 2EEYA 3HX9A 3M6VA 3MM5A 5KFBA 3J7AN 1FFWB 2CWXA 4NLPA 2JNJA 2KDOA 2W2MP 3CJSA 3DC2A 3UD5A 3ZTQA 2RNEA 1J5EJ 1RLDA 1C1CB 5BYSA 3UCGA 4B3MJ 2KI2A 4JI1J 4KHPF 4LFBJ 3L3CA 4UF4A 3QJPA 1WC4A 2GAGC 2YWGA 4N8OA 4CLTA 3ONQA 1H98A 1QAXA 1RHQB 1O6XA 2D9PA 1SC3B 2IJFA 4PWUA 3PY8A 4WTYA 1FD8A 2W4DA 1LWCA 3W63A 1LK7A 1WNEA 3QRPA 4CH0S 4XK8C 5HL7Q 2CQBA 3PNIA 3ELHA 4F2SA 4A47A 1REVA 2M4MA 3NWRA 1KVKA 1RXOB 2YKMA 3FCVA 4HI1A 3I55S 4LF9F 2E9TA 2N4DA 4O0NA 1UFWA 1S9GB 2N3LA 4H4OB 3PX6A 5E0OA 1MG7A 3ET6A 3JTPA 3MM8A 5ETMA 2WVBA 4PXDA 4HACB 2J9DE 5LJ5Y 3OL7A 4URSA 4DV5F 2AX0A 3FCWA 1N34J 4YN3B 1YKWA 1W2IA 3UNYA 2PDAA 2QL9B 5M2UA 1Q5VA 3TEHB 4YP3A 1Q95G 1RTZA 1WC6A 3RAMA 2FY8A 2XCAA 1WSVA 2NXEA 4NCAA 5F8JA 3W7BA 3R8YA 1D3WA 2ZD1B 3EICA 1UCNA 2R7QA 3KLGA 4LFAF 1NSKL 4GKKF 1MN9A 3SCKE 4DPOA 3MM9B 1HQEA 3T19A 2R7RA 3B8HA 3BF4A 4RW4B 2XZWA 8RUCA 3LP0A 5LOQA 5KFKA 2GHVC 1N34F 4JI7F 4U8YA 3BDEA 2BVZA 5I42B 2VU5A 4WK1A 5U47A 4A8XA 1WC0A 2ZFHA 1AZSA 3SDEA 2DGSA 4WU2A 2V8HA 5IFMA 3EPIA 2R8KA 2HW3A 3IBCB 2M8DB 1OJ4A 2EFVA 5K9FA 1S6PA 2B3TB 4QU6A 3ZO7A 2ZKTA 2W8LA 3CJ8A 4F4WA 1T0TV 3BN7A 1RT7A 4URQU 1LWFA 5F0UA 4EZ9A 4I0WA 4CLSA 5LM7E 3D6MB 4USVA 1EIYB 4N41A 3AJ2A 2E7WA 1FEHA 1VRTA 3H90A 3WBZA 3M8PB 5LL6d 3PIPQ 1RTDA 4PEOA 4P2MA 4FVMA 4ZDNA 4EZ6A 3CCZA 2ZH2A 2YXLA 4U6PA 4IR1A 3JSYA 1M1KT 2XEXA 7FD1A 1NK4A 2HMIB 2J5AA 3HVTA 5E3AA 1XR6A 2V2QA 3M8QA 3NCRA 2J6UA 1HNVA 1WC1A 1HI0P 2HVHA 2YNHB 1YJRA 2FC8A 2I1RA 1RWOB 3JAMU 3TANA 2P6TA 2EWHA 3W8GA 3FEZA 2DGUA 2XMKA 3O44A 2HGLA 1CJUB 2VG7B 2V6AA 1YLXA 2OFGX 5A8WA 2ROEA 4C4WA 1A9NB 2WONA 1QAYA 3V4MA 2AHOB 3DOKA 1BUXA 2FLOA 3RAXA 1T3OA 3OL9A 2ZBRA 4Q5VA 1IBLJ 5AXLA 2QEXS 2UV8A 2KFZA 4G1QA 5G4DA 1AB8A 4C97A 2A6MA 2CG8A 2CQ4A 2YKQA 2B6AB 4DV2F 2GO8A 2HHHF 2XQCA 4K4UA 2ZOGA 3VV2B 4KTQA 3QBCA 3QFHA 1UWAA 1TL7A 3ZFVA 1ZM9A 3ET6B 1FCAA 5D15A 3HSZA 4HACA 4LSZB 3UQSA 3OSNA 2IVFB 3H20A 4KO0A 4LSLA 3Q0AA 4DLGA 1R31A 3MPUB 4JI8J 4RWXA 1PIEA 2JVRA 2VBWA 3BM7A 1XMBA 3CJ4A 1D9FA 5CQGA 4ZVFA 4DUTA 2H4WB 3SEOA 4U9RA 5C24A 2XB2D 1IQTA 1EETB 1N54B 2AYEA 2MKJA 3AOAA 1GMWD 2H5JB 5K14A 1ZBTA 2ZD1A 5C5JA 1N56A 1M0SA 1RAAB 2CPFA 5GAGU 3GMGA 3KK3A 2B5JB 4WKYA 3K59A 2K2PA 4OYZA 4CT8A 2NZCA 4AL6A 3CCLS 2FZCB 1TL4A 1YI2S 4JI6J 3R2CJ 2L08A 3L09A 2DXFA 4DR7J 1NRKA 3MM7B 4FXVA 2NZ4A 3IRXB 4QW9A 1Z4UA 3B4MA 5E3QA 1UJ4A 3SSRA 5E2QA 4UY85 5B0EA 4ZLPA 2EFGA 1SBRA 3AD9C 3B78A 3I5AA 4NXNF 4YR3A 1FVQA 1Q78A 1KFDA 1FKPB 3SFGA 3JQMA 3H40A 4A8QA 2UZAA 4DL0C 1D8YA 5A6PA 1KDNA 1LK5A 3D54A 2YH1A 3DHWC 4DR1J 1FJ7A 4W4MA 1U25A 2HBRB 1FX2A 2ACYA 3A3NB 1NSQA 3BV8A 1U1KA 1U2FA 1KQKA 3G8SA 3M9NB 2MQQA 2GO9A 3S8SA 1M90T 3LP1B 3MEDB 3BO4A 2EK6A 1B70B 2K8GA 3NG8A 3QAUA 1NXIA 4L3KA 4RJVA 4R8UB 2BM0A 2VA2A 2YNFB 1F6TA 1IKVB 2FHMA 1UWBA 2MB0B 4ECRA 1N36F 4OV1A 1GAOA 1WACA 2BR0A 2AW0A 1R0AA 1NHUA 2NSBA 3OR2B 4Y28C 2X1GA 4G65A 3RUBL 4PKDB 3VAIA 4DV3J 1BHNA 3CDBA 3MDFA 4EBEA 3UD3P 3IM8A 2LU1A 2L9WA 1C0TB 2X3GA 3CDWA 1N8RT 5CYMA 3TA1A 2N7CA 2XBPA 4EO6A 3CO9A 2R2UA 2DNMA 1CJUA 2FDNA 1HPZA 2RT3A 2VG7A 2X51A 4O44B 1ZM3A 4ID5A 5KOXA 2CDQA 3M9OB 4ZVPB 2YKAA 1S0NA 2FZGB 1M1HA 4OMFG 3TJAA 3VAJA 2IRUA 1N4LA 3FDSA 3GIRA 5ETNA 4CDIA 3LP2A 4USKA 2EG1A 1Z1ZA 2G2OA 1NH8A 4GO5X 4LVNP 1LFWA 5AXKA 4O3QA 4WXOA 3SXLA 3VVUA 4IFVB 3DNCA 5C2GA 2W9CB 1L5UA 5DETA 1AFIA 4FYVB 3DRPA 1SCJB 1WOSA 3LF0A 3OJUA 1LWXA 3R5BA 1LW0A 4I7FB 3VGUA 3CMQA 2PMZD 3ZZZA 5LMUJ 1GX5A 2HVIA 3CEDA 4KO0B 4LRCA 3RBDA 5J2NB 1SVDA 2KZMA 2QLFB 4LBIA 2ZBPA 4NLDA 1WEXA 1YHQS 3N5BA 1JLEA 2FJAB 5CHCB 4ZIVA 3GYXB 3IGVA 1KKHA 5HANA 3R2DJ 1SKUB 4B02A 2D74B 2ZEJA 1LQ9A 2DNRA 1HBMA 4LSNA 4K5SA 2J7UA 2ATLA 4DPUA 1AROP 1ZM2A 1TVRA 1C2PA 1NPRA 1RZMA 3DGVA 3HHLD 1VHIA 4NLRA 5IWAF 3ENVA 4DS5A 3W3SA 4XIUA 3DDIA 4J9NA 2KM8B 1QTMA 3F56A 1VBYA 2DGTA 1Q7LB 3UDEA 1OO0B 1Q8BA 5DRKA 2XYGB 1OY9A 3K5MA 2DY9A 3EYZA 4C8YA 4WXWA 5KFCA 2MQPA 2V68A 1OMSA 1RJJA 4ZP7A 1N0UA 2A18A 2L3MA 3SSQA 1VBKA 2LECA 3M1VB 3KLEA 2KU7A 4PWWA 2VDHA 5HROB 1X7VA 3TNVA 1KHVA 1QSLA 4QW8A 2GX8A 1IKXA 4JI8F 2IVMA 3CCJS 4DV4F 2W25A 3TJ9A 3N5FA 2DO0A 5KT7A 2ZUGA 3ENAA 5KFOA 2OAUA 3T6JA 1NSAA 3VALA 2KRBA 2DNZA 2MMYA 2QSWA 2W7AA 4HL9A 4OJHA 2M5YA 2QO3A 3EZOA 3OV7A 1NAQA 3NAHA 2QN6B 3GR1A 1L3UA 3W5ZA 4C8KA 5EGYA 4K4XA 2ERRA 1Q8LA 1RABB 4KR0B 2DEJA 3BPDA 1E6YB 2B8QA 1M5KC 3MXHP 3IAS9 2C42A 3W60A 2IAJA 3LAMA 2GGPA 4E2FB 4DV4J 2ZC4A 2W2PP 4TY8B 3KMQA 4X4QA 2UVWA 2CQGA 1WEZA 1XR5A 3V5RA 1FEEA 4AQYF 3W64A 1NPPA 4RW9A 2I5JB 5LT5A 3H98A 4A8OA 2WOMA 1VRUB 1DY3A 1DURA 4F02A 4QWAA 3CDAA 1DJ0A 2FZKB 2HNYA 3H5YA 2AGQA 1Y7PA 2O1PA 5CCMA 1KC8T 3K0JA 2HHSA 2YPZA 3CIMA 3W9HA 2OTLS 1T7PA 3OXFA 4LT6A 3M8SA 3ZC4A 2CIMA 4CTAA 2JEGA 2WW4A 1HHQA 4ECVA 1FXLA 5KTQA 1HBOA 2BJ7A 1DTQA 1TKTA 3T6BA 5K8OA 4X65J 1S9GA 2XLKA 2BACA 4J5OA 1S4EA 2LVWA 3POTA 4WFZA 4RBVA 4IOCQ 4Y2KA 1VCTA 4EFAC 2HK2A 1UVKA 2XZDB 4DR7F 2Z57B 4KSEB 4CYUB 2DR5A 1VLYA 2Z58B 3D68A 3LOUA 4QWEA 1VQ9S 3FMBA 5KFUA 5HQLA 5IT4A 4NYOA 3QAEA 5J2QB 1NJXA 1A0OB 4OI3A 3H25A 4WFYA 4PG7A 4A8WA 2V8GA 4O3OA 1RAHB 5K20B 1F5CA 1LWEB 3R7NB 4NWBA 1WTFA 1W7WA 4J37A 3TRGA 4A4JA 5B08A 2DNPA 1YG0A 4LBPA 2DNLA 4DSIA 4LF8F 3D6FB 3T5LA 1RLCL 4B9LA 3LPYA 2JFDA 1HNIA 3HFZB 2ZDOA 1HQEB 4CLPA 2LXIA 2XMWA 5I3PA 1QSSA 3FVYA 4J9PA 2HBZB 2XMAA 1FO1A 1WG1A 2ZITA 4OZ3A 4HHJA 4HYKA 2HQCA 2LP4A 5A8KA 4W92B 1FK9B 2BJEA 2H48B 3DI6A 2JC0A 2AJFE 3T3FA 2BJ3A 2MQMA 3H42A 1X0FA 4ZLJA 1LOUA 3LTOA 1RWMB 2CYYA 2C2DA 3SMZA 2R8IA 4OQJA 3ILLA 4HH0A 1C4AA 3BSCA 2OP5A 4QR2A 3QSYB 3BGRB 4ZVGA 2HHPA 2KZZA 2F65A 3KLIB 3FZ2A 2R7VA 4OZ5A 1RAIB 2IA0A 1VK8A 1OYEA 3JAMY 2MKCA 5G0RA 3F41A 1N88A 5B7WA 1NLKL 4M5LA 4NA2A 3G82B 4FNIA 4U7UK 1L3KA 2CPHA 2HEKA 5M2PA 4F3MA 2MLXA 4X2BA 1QM9A 2CJ9A 1T95A 5AE1A 3J81j 1FA0A 2G0CA 1F2GA 2V2VA 3CCUS 1XMQJ 5IQ6A 4HTJA 5HBMA 4GKKJ 2VG6B 3CD7A 3I96A 4PR6A 1GK8A 2RKIA 4EBDA 2R7TA 2HNYB 4OLOA 3LH2S 2V8DA 1QTNB 3KK1B 1N32J 2UXDJ 4KPYA 3BEGB 1U6FA 1R8CA 4QBUA 4KYZA 2BX6A 1HR0J 2XTJP 1XBWA 4OZ0A 1B0TA 1HBOB 2OH2A 2CJYB 3THVA 1KSPA 1UP1A 1IQZA 1JJCB 1JXLA 1CJVB 2CJQA 3KJVA 2DISA 1ZYQA 2BJ1A 1GXUA 4DV6F 4F50A 1DTTA 1SI9A 2CPDA 4MFBB 3TA0A 2VOOA 2CQIA 2JC1A 2OEJA 2OPQB 2C3MA 3HHNB 2WK4A 3TAPA 4ECSA 4RW6B 3QIDA 5F8HA 3ZZOA 1ZTTA 2P6SA 4LR7A 3KK2B 2AT1B 5D4NA 3R7BB 4NCGA 2AX1A 3N9UC 3MM9A 1CULB 1IKYB 3DCAA 2HK3A 3FK4A 4NZ7A 2BJ8A 4GVBB 2HBYB 4USIA 3UI3A 4CLFA 3TAMA 2CUYA 3R27A 3UN5A 2FVCA 3W5YA 2OJ3A 4OI1A 2RS2A 4K50A 1UFKA 4DR4J 1FNXH 2PA3A 1RA6A 3SDEB 2C3YA 1PKUA 2KL8A 2P9EA 2CZ9A 3QT5A 4B17A 4FBUA 2DH9A 4JI4F 3NGUA 2HYIB 2DRAA 2H1YA 4DV5J 2LEBA 1HBNA 3DLKB 3IR5B 4ZVUB 4UW2A 3W62A 2VASA 2CZVC 3BS9A 3MEGB 3K7RA 5B0FA 2MZ1A 3ULHA 1JLAA 3EWGA 3NXZA 3MFHA 3E8OA 3W61A 1XQIA 2WAQD 1UETA 5DG8A 1IVZA 1FTCA 4ZS6A 4I6YA 3HO1A 1U1LA 2G9OA 4ANDA 3W2WB 1WI6A 1F3VA 2H4YB 1DAXA 2PT0A 1IN0A 5H9EJ 1XWLA 1DZ5A 3QYYA 3K5OA 2K06A 4ZJOA 3Q8YA 3CJ2A 3ILJA 2GVDA 3NGTA 3MD3A 4PXBA 1PAEX 4CLLA 2RRAA 3C46A 1IKVA 1KTVA 2HVEA 1WC3A 3EMTA 3HJFA 3MPVA 2AMCB 4DEZA 5GVQA 4H4KA 3I4PA 2WB1D 4LFCJ 3AY0A 4NLUA 2AJ4A 3G87A 3P3DA 4ZVEA 5HMZA 3DLEB 3MMCA 1D0EA 2LLZA 2D3ZA 5A76A 2KM8C 1HD1A 1KHWA 2DHXA 1K1QA 4DR5F 4DUZJ 4I64A 1SV5A 3VAFA 1V9OA 2E5LJ 4X4SA 1QE1A 2YNGA 5E5NA 1KN6A 5A8RA 4LRBA 2UXCF 2E1RA 3IS9B 4FDFA 1PJ6A 1S57A 5KFMA 5GAGI 2GMHA 2C2KB 2KKHA 4MYUA 4RLEA 3SCJE 2JLGA 5DM7Q 1H72C 4MKVA 2QMXA 1FJEB 1VQKS 3C6TA 3AA8A 3UNGC 2JL9A 2MKKA 2KXNB 2R9LA 3I9V9 3KTQA 1Y3JA 2LEAA 4B3RJ 3IWXA 4IFYB 1S76D 2Y0SD 1SUQB 3EGWB 3C15B 3HKWA 5DDPC 2R8GA 3DMJA 5DM6Q 2I38A 2VIHA 3D0IE 2W9CA 5F8LA 1YZ6A 3KYLA 2WVDA 1PGZA 1FKOB 1OQ6A 1WHWA 1S1VA 4G3IA 2A10A 4ZLLA 1VIOA 3PR5B 2DB1A 4NOHA 2XG8A 4DHVA 4ED3A 3RRHA 2CJKA 3RR8A 1UAWA 1S77D 1KQGB 4ILMA 1G1XA 3M4XA 3NGSA 3O3LA 2MPUA 2JZ5A 2LQBA 2V5HG 2IDLA 3BR8A 4ITSA 3LANA 4TU7A 3OVBA 2KJVA 1X31C 1JLEB 4X66J 4QIWD 4OX9J 4C11B 1ACMB 5JMNA 4Y3CA 2D69A 5KFQA 1NJWA 4IRDA 3KLHA 3V4IA 5ETPA 3G8QA 2W7PA 4XDDA 3GV8B 3V2UC 5I3UA 2HAFA 2V0NA 1X5TA 1EJ7L 1NDCA 3C19A 3R5DA 4NLVA 5HP1B 5KAKA 1XNQJ 2EG2A 3LA0A 2HRTA 3OFHA 1Y9OA 4G6VB 5JUMA 3FSXA 1YJWS 3F0NA 2I6WA 1B4SA 3SI8A 1VK3A 2CPIA 3AH6A 4L74A 1S0MA 5D77A 2D3UA 3TW0A 3CTRA 3CVKA 3G6YA 5LMNF 2DR8A 5C42B 1VISA 3DLGA 3ITHA 4LR8A 1YIJS 4DX7A 2E5JA 3E01B 1UVLA 4MH8A 4TN2A 4CO2A 2M8HA 2VBYA 3UN3A 1SXLA 2BW7A 5DLFA 1FDBA 4WWSA 2QLXA 4OYIA 3M8ZA 2NPFA 3D5MA 2Y1IA 2AQ4A 4EEYA 1KLMA 2FJWA 4ED8A 4CH7A 3VR1A 1WKLA 1T9WA 1X9MA 3F44A 1NB7A 1TL5A 2MKHA 3M2RA 4NLQA 2F63A 4I2PA 4YY3J 2HFUA 3U1MA 5BXIA 4DSFA 8ATCB 4WFBQ 5LMNJ 5HI7A 1U6ZA 3HHLB 2G2ZA 1RWWB 1HPZB 4O44A 4DQQA 2FVPA 4NLSA 2ATCB 1NDLA 4ID5B 5GAEU 1YK9A 3MMJA 1IBCB 2JFKA 1DHMA 3OD2A 2L41A 3EPGA 5T7LA 1NKEA 1S1UA 4OZ1A 3KUHA 4FPRA 2LQ9A 3RW7A 1U1QA 1DFDA 3MCOA 5K5MA 1E6YA 4IDKB 5L39A 3BJYA 3JSBA 4F2RA 1RAGB 5KT2A 2QGFB 1VRTB 4X4VA 2ZH4A 1SH3A 1RTDB 4K2JA 1HQUB 2XYHB 1UJ5A 2FD2A 3AXMA 2AD9A 5D0EA 5CCLA 3HKZD 1UPMB 1V3ZA 4ZCKA 4FYXB 4ED5A 4CO1A 1DARA 4FF1A 2ZJPQ 3EZUA 2VBXA 4CRJA 4X64J 1NK9A 3TO8A 3T1YJ 4KKOB 4OZ2A 1NPKA 1TQLA 1MWYA 1TAQA 3HULA 5KG5A 3T9NA 2N82B 4IG3A 1GEHA 3M9MB 4IOAQ 4Q2MA 1SQEA 2V4JA 3JB9k 2GS8A 5B0AA 2F7VA 3S7RA 2J0QD 4F4ZA 2VFRA 3PW0A 2RQCA 4FS2A 2YQ1A 2OPPA 4QCLA 3DN9A 1SKWA 3R1HA 1AUDA 4X62F 3U02A 4QWBA 1T11A 4H4MB 1K47A 4WYWA 1O51A 4C6AA 2IHR1 4MK8A 2BE2A 3TZYA 3NGDA 2HHXA 1TL1B 2KT2A 2A2DA 3FQLA 4OX9F 5F8IA 4DR4F 4IQMA 4J9LA 2CXEA 1Y5LB 3LUYA 1O0PA 2CWKA 1JLQB 1QAJA 2I9SA 5F9NA 1VQNS 3CULA 1BQMA 4MK9A 1TKZA 4U96A 2P8IA 1RK8A 3SCLE 2IDEA 3TQEA 1S49A 1YVFA 2ROPA 4OYMA 4DFKA 1QVGR 4EBCA 4B9NA 3G86A 1SJ4P 1SIWB 4DU7A 4CLWA 3SBMA 2RD5C 2W9BA 1SPBP 1RYSA 1H2TZ 3UPFA 3P6YC 3QJLA 3W8PA 1U47A 3DLGB 3ITHB 5DS7A 3TI0A 4B9MA 1UTAA 1IKXB 4KGXB 4I68A 4RW8B 1NK7A 4M95A 2DNQA 1RT6B 3AQPA 3UCZP 2ALYB 1GFWB 2YKNB 4RW7B 2BABA 4DQPA 4ENOA 2HHVA 2UXBF 2ZH1A 3AB4B 3MMBA 3PKMA 3QIPA 3GIMA 1LXJA 4CNZA 2V2ZA 3KHGA 4Q8FA 4B3SF 5KFSA 2LQ5A 2QMUB 3HSJA 5FIIA 4DLEA 3GFHA 4DPYA 3QRRA 3GSIA 3AT1B 3MR7A 3ILIA 2B4UA 5A2QY 4F4YA 2R7OA 1CC8A 2HFZA 5E3RA 1WWHA 3QO9B 3Q8PB 2R2TA 2VV5A 4A48A 1P9QC 1FFSB 3IG1B 4LFAJ 3UFCX 1UA1A 4I56A 3ZTRA 1T3NA 5T14A 1IWGA 1RBLA 4TVAB 4BWMA 3IP0A 1PJ7A 5E3CA 3H4DA 1HI8A 3PACA 1X5PA 2GQQA 1Y5IB 4M5HA 1WG4A 1HIYA 1S10A 1F0XA 2JSXA 5KFYA 1J5OB 1RWKB 2J9DA 2ZH9A 2W4PA 3D2WA 5HQ8A 3GV5B 4LF5J 4LF8J 5KFHA 1YZ7A 2E1CA 2J6SA 4DV1J 1BQNA 4DCPB 1PBUA 2VG6A 4MIWA 5MLCV 3J7Z5 1I94J 4MIBA 5F3TA 1VJWA 2CA9A 3W9JA 3UCUP 1B0PA 3G9CA 1JLCA 3TX0A 2YWWA 3G71S 2OTJS 1M5OC 1JQGA 1SJRA 3L9ZA 3DYAA 2J0SD 1AW0A 2FJDB 1GH8A 4OIXA 4JI1F 3OBIA 4PQUB 4ZIWA 3NCPA 4ICLA 4C3LA 1HL6A 3V6KA 1XJWB 1SJ3P 1YJVA 3HJVA 3TVZA 3UN2A 2N3OA 1APSA 4ZA1A 2MTLA 3GONA 5RUBA 3V6DA 4YR2A 5BR8J 1KD1T 3MURP 3HVWA 3KJVB 1C1CA 1NJYA 1H38A 5C7PA 4FYWB 2E9ZA 5GADU 2NUUG 4Y2MA 1S1WA 4LF6J 3MAAB 3OT9A 3DRPB 1Q81T 4PPZA 1A7GE 2Z2ZA 2VF3A 4RUAA 3KJNB 3VQSA 3FRYA 4F26A 3BO2A 3KG0A 3BGLA 2E44A 3RB3A 1YBTA 4OFZA 1F5BA 1HMVB 3PW2A 1REVB 3CJKB 1T94A 1T9VA 2PA8D 2QMWA 1UVMA 1GMWA 1XK8A 5ETTA 1KBRA 2VICA 3S1TA 2IBKA 4QPXA 4N8NA 3VQTA 1BE4A 2XS7A 2ZUAA 2WSFC 5GMEA 3X3UA 3KNGA 4ZHRA 5HLFB 1YJ9S 1HWJA 1TK0A 1GTHA 1DLOA 2Y8WA 1IKWA 2GNKA 2XWXA 3R6GB 3MZIA 5BYQA 1RT4A 4X4RA 1JIHA 2HAIA 3VZIA 5DDQC 2GVZB 1MSWD 1WD6A 4YB5A 5K8NA 4ED6A 1NJZA 2AJQA 2B51A 2ZNYA 4LF4F 5B0CA 1SH0A 1CSJA 2RRBA 2HHQA 1K0TA 1F2HA 4B3OB 2ZZMA 2HS3A 4DPWA 4M5MA 4RZRA 3K58A 2DT9A 2XYPB 2VA3A 1JLGA 3Q2TC 3W5XA 1QSYA 3UD4P 1FESA 3DU6A 3DOMA 3WC0A 3RG6A 1RTJA 2FJBB 2K1RB 4TXSA 2V4QA 4JI3F 2QL7B 2Y1RI 1X60A 4R5PB 1KRPA 1F5AA 2MQLA 3BGOP 3SQGA 2L9NA 1KS2A 2JVOA 4E0DA 1RQ0A 4G1IA 1RHMB 1KP6A 4YOEA 3I87A 4RWWA 4DQRA 4C0HA 1NEEA 4NXMJ 4I67A 3BGFA 4LMZA 2AEFA 1SV5B 1K1SA 2HSEB 2L9DA 3D1HA 2UVUA 3PO4A 2AEMA 2XSJB 4LF5F 3J7A1 2LFVA 2LXFA 3DRRA 3FQKA 3VGSA 3H4BA 2WRMA 3U27A 1S5ZA 2ZJQQ 2ALZA 3EXYA 3R5JB 1XIQA 2H3EB 2SXLA 4PG4A 3J81Y 2WBRA 3N6LA 5JVGQ 1Q7YT 3CJ3A 5HJYA 2HQGA 5CXTA 1X4FA 4DFJA 2AP6A 1RU1A 4KV8A 4LIWA 4CO4A 5J1EA 3EVOA 2M7SA 2D1CA 1S9EB 2PI4A 4TY8A 2JX2A 4UUWA 5DDRC 4I6AA 4ATNA 3V6DB 4FF3A 2IJNA 3KXDA 2Z0GA 3BQ2A 3CD6S 1FVSA 2V9KA 1FXRA 1N48A 4BC7A 3MAAA 1TUVA 2ZWOA 1U8WA 3OSPA 4NI2B 3QMQA 4MKYA 2OD4A 3U1NA 3VCDA 1RAOA 2HG4A 4DCOB 1R7IA 1LXNA 4Q0BA 3B4DA 2LMIA 3I32A 2WTFA 3AFGA 4J9SA 2ILZA 1Q1KA 4DOZA 3TUJC 4C11A 5LXYA 2MQOA 2DEIA 3K5LA 4NYPA 4V1Ak 1TKXA 1T9UA 4WYLA 4DR5J 3BDPA 2EC2A 4D3HA 4J9OA 3RB0A 1VQ6S 3PEHA 2XNQA 5C25A 4P2XA 1Y5NB 1C0UB 2XHCA 3ISNC 4F3QA 4ZVQB 3OUYB 1RT2B 2H5EA 2HFSA 3CJ0A 3FBBA 3K17A 4BCAA 1EP4A 2F4FA 2RE1A 3IXQA 2YTCA 4ELTA 1NCLA 3ENQA 4Y6IA 3FEXB 2IBOA 2MEWA 5DQGA 5AJ3J 3BZQA 5C42A 4WKRA 3BB5A 4Y2IA 5CAAA 2JEIA 1HI1A 3PHTA 4B3OA 4JYAJ 1UMJA 4CH1A 3AAWB 3BSAA 4ANCA 1CG2A 5IT9U 4ED7A 5CD4A 1R0CB 2EFNA 2RQMA 2RMLA 4TNOA 5EX3A 2YPYA 3QRQA 1SIZA 3IRXA 3W9IA 5FLXY 3TQ1A 1NHVA 2KB2A 4I2PB 4KT0C 2CQHA 2MZSA 2MY7A 2VFTA 2FLNA 2LKZA 1FNMA 1HWLA 3M8YA 2J0WA 5IC4B 1N6QA 3HSGA 1FK9A 2V4RA 5A8WB 2RDJA 1VQPS 1PG5B 1ZAWA 3H2VE 3VAHA 2XS5A 1ZOTA 1WI8A 5E7OB 2CZ4A 5T7LB 1I94F 2HVDA 3CC4S 2F1FA 2RIJA 1EB0A 1H7WA 4NMLA 4DX6A 2KJWA 2RUSA 1QLNA 4G1QB 1RP5A 4ZKAA 5KG6A 1TK8A 1HBUB 2YH0A 5HJXA 4NASA 1SQFA 4YB7A 4LREA 2IRYA 1NK6A 2XNRA 4RNNA 2ZE2B 3G82A 4CNYA 2ZBIA 3OTDA 5EHHA 1C1BB 2VH7A 4RNMA 2CNLB 1IBLF 2BV3A 1SC6A 1R0AB 5D4LA 1RTHB 1OPZA 4DL5A 3G6XA 2D7SA 3Q8QB 2Q6BA 4Q7AA 1F9EB 2W01A 5GMKa 3OQ2A 4TYBA 1UL3A 2KHDA 4HVZA 1KR4A 1C0TA 2ZH3A 5D8HB 5CYMB 3I4HX 3GCXP 4DUZF 1YGYA 2NXCA 3ZXWA 2OPSA 4N56A 2AYGA 2DXEA 1CEZA 2RILA 1L3TA 3JQJA 4DSKA 4BBYA 5T41A 2DCUB 4UOFA 2VONA 2DNKA 1S7IA 4ETZA 3G8TA 4XPCA 5IC6B 2WCXA 1H2UX 3H5UA 4ZVRB 5IS2A 1T8EA 3D1OA 2UUWA 2FYXA 3SYZA 1WDTA 2MKYA 3DDKA 2NQPA 3HLUA 4HT7A 3TUPA 4DCJB 1RTIB 1TP7A 1GXLA 2P9GA 3JSMB 1CC7A 1NDKA 4J9MA 2AV5A 2KH9A 1VQ5S 2HQIA 4LQ3A 5LSLA 2DVIA 2YX7A 4LRDA 1NUEA 2XSFA 4LUBA 1MU2B 2CQ3A 1OSDA 3Q86A 2C22A 4LF2A 2E5IA 5J2NA 5LSRA 4U7UD 4ZCMA 4K8RA 1U2RA 1XR7A 2ZJRQ 1P1TA 2V8PA 4Z37A 4OV6A 1Y3KA 4QR1A 1TFYA 2EPIA 2YKPA 4X64F 1RT3A 2IJRA 3HZEA 2QT7A 1OQ3A 5HK4A 4C8ZA 1HYSA 1YJTA 3MM6A 3N6MA 2YX1A 4M5IA 1HBMB 4A8MP 2UVRA 1M5SA 3NNCA 2Q3PA 2QIFA 4I69A 2UUCF 3JYTB 5A2QU 2C2EA 4KHPJ 1FE0A 3NNHA 4YUDA 4EGLA 3TA2A 5FLXU 2RU9A 1FKAF 3OR2A 5B0GA 4S0MA 3DHXA 2IM0A 4BLGA 5DGBA 1U6BA 2M70A 2WB4A 3PM9A 5EWGA 2CADA 3KJQB 2MZTA 1S6QA 3TEGA 1KOHA 2CPZA 5H1SV 2G4BA 4IH5A 2A0FB 2MLZA 3AHPA 4IDKA 3ZNJ1 4Y00A 2HIYA 3MECB 2B7CB 1R6YA 1RT5A 3FCHA 3NOCA 4QYRA 5HMXA 3SZ2A 4JB8B 4L76A 4KY3A 3TUZC 5IT0A 3PW4A 5EX0A 4KE5A 4C3KA 1Y0HA 1WSRA 2F8MA 2NYIA 2VL1A 3EVWA 1KQFB 1V6HA 3IG1A 4DPTA 3G6VA 3FZBA 1T03B 2PD1A 3BR9A 5CYQB 1R8PA 1ITPA 1WTBA 3EGNA 1X4EA 1WKJA 2HZAA 1U49A 4IFVA 4KGMA 4KHRA 2GVDB 5IXUA 3MR6A 4AL5A 2VPYB 4DN0A 3L4BC 1SKSA 2N7YA 2RQ4A 2ZE2A 2CNNB 2YWEA 3ZTOA 4M5DB 2ZH6A 3MHYA 1JJ2R 3FKBA 3IFEA 1VR6A 3CDUA 3D3CJ 1RHKB 3M6WA 4P6QA 5HVGA 3CO0P 3KLFA 1WF0A 4QZVB 1LW2B 3LW5C 4KRWA 2CFXA 2FB0A 2MXYA 5EN1A 1QJHA 1EKRA 4V19J 1NK0A 2HWIA 4EUVA 2MSTA 1RHJB 2EKYA 1TR0A 2IM2A 2QTWA 1S99A 2V8VA 3PJWA 1HKAA 4WP3A 1XNRF 4KJIA 1LKZA 2PC6A 3RBZA 3CJTA 4H4OA 2GFFA 4ZJQA 2AKWB 1H7XA 2OMLA 4IG0B 5KFTA 1FWLA 1W26A 2NPIA 4YEAA 1H74A 2G2YA 1JB0C 2J8SA 1RWNB 2NUHA 3OTBA 2V34A 2OSQA 4IO1A 1FXDA 2DIUA 4DJBA 3A1YG 3CF5Q 2PE8A 1U09A 3R3TA 2W9BB 4OJ1A 1FE4A 1FRIA 3DLBA 5IZHA 3Q83A 3LGHA 2B9XA 3PYGA 3AQOA 3DU5A 1YSJA 3DFEA 3AOBA 4OZJA 2UU9J 1N0VC 4GVLA 4LSLB 1N5TA 1RT6A 4JI4J 2HHTA 2VJVA 2ZHAA 5H9FK 3M1VA 3KLEB 4P75A 2R8JA 3NGKA 3OTEA 2QSFA 2G1HA 2MGZA 1UPPA 3KHLA 1HYSB 3D9BA 2YQ0A 1SL0A 1K73T 3EZ5A 1F60B 1JKHB 3LP0B 1RADB 2DH8A 4IKAA 2DKOB 4PPDA 5JJBA 5ITHA 4QU7A 2BA9A 4OYWA 1BXNA 1H0HB 2VPXB 3UDVA 1RWVB 1A6LA 4PUOA 2VDIA 2KFNA 3KUGA 1NO8A 3G2XA 2EKNA 4ZJLA 3QZ7A 3AJDA 3OJSA 2DRDA 3GIIA 3BSNA 2QV6A 4AL7A 5GAHU 4ELVA 1MROB 4QYZJ 1S6QB 4ZVSB 3FJ2A 5GAEI 4UY8T 4R0EA 5DLGA 2J7KA 3WIVA 3ZZPA 3THPA 1HWIA 4DF4A 1FRXA 3HXMA 4DS4A 2IC3A 3EGVA 4LVOP 1KVJA 2VFVA 4QIVA 1WHYA 2OSRA 2GGPB 3CCMS 1S0VA 3E01A 2YX4A 1AT1B 3GWCA 4W98A 2VC0A 3OHBA 3BQ0A 5AE2A 4Q8EA 2GQ2A 2Q6CA 1J5EF 1OY6A 2B7BB 1UEVA 4O0IA 3EXCX 1O8BA 2FQQB 2Z2YB 2HBQB 5CYJA 2C3PA 4RNOA 4DR1F 2ASJA 4F0KA 4N76A 4CM2A 1BLUA 3NEKA 3M2VA 3NS7B 3PYFA 1MMLA 1M1GA 4A8FA 1UWBB 2MKIA 1D9DA 2KVIA 4BWJA 2OIHA 4EO8A 3HHLA 6AT1B 2F8EX 1SKRA 4QPTA 2IVYA 3SSSA 3UDLA 3H7HB 3D7SB 4L6V3 2XSJA 2GZOA 1GMUA 2OEKA 2WHOA 3Q8UA 1ZPWX 3D4JA 4KFBB 4OHVA 1Q86T 2FJXA 2EW9A 1Q0NA 2YY3A 5HMWA 3ZZYA 4Y2AA 3DGPA 1CJTA 2BANB 3OUYA 2VQEF 4JI2J 4OHZA 1JLFB 3T9ZA 4DG1A 2QA2A 3JTNA 5L46A 1VQMS 2XMMA 2EK1A 3D6TB 1UA0A 3S6EA 4OJGA 1I3OB 1IUJA 4KGVB 3TAQA 2GV1A 3PRDA 2K3IA 4FKXA 5A0YA 4DU8A 1U1PA 1D1UA 1K9MT 2UUAF 1E6VA 1GT8A 3QT7A 4YB6A 4ECXA 4DFPA 2CPJA 1N33J 1B7YB 2VG5B 1SL1A 3H5SA 2UUBJ 1CJKA 1LWEA 5E33A 4ZMMA 3KHHA 2E66A 2B4VA 4JI2F 4MT1A 3THTA 4ALZA 4DV0J 1RI7A 3GZ7A 1BWEA 3H2UB 1EETA 3R5CA 3CPWR 4NLYA 5LXRA 2AYMA 2WBMA 3B6BA 5LMUF 2F5GA 3CIZA 3HFVA 3TUIC 5L9NA 1IKWB 1MMDA 2BE2B 4ZITA 1RWPB 1SB6A 5EWFA 2W4CA 1JJ4A 1S97A 5DZ7A 4C9DA 1F1BB 1NHKL 4AXJA 1CQNA 1S7HA 3QQCD 5FD1A 3CW2C 1VQSA 1OSCA 3N6NA 1S1XB 2H9ZA 3JQKA 2E7VA 2BKPA 4OZNA 3SCIE 4OX6A 4F0MA 2GIQA 3A3OB 3GLJA 1TUWA 1H2VZ 1XN9A 4K2XA 2LDIA 2I8EA 2OPRB 2Y1LB 3QSIA 1JLBA 3GJTB 5B0DA 2KG1A 1HW8A 2DH7A 3VGVA 4WE1B 4K4YA 4BDPA 4ERDA 2DNOA 3BKTA 2IC3B 1U8SA 2MSSA 3JTOA 2XLIA 4ED1A 3GTYX 1IM4A 2QL5B 1VC0A 4R8UA 1TL3B 4Q2LA 5FJ4A 2YNFA 4NMXA 1R8BA 3CD5A 2EBGA 1Q8KA 3KDOA 4USHA 4FPIA 4QIGA 4O3PA 4FBTA 4KQZA 2BOAA 4B9SA 3ADAC 4PG6A 1PYTA 5BYRA 4JI6F 2GJIA 3MOZA 3TZWA 3RB6A 2Q79A 1FRMA 5KFAA 4PABA 1LEOA 3VVTA 1XMOJ 3WQPA 1GMVA 3HI9A 2XMVA 3NLCA 4QWCA 1Q16B 3W2VB 2HFVA 4F4AA 3FBFA 3NNAA 4X4NA 4NLGA 4KV8B 1LWFB 5F41A 1Q53A 3PZPA 2H5IB 3IA0A 3QGGA 3DGPB 1VGYA 2E1AA 4DG1B 1SJ1A 3HHKA 4RU9A 1G4CA 3OL8A 3UVJB 4N5SA 2HHWA 3NCQA 5F0WA 4JI0J 3BYPA 4RBUA 5AE3A 4WJBA 2XO6A 5FDLB 5KFIA 1R43A 5A0YB 2R4FA 1VDHA 1E6VB 3PKYA 1FX4A 3U1LA 3WX4A 1JX4A 3X1LB 4I6WA 2BKNA 2QC3A 5EDWA 1UW9A 2M9KA 5KG4A 3UW1A 3HVAA 3KK2A 4F3OA 2ZZNA 3FRZA 3LPEA 5KG7A 3QLHA 4O4GB 5AXNA 2UP1A 3IS9A 4DV3F 2U2FA 3I0RB 1ZETA 3T41A 3MPYA 1P6TA 2MKSA 1ELOA 4LQ9A 1CS4B 3A8IA 2HQ3A 2OLWA 5HO4A 3HFKA 4ICLB 4ZCLA 4CTAB 4ILLA 1FRKA 4MIAA 2OHDA 3BBCA 1BY9A 1N5SA 1U0HA 2C3OA 3CGIA 2GJ2A 1PSDA 2JH3A 4RBTA 3HP6A 1VQYA 2J7WA 5HSPA 2Y1JA 4ES2A 4HKQA 4XTTA 5CA5A 4A8SA 5L1IA 1NMEB 4B3MF 2ZZTA 2DGWA 2HRUA 2QLBB 4DUYF 1S72S 3DM2A 1BD6A 3N4WA 4NRUA 5DG7A 5F8GA 4MAKA 4J90A 3TZZA 4JI5F 4OI2A 4UZBA 5KFWA 2RDIA 3KLGB 2DHAA 2RUGA 3AB2B 1RT3B 2QYGA 3OFEA 1S59A 4Q45A 2PMWA 3NBPA 5IT9Y 4A46A 4RUCA 1NK8A 5KFRA 3CC2S 4AQYJ 4C8OA 4IR9A 1HWKA 3KLHB 3FFIA 1HLWA 3Q23A 4P72A 1B3TA 2B5JA 3PYEA 4YMEA 3VWSA 4HTIA 5IV3A 4Q44A 2HPUA 3KG4A 2FVSA 5E41A 5D3GA 4QR0A 2V94A 1TMMA 1PC5A 5KG2A 2P5VA 2MZQA 4WF9Q 2E29A 1CBKA 2XMUA 5HQMA 1MN7A 4AYBD 1IJEB 1RT7B 2BE7D 1ZAXA 1HQ2A 1QE1B 1RA7A 1U7LA 1NSPA 3GFZA 4L75A 3GIKA 4JUZA 2R8HA 1KONA 3DXSX 1S79A 2XI2A 1FDAA 1PJ5A 1YRXA 3G4SS 2CQPA 2P9CA 4FN5A 1SC4B 3H5XA 4J9KA 5HVHA 2IAJB 1RAEB 2WSEC 1N5YA 1U0SA 4OI6A 3AA9A 2FLPA 4L3NA 4EU0A 2W2OP 3GG1A 1M5VC 2JWNA 1SUQA 2KXHA 3KLIA 4WK3A 1FJGJ 3SFUA 1SL2A 2DHHA 1R3NA 1R6VA 1DBDA 2IY5B 3ETMA 2GIFA 1HNVB 5G0RB 4P73A 2H54B 1WHVA 2FC9A 1MLAA 1S1VB 2VKZG 4R25A 4WFAQ 2O3DA 3EX7B 4KB7A 4JI7J 1TZ0A 3KKFA 5IM0B 3V6HA 3LO3A 3KLFB 1ZH5A 4KAIA 3OTOF 3CMAS 4UQGA 2CPYA 3ICLA 3OFFA 3PRBA 1YITS 1HNXF 1YX2A 2WONB 2GHWA 1XC9A 1CLFA 3PYDA 3E2EA 2FIUA 1YRUA 5IQQA 3UE2A 1NBEB 4K4SA 2DGOA 2RKIB 2V67A 2OGUA 1VBXA 3CUNA 2Y0BB 5HMYA 3R9LA 1HNWJ 3JSMA 1LNQA 2VJUA 2BBEA 3EDRB 4C8LA 3CCTA 4AFFA 2QX0A 2DR6A 3ISND 3I56S 4CO0A 3IBFB 1UVNA 5J2MA 1AUSL 4L72B 2NSCA 4DV7F 2A3JA 1Q82T 1V3SA 2WVCA 1T9YA 2CDRB 1RCOB 2KRRA 3MF5A 2QFIA 2M52A 2OFHX 3WZ0A 4I7FA 4H4KC 2YWHA 2AEJA 2ZOFA 4NZ6A 3K57A 2AJ1A 3US5A 4NI2A 4OHWA 2VPZB 3GG0A 4ZCIA 3P5BP 2KT5A 3M8RA 1DRZA 2IA6A 2ZKUA 4AXIA 4ZPCA 3PW5A 2XMTA 4IYQA 4K5RA 5EWEA 5JVHQ 1ROFA 2QA4S 3GYNA 1UVJA 3BSOA 4LF7J 1KLMB 4RPFA 3FSIA 4H4MA 1URNA 2GIRA 3QGPA 2VFUA 3HD1A 3IR6B 4NX9A 4ZPVR 1TL1A 4UT4A 2C2ZB 3MPDA 1NKCA 3RRGA 4RO0A 4K4TA 4HHUA 1RBOB 2GW8A 4NEZA 4USWA 4CLZA 1B7FA 4DV2J 2HHHJ 2HRYA 3RU0A 2O5DA 2AZ3A 3MR5A 2CPXA 3T1HF 1IBMF 4MMOA 3I5CA 4OX8A 5D3GB 4OZLA 4WIQA 3MECA 5GMDA 2H65B 1DQAA 2AF6A 3GFXA 4WZQA 3LWMA 3MUMP 1Y4ZB 1X4DA 3QT6A 1PYOB 2BQ3A 1T03A 4OYOA 3DOLB 1FNOA 2W7OA 4ETXA 1JJHA 1QD1A 1WKKA 2V69A 3ZZUA 2NXJA 3M05A 3C14B 4C48A 4ZK7M 4M5KA 3VAGA 3L7UA 5DG9A 1N5YB 2APOA 2I0XA 3MMBB 4X4TA 1FHTA 3OTCA 2YNIB 3EJMA 5HVFA 1UW4A 1KOOA 2HGMA 5ETLA 1FTRA 1RT1A 4B08A 4KGZB 5CD4H 1VQ4S 2QG9B 3ZZTA 4F4KA 1U1OA 1Y00A 1VIXA 3CSKA 1VS3A 3DDNA 3GJQB 4MKAA 4N77A 3EM1A 1VYAA 5KFXA 3DLLQ 4ZOSA 4Z7YA 3QNWB 1X4BA 3GFYA 2DHGA 4WFXA 2E9RX 2JOQA 4MJKA 2AGPA 3MD1A 5F8NA 1LWCB 1Q79A 2LQJA 3RB4A 1S6PB 2R2SA 4HR2A 4J91A 3GQCA 3PW7A 3MAHA 3BPSP 3OL6A 4IG0A 3TZXA 4HH1A 1U24A 1L3SA 2VQFJ 3BGUA 1MWZA 3LP2B 4ED4A 1I5OB 4P71A 4XDCA 3RYLA 2YKMB 4CM0A 4JV5F 1MW7A 2YQ3A 5ADZA 3FGVA 3T1AA 3MTKA 4DQIA 3Q2SC 2FTRA 2DK2A 3GSDA 3MM8B 1TU0B 4WCEQ 2PFFB 3CNQP 3N01A 2FGOA 3HVTB 4P2SA 3TVYA 3BO3A 5MAOA 2KT3A 5KG1A 4PQAA 2ZBCA 3M8QB 4CI0B 1SJFA 4DZ6A 4RNFA 3FMWA 1VOMA 2CQ0A 2J9EA 4PG5A 5L1JA 1X9SA 4DXLA 5ETOA 4OHXA 2C2MB 1OYDA 1R27B 3P45B 4WPAA 4FZVA 5BR8F 1IR1A 1WF1A 3G96A 1B64A 3ISZA 1FRJA 1CULA 3C6UB 4GVBA 3R97A 4NYZA 3TAMB 5D6GA 4J9RA 5I4MA 4ECTA 4WBFA 4HT5A 1FJCA 2PEHA 1OIAA 2EBEA 3QIPB 4G1PA 3CJRA 3A8EA 3MWBA 3OXLA 4EI2A 1HR0F 1S6OA 2Y8YA 2UUAJ 1TFWA 4UTGA 3NMAA 3Q8SB 1TAUA 4ILRA 2R42A 4WP8A 2A2CA 4K7QA 1S1TA 4OHYA 4HDHA 3D0HE 1GQEA 1TL7B 3HDSA 3NS5A 4NL5A 4X84A 4DR2J 1F9FA 2XCPA 3VGTA 5HP1A 2J6TA 2FLLA 4DZDA 2DPJA 1MU2A 3C66A 3OVAA 5J2QA 2ZHOA 4B9UA 3PXGa 2E1MC 3SQOP 5DZ6A 5KFPA 4DWIA 3MPWA 2WVFA 3OVSA 3C3LA 3RR7A 1JLBB 1RUSA 3CJKA 3ZZRA 1VRQC 2CAJA 4DV7J 1EAYC 2HS0A 4WE1A 2C3UA 4GMKA 2DNNA 3HMJG 4DX5A 1N52B 2LA6A 3M8PA 2Q1LA 1MMNA 2BKOA 3ETOA 4NLOA 5K14B 3MUVP 1YBUA 2ZNZA 4QJVA 4F67A 1HNIB 2GC8A 2PI5A 4TY9A 2B9WA 1R8HA 3CXCR 1D8ZA 1RSCA 1UEUA 2MZJA 2HMIA 5DQHA 1OPIA 4CP5A 1TV6B 2PN6A 1RT4B 1KQSR 1KLNA 3CMES 4X65F 1KNZA 3BH6B 4TQRA 3DRSA 2POKA 2PSZA 1UZDA 2VBZA 1VHFA 4Z2XA 1IBKJ 3OLAA 1X4GA 3CC7S 4DR6F 3P4UB 3TWZA 2AJ0A 2VD3A 2XGQA 3VTIA 4Y2CA 1FKPA 2CQ1A 4M1KA 1D9AA 1R8AA 4P74A 3BGRA 4CO3A 4CLKA 1VJQA 1FWPA 2LDYA 3K2YA 3C6TB 3ZTSA 3MAQA 3M32B 4FF4A 4QYZK 2D3OR 4ZLNA 2FY1A 4O3NA 2X7IA 3PX4A 3UVJA 3LP1A 3M8WA 3MEDA 1U1RA 2XM3A 3I5BA 3TYTA 2OELA 4NRTA 4DPXA 1AA1B 3V81B 3Q24A 3H8YA 3VHQA 4TU8A 2J8AA 2FJEB 3NAIA 1P27B 4ZPAA 2J9CA 2MZRA 3IWLA 5DJBA 1HFEL 5IV4A 3VAMA 4FS1A 2LA4A 2BDPA 1Q5YA 3D28A 4B9VA 1SC1B 4LFCF 4M8LA 1HMVA 4UQTA 1J2VA 1RU2A 1S4FA 2M0GB 3M7VA 4ZN1A 3BREA 4IG3B 3RBEA 1NJIT 3M2UA 2V4JB 2ADCA 3P96A 1CS4A 3RBXA 2WW8A 3PO5A 3CDEA 2CJBA 3PR4A 2Y3YA 4DL2A 4PWDA 1RWXB 3I0SA 2HVZA 4O23A 2Z4PA 4FYYB 4OYAA 4CQ1A 4F25A 3CCQS 4RX6A 5I3UB 2MHEA 2GAHC 4NA1A 4B3SJ 2F9DA 4KHMA 4ZP6A 1CJVA 1IR2A 1H3DA 4LR9A 3E51A 3OLBA 1ZZFA 3HPOA 4WU3A 4X4UA 1Q8IA 2CJXB 4PYAA 1U2CA 1VLOA 3CT9A 2KO1A 5CZVA 1U48A 4JV5J 2K3KA 2BM1A 2L48A 3PG9A 2KG0A 2X3DA 5CH7B 4CT9A 1JLGB 1M5HA 1FJGF 2ILYA 2DD8S 1KTQA 4XAKA 1F3FA 4W90B 4NCGB 3J80U 2MQ8A 2QRRA 1PYSB 1UZHA 2NYHA 3MMAB 2ASYA 1IKYA 2NS1B 2W9AA 2MGZB 2BE9B 1HARA 3T1YF 4KBIA 2ROGA 2JRSA 4M63A 3A3PB 5K8PA 3SV3A 5KFJA 2KFYA 4B9TA 4LSNB 5C25B 4ECUA 3KOAA 1FF2A 2F40A 1C0UA 3R5GA 5A8KB 2RHQB 2VFSA 2YKNA 5C2CA 4Y0FA 2AZ1A 3DI6B 4FKYA 2IMOA 4AT1B 2WVEA 1EP4B 2OMOA 3UR3C 2ZVIA 1RE1B 1TV6A 2HNZB 2DGVA 1K0VA 1RHRB 4JV1A 2RU3A 2Y9HA 3MEGA 3PFOA 1WHXA 4NLXA 4X62J 5KT3A 5E3PA 2RF2A 3EUNA 1JLAB 2Z56B 3KWMA 5IOLA 3MFIA 5HATA 4N47A 2NLWA 1DQ8A 2OUGA 4USUA 5KFZA 3W2WA 1VC6A 4JV0A 2B8PA 1U02A 1S9EA 3IM9A 2Q43A 3M32A 5CZXA 3HM9A 1ZAVA 4OJ3A 3E3XA 4ZP9A 3EGZA 4U7CA 4ECWA 1GXTA 5HBMB 2JEFA 3KNAA 3SIPB 4KKOA 2CRLA 2UXDF 1N32F 4O3RA 4DL4A 3M2VB 3NS6A 4DF8A 2OKQA 5K8MA 2Q66A 3V81A 1ZA2B 4CWBA 2ZDPA 3DLEA 3MMCB 2HLTA 3NWGA 3TJ8A 9ATCB 3RGIA 3FBCA 4C98A 2FVQA 1H6KX 1WF2A 2DO4A 2V63A 3N0VA 2HKEA 5LSOA 4PZVA 1CPZA 4EK2A 1NKBA 1NM2A 3BYRA 2CQCA 2RDDA 2JJ4D 4C2MA 1R0BG 1JLCB 4X4PA 1LV5A 1U0HB 4PRFA 2C2OB 1JK9B 2ABYA 4KGKA 3K5PA 3A8JA 3AOCA 4LBHA 4TYAA 4YDDB 2DBBA 5AXMA 3O6QA 3VZHA 3F73A 1Y11A 4IH7A 4MTPA 2A6OA 3C15A 1JLQA 3DM2B 5ETRA 3RZAA 1BQMB 1RISA 4Z7CA 3K89A 4DL7A 1S12A 2YWFA 5GADI 1IWAA 1W25A 2V9WA 1WG5A 4OYBA 2VHGA 3GPAA 2VKRA 1YJ7A 4UUXA 3GB0A 1D09B 1REGX 1V3RA 4P9SA 5L8RC 2W8KA 2AGOA 1UVIA 1HNZF 2DNGA 3W65A 1J27A 3MUTP 4RU2A 2QA4G 1N5VA 2RRNA 5IWAJ 3PRVA 2JLEA 3CWJA 3IR7B 4NA3A 4AUKA 4XPEA 3B54A 2XY7A 3H2LA 3P8BB 1X4CA 1YTYA 1NH7A 2YWKA 4RW7A 1K44A 3BH7B 3OR1A 1S0OA 2Z2LA 1RKIA 3IC1A 1DTQB 1TKTB 4JYAF 1VBZA 3J7YU 3CJQA 5I42A 2B9EA 3UO0A 1TTHB 2M3DA 1N36J 3M6UA 2B43A 3KLVA 1HNZJ 2KN4A 3L7PA 3IAM9 4CYUA 1MWQA 4DUYJ 1BQXA 2GMLA 1UJ6A 1X8DA 2KHCA 4BHQA 2EXUA 4BS2A 4NZ0A 1RGVA 1EQ0A 3QATA 3MR2A 2DITA 2RF2B 3R5AA 1V5VA 2OPRA 3TOQA 1HBUA 1PCAA 2HFNA 4R0JA 3MM6B 4DX8H 1U1MA 2UXCJ 4EMDA 4WIIA 3K8VA 4YR0A 1Y10A 1TUGB 3RW6A 2BEFA 3D3BJ 2R7WA 4ES3A 3TVKA 4NXNJ 1C1BA 2CVEA 1TL3A 4Y34A 2YBVA 3FSYA 4ZPTR 4Q43A 3DOMB 3IGNA 1B0VA 3Q8RB 4GC7A 1U1NA 4R5PA 3M2RB 2MYFA 1JMTA 5F8MA 4DMZA 1TELA 3L95X 2M2BA 2WOMB 4DN9A 4DSEA 1CQMA 2DY1A 2C2RA 4LIRA 2F8HA 2MY8A 3GU0A 2ZM6F 2XC9A 3OPKA 1T9XA 3D6HB 4HI2A 3QWPA 4HHHA 2IIHA 3PIOQ 2DR7A 4DR3J 3DOKB 3CD0A 3HSDA 3J7YI 4O4RA 1TKDA 4HEA9 3DRRB 3DXBA 4GRSA 5J2MB 2Z2MA 4J9VA 4HDGA 4DFMA 2Z30B 3CE8A 1YDLA 3CCWA 4DV0F 1OWXA 3C8YA 3PJXA 2AYBA 2VOPA 2DGQA 4F36A 1B99A 2HLUA 1AFJA 1LFPA 1NZ8A 3IWNC 2ZWPA 3FUYA 1TK5A 4LF4J 4V19X 3MM5B 4RL1A 1XEZA 5FDLA 2FHJD 3MEEA 2VODA 4F7VA 4X66F 2C1EB 4IQXA 2E5GA 2DR9A 2G13A 6FD1A 1NB2A 5M2RA 4K59A 3BKUA 2XY5A 1Q4RA 1RWUA 3QT8A 1YRTA 5D78A 2BOPA 3GCWP 1HWUA 4I1TA 5B09A 1VI7A 3QLHB 4O4GA 2PO4A 5L1LA 3I0RA 5LJ3Y 3OW2R 4FYDA 4KPCA 2GJFA 2VQEJ 4D3GA 3FNNA 1XNQF 2UXBJ 4P7VA 3S01A 2B4OA 4F04B 1H73A 4DR2F 4Q0BB 1SQGA 4DV6J 2V50A 4OYPA 4B3TF 5DQIA 2RB7A 2F9JA 3OR1B 5KG3A 4NPOA 3MM7A 3J80Y 4B3RF 2IRXA 2QLWA 1PO6A 2XI3A 3NGRA 4C8MA 4YQWA 4DR6J 4NCBA 1RCXB 2ASLA 1QVFR 1S1TB 2BMBA 2H51B 2UUCJ 2VQFF 4C0OC 2EC0A 1KVIA 4F0HA 4FNHA 4J9UE 4JV2A 3IO1A 4JBCA 3BN4A 3DOLA 1I51B 2D41A 3G6ES 2JDJA 4GKJJ 1O5JA 2XHWA 4KIAA 3DRXA 2F3JA 1I6JA 1L3VA 2ACMA 4IUFA 2IYGA 2D9OA 4PG8A 3DRYA 2B56A 2YNIA 3B82A 2WSCC 4RUHA 3HT0A 2HZCA 3LALA 4DSLA 2RVJA 1RT1B 2NCKL 5AJ3F 3MEKA 4M5GA 1HD0A 1VFJA 2IPOB 2LEPA 2RJZA 3A13A 3PHEA 5KFLA 3MR3A 4J9QA 2CPEA 4PUOB 3PCOB 1N33F 1ZM4A 2DXDA 4PYDA 5JXSA 4C0BA 2DRBA 1FDDA 2RAQA 1PAUB 3C2PA 4PCQA 4RW4A 1LW2A 3P49B 1OS5A 4C7QA 3DLHA 4LF9J 3P5TL 3HZGA 3J81U 2G0JA 2IM3A 4NLWA 1MROA 1HBNB 3DLKA 2ASDA 1FI4A 4JI0F 1N6QB 2E7XA 1KEKA 2HIQA 4I2QB 4DDFA 2E1PA 4PXCA 5KFFA 5KT4A 1X4AA 4DSJA 3KK1A 4GO7X 1QUVA 3N28A 5THWA 1WC5A 2BXJA 2COLA 1GX6A 3CJ5A 4O3SA 4CLYA 3BKFA 5EUHA 5J1EB 5ETSA 2ZM6J 3VAKA 1U45A 2DNYA 2RQKA 1RYRA 3AD8C 2CQ2A 2GA7A 4FF2A 1ULRA 1BGXT 4K4VA 3FC9A 4UOHA 3CCSS 3O8WA 3QFWA 2AIRB 4OL8A 1EHWA 1M5PC 2LU2A 3WHIA 3HHDA 3IRWP 3NRBA 1J5OA 1DTTB 3D1QA 2XZTB 5I3QA 3GP9A 4MFBA 4DL3A 2J0XA 3R6LB 5IM0A 1AYEA 2OPQA 4QQBA 1RTHA 2MHNA 3PV8A 3C6UA 2XS2A 2HURA 4USMA 1BQNB 1ZZNA 4OLPA 3ZTPA 2R7XA 4WZMA 3LWLA 1HA1A 3GE9A 1FD2A 3I9ZA 3M30A 1EARA 1FWKA 2VZ9A 4GC6A 2MDAA 2W2NP 2BW2A 2YNGB 2F4VJ 4ED0A 7AT1B 1WOPA 1PC4A 1Z2LA 3T1HJ 4QWDA 1IBMJ 1TKXB 2ADBA 4PWDB 4K4ZA 3HF5A 3DKDA 5KT6A 2UUBF 1YWXA 3UWTA 2FUG9 1VMBA 2BQUA 2DGXA 1YQHA 1FRLA 2RHSB 3RRKA 4IRKA 5KT5A 3TARA 5D0RA 5KFVA 1NDPA 3QGIA 4KC5A 2A1BA 1NZAA 2B6AA 2MJUA 1JWWA 3HT3A 2YKOA 3H59A 2C2NA 2ZOMA 4U8VA 4E98A 1FKOA 2IMWP 2YVSA 6FDRA 2BRLA 2QZ8A 4M94A 2DJWA 2DHSA 3EE3A 2LCWA 4PAAA 4ZPDA 4BC9A 4AD6A 2N4CA 5H9FJ 1U4BA 3MGJA 4CIOA 1YJNS 4LFBF 1P8GA 1PILA 4RW8A 2X1BA 1N5QA 1ZS6A 4P2FA 4EYHB 1EX8A 3GIJA 1QUPA 3GILA 2R2RA 4ECQA 2NXNA 3MMAA 3O5TB 3OHAA 1RB0A 3AXKA 4KH1B 4LF7F 3KG1A 2FHOB 5C24B 2EVZA 2HZVA 4M5JA 4A8YA 1AXQA 1CVJA 5D4OA 3ENWA 1URRA 2GCFA 3PJ9A 3IBWA 3V4IB 5DGAA 2IYIA 2O66A 3JXOA 4QIEA 4K4WA 1X5OA 4USTA 1HHSA 1IJFB 1DLOB 3VF0B 1AZSB 4LRAA 2CQDA 1WEYA 4FP9A 4TLQA 4ZP8A 3ZNUA 3SV4A 2FPHX 4JI5J 3MOJB 1FT8A 1G6BA 2FHJA 2P2CB 4L73A 4YHHJ 3QGHA 2HQFA 1FERA 1CJTB 1S6UA 2BANA 2O01C 4ID8A 4I2QA 1JLFA 4Y65A 3TP2A 5CABA 4HLBA 1RT5B 1VC5A 1IR0A 3H0PA 2CNKB 4CLUA 5H9EK 2R3VA 1G2EA 4EWTA 3A12A 1RTJB 1T9TA 2K1RA 5DO2A 4DV1F 4RUBA 4AE5A 2DIVA 3Q89A 4IFYA 1UEKA 2XMJA 2BJ9A 3N79A 3BBBA 3DMJB 4RW9B 3KFWX 3EDQB 2CG4A 2I5JA 3SQGB 2XULA 3J7ZT 2DNHA 3MCSA 4U67Q 2YNHA 3LQVA 1XERA 2OEMA 1CJKB 4ED2A 4U95A 1U26A 1EZZB 5KFGA 4E8UA 1VQ7S 4TU9A 3T5HA 1BC6A 4N7TA 3WX8A 3KUEA 2CNOB 2OPSB 3W2VA 5F3ZA 4ECYA 4PQUA 1F9HA 3QPIA 4TLRA 1JXEA 9RUBA 5KFNA 1X5SA 1S1UB 3PVXA 2GHPA 1GNKA 3M30B 2NR0A 4ZVHA 3MTJA 3MCNA 4CO5A 3NL0A 1IM6A 2QA1A 2RH3A 3NY0A 4ELUA 4LF6F 2GQCA 2FHKA 2BZ2A 3AD7C 5A6WA 2D3O1 3CB4A 3U7JA 1G3OA 5HN0A 2ZH7A 4A8KA 3A8KA 3MCMA 3POTB 4LJMA 4UOGA 1HQUA 2F4VF 3TX8A 4FXWA 3GJRB 2I2YA 4TKTA 1S9FA 2R7UA 3ILOA 4YFUA 2BUNA 3OTOJ 3PDNA 1HNXJ 3KHRA 5BJRA 4RR5A 2FJVA 1SJQA 3HHEA 3NMRA 1ICEB 2G1DA 2HQDA 2RS8A 1QY7A 3I6PA 3UDCA 2AU0A 1FFGB 1LW0B 3T5JA 1GTEA 2FGCA 3FEYB 8AT1B 1FRHA 1WORA 3PTWA 5J2PA 2DTJA 2EFQA 1JNZB 3CCRS 5F9LA 3KK3B 2JEJA 1HNWF 1X4HA 1UKUA 2RSQA 3JSRA 3PFEA 4ZHRB 5HLFA 1IBKF 1T05B 2UU9F 3KMSA 3WDOA 4RKUC 3QZ8A 2ZH5A 3BBFA 2LYVA 3LGNA 4DBQA 2W1BA 2U1AA 1I1GA 1S48A 2OO4A 2QLJB 4QIFA 1HHTP 2DPIA 2GVZA 2LQ8A 3GV7B 3I82A 1QAIA 1TVRB 2ZVSA 2VC1A 3C16A 1VQOS 4DR3F 4QOTA 4USJC 2K7KA 1MNEA 1TKZB 1T02A 3DLJA 1RACB 1IXKA 2ZC3A 2HGNA 1Z2ZA 5ETVA 2PMHA 4JP8A 2BQRA 1WUUA 3W66A 1QDUB 3LAKA 3M6XA 3A4TA 5SUHA 1ZPVA 1OY8A 2HNDB 5ETQA 5J1NA 5D4PA 3O1LA 3HVRA 3NBPB
chains in the Genus database with same CATH topology
1R89A 5CYQA 1UFLA 3K5NA 5J1PA 2LXUA 2HFOA 3L7OA 7FDRA 1X9WA 2XO7A 2X1FA 4M5DA 1SH2A 1DQ9A 3MI7X 2VB6A 1NK5A 5HROA 2HWTA 3RTVA 2MJNA 2PGCA 3DRSB 2Z8QA 3IN5A 5B0BA 2UVVA 2BRKA 1JNRB 2UUTA 1W2BR 1VQ8S 3CCVS 4DQSA 4ZPWR 4FXDA 2CKWA 2OPPB 2XGPA 3QO9A 1ZTWA 2VPWB 1WELA 1VQLS 2PIIA 4H54A 3ZZ0A 5DDOC 2IM1A 4ECZA 2E5HA 1NU4A 2XWYA 2E5LF 2BJDA 1XTZA 2KXFA 4GKJF 5KG0A 3MEEB 4PXEA 4CZCA 4NLTA 4URGA 2CVIA 2EI5A 2QFJA 4RW6A 4CCHA 4MKBA 4FVCA 2KTQA 4JOUA 2CJAA 1YBAA 4ES1A 1YJUA 2VG5A 4NXMF 1VRUA 3GR0A 2X1AA 2HHUA 2BYCA 1FDNA 2B0GA 2JHEA 2ZH8A 4IO9Q 4YDXA 2J76E 4P7TA 4MYTA 1C4CA 4I4BA 3M2UB 3RW6A 2EFPA 3FFIB 1P1LA 3DYAB 4UOCA 2FVRA 4K0KF 1JKHA 4IH6A 5J2PB 2NREA 3TR5A 2OD6A 4C3MA 3I0SB 3NP5A 4OI4A 5L1KA 3O2IA 3QJJA 1RT2A 3PEJA 2XLJA 3PX0A 4X4OA 1T05A 4DL6A 3R1LA 3LGMA 1RTIA 4YY3F 1XMOF 2W24A 1RKJA 2B4PA 2MQNA 2QE5A 4C8NA 1S1WB 5KOWA 1KFSA 4EYIB 4F8RA 3RAQA 3UR0A 1RAJA 2M88A 5L9XA 4IRCA 2KYZA 1S1XA 4TQSA 4MK7A 5KFEA 4YHHF 2XY6A 3HK2A 4ZPBA 2HNDA 2NXUA 4OX7A 5KFDA 4RNHA 2EFOA 2JLFA 3I31A 3K8WA 3QWUA 5L38A 3JYTA 2HWHA 3NKYA 4OI0A 2IFXA 3OXGA 2K7JA 3Q22A 1XMQF 2UV8G 3CCES 5GAHI 3BQ1A 2VUGA 2V2KA 3T5KA 2GMJA 1NNDA 2HNZA 2QYCA 2B9YA 2DCLA 1RDRA 1G7CB 4KFBA 5A8RB 3D0GE 3OFGA 4WFNQ 2R7SA 4YB1P 1X0PA 2O67A 2HS4A 4XO0A 3V6JA 3WC2A 5SZTA 3AJ1A 2KYXA 3HHLC 2AWZA 1K8AT 4F4XA 2C28A 1HW9A 4IOBA 3HX9A 3M6VA 3MM5A 5KFBA 4NLPA 2KDOA 3DC2A 2RNEA 1C1CB 5BYSA 3UCGA 2KI2A 4KHPF 3L3CA 3QJPA 2YWGA 4N8OA 3ONQA 1H98A 1QAXA 2D9PA 3PY8A 2IJFA 4PWUA 4WTYA 1FD8A 2W4DA 1LWCA 1WNEA 1LK7A 4CH0S 4XK8C 5HL7Q 2CQBA 3PNIA 4F2SA 4A47A 1REVA 2M4MA 2YKMA 4HI1A 4LF9F 3I55S 2E9TA 2N4DA 1UFWA 1S9GB 2N3LA 4H4OB 3PX6A 5E0OA 3JTPA 5LJ5Y 3MM8A 4PXDA 3OL7A 2J9DE 4URSA 4DV5F 2AX0A 1W2IA 2PDAA 5M2UA 4YP3A 3RAMA 2XCAA 4NCAA 5F8JA 3W7BA 1D3WA 2ZD1B 2R7QA 3KLGA 4LFAF 4GKKF 3SCKE 4DPOA 3MM9B 1HQEA 3T19A 2R7RA 3B8HA 3BF4A 4RW4B 2XZWA 5KFKA 3LP0A 1N34F 2GHVC 4JI7F 3BDEA 2BVZA 5I42B 4WK1A 5U47A 4A8XA 2ZFHA 3SDEA 2DGSA 4WU2A 2V8HA 5IFMA 3EPIA 2R8KA 2HW3A 2M8DB 2EFVA 5K9FA 1S6PA 2B3TB 4QU6A 2W8LA 2ZKTA 4F4WA 3BN7A 4URQU 1RT7A 5F0UA 1LWFA 4EZ9A 4I0WA 4N41A 3AJ2A 2E7WA 1FEHA 1VRTA 3WBZA 3M8PB 5LL6d 3PIPQ 1RTDA 4EZ6A 4FVMA 4ZDNA 3CCZA 2ZH2A 4U6PA 4IR1A 3JSYA 1M1KT 2XEXA 7FD1A 1NK4A 2HMIB 2J5AA 3HVTA 5E3AA 1XR6A 3M8QA 3NCRA 2J6UA 1HNVA 1HI0P 2HVHA 2YNHB 1YJRA 2FC8A 2I1RA 3TANA 2P6TA 2EWHA 3FEZA 2DGUA 2XMKA 3O44A 2HGLA 2VG7B 2OFGX 5A8WA 2ROEA 4C4WA 1A9NB 2WONA 1QAYA 3V4MA 3RAXA 3DOKA 3OL9A 2FLOA 1T3OA 4Q5VA 5AXLA 2QEXS 2UV8A 2KFZA 4G1QA 5G4DA 4C97A 2CQ4A 2YKQA 2B6AB 4DV2F 2GO8A 2HHHF 4K4UA 2ZOGA 4KTQA 3ZFVA 1ZM9A 1FCAA 3UQSA 3OSNA 2IVFB 3H20A 4KO0A 4LSLA 3Q0AA 4DLGA 1R31A 4RWXA 2JVRA 2VBWA 3BM7A 1XMBA 3CJ4A 1D9FA 5CQGA 4ZVFA 2XB2D 1IQTA 3SEOA 4U9RA 5C24A 1EETB 1N54B 2AYEA 2MKJA 5K14A 1ZBTA 2ZD1A 5C5JA 1N56A 1M0SA 5GAGU 2CPFA 3KK3A 3GMGA 2B5JB 4WKYA 3K59A 2K2PA 4CT8A 4AL6A 3CCLS 1TL4A 1YI2S 2L08A 3L09A 2NZ4A 1NRKA 3MM7B 4FXVA 3IRXB 4QW9A 1Z4UA 3B4MA 5E3QA 1UJ4A 3SSRA 5E2QA 4UY85 5B0EA 4ZLPA 2EFGA 1SBRA 3B78A 3I5AA 4NXNF 4YR3A 1FVQA 1Q78A 1KFDA 1FKPB 3SFGA 3H40A 4A8QA 2UZAA 4DL0C 1D8YA 5A6PA 1LK5A 3D54A 2YH1A 3DHWC 1FJ7A 1U25A 2ACYA 1U1KA 1U2FA 1KQKA 3G8SA 3M9NB 2MQQA 2GO9A 3S8SA 1M90T 3LP1B 3MEDB 2EK6A 3NG8A 2K8GA 3QAUA 4R8UB 2BM0A 2VA2A 2YNFB 1IKVB 2FHMA 1UWBA 2MB0B 4ECRA 1N36F 4OV1A 1GAOA 1WACA 2BR0A 2AW0A 1R0AA 1NHUA 2NSBA 3OR2B 4Y28C 2X1GA 4PKDB 3VAIA 3CDBA 3MDFA 4EBEA 3UD3P 2LU1A 2L9WA 1C0TB 2X3GA 3CDWA 1N8RT 5CYMA 3TA1A 2N7CA 2XBPA 4EO6A 3CO9A 2R2UA 2DNMA 2FDNA 2RT3A 1HPZA 2VG7A 2X51A 4O44B 5KOXA 1ZM3A 4ID5A 2CDQA 3M9OB 2YKAA 1S0NA 4OMFG 3VAJA 2IRUA 1N4LA 3FDSA 3LP2A 2EG1A 1Z1ZA 4GO5X 1NH8A 4O3QA 4LVNP 1LFWA 5AXKA 3SXLA 4WXOA 2W9CB 2IMWP 4IFVB 3DNCA 1L5UA 1AFIA 5DETA 3DRPA 3LF0A 3OJUA 3R5BA 1LW0A 4I7FB 2PMZD 3ZZZA 1GX5A 2HVIA 3CEDA 4KO0B 3RBDA 5J2NB 2KZMA 4NLDA 1YHQS 1WEXA 3N5BA 1JLEA 2FJAB 5CHCB 3GYXB 3IGVA 4B02A 2D74B 1LQ9A 2DNRA 1HBMA 4LSNA 4K5SA 2J7UA 2ATLA 1AROP 1ZM2A 1TVRA 1C2PA 3HHLD 4NLRA 5IWAF 3ENVA 4DS5A 3W3SA 4XIUA 4J9NA 2KM8B 1QTMA 3F56A 1VBYA 2DGTA 1Q7LB 1Q8BA 1OO0B 5DRKA 3K5MA 3EYZA 4C8YA 4WXWA 5KFCA 2MQPA 1RJJA 4ZP7A 1N0UA 2A18A 2L3MA 3SSQA 2LECA 3M1VB 3KLEA 2KU7A 5HROB 1X7VA 3TNVA 1KHVA 1QSLA 4QW8A 2GX8A 1IKXA 4JI8F 2IVMA 3CCJS 4DV4F 2W25A 3N5FA 2DO0A 5KT7A 2ZUGA 5KFOA 2OAUA 3T6JA 3VALA 2KRBA 2DNZA 2MMYA 2QSWA 2W7AA 4HL9A 4OJHA 2M5YA 2QO3A 3OV7A 1NAQA 3NAHA 3GR1A 1L3UA 5EGYA 4K4XA 2ERRA 1Q8LA 4KR0B 1E6YB 1M5KC 3MXHP 3IAS9 2C42A 2IAJA 3LAMA 2GGPA 2ZC4A 4TY8B 3KMQA 4X4QA 2UVWA 2CQGA 1WEZA 1XR5A 3V5RA 1FEEA 4AQYF 4RW9A 2I5JB 5LT5A 3H98A 4A8OA 2WOMA 1VRUB 1DURA 4F02A 4QWAA 3CDAA 1DJ0A 2HNYA 3H5YA 2AGQA 1Y7PA 2O1PA 5CCMA 3K0JA 2HHSA 3CIMA 2OTLS 1T7PA 3OXFA 4LT6A 3M8SA 3ZC4A 2CIMA 4CTAA 2JEGA 4ECVA 1FXLA 5KTQA 1HBOA 1DTQA 1TKTA 3T6BA 5K8OA 1S9GA 2XLKA 2BACA 4J5OA 2LVWA 3POTA 4WFZA 4RBVA 4IOCQ 4Y2KA 4EFAC 1UVKA 4DR7F 2DR5A 4KSEB 1VLYA 3LOUA 4QWEA 1VQ9S 3FMBA 5KFUA 5IT4A 1NJXA 4NYOA 3QAEA 5J2QB 4OI3A 3H25A 4WFYA 4PG7A 4A8WA 2V8GA 4O3OA 1F5CA 1LWEB 3TRGA 4NWBA 1WTFA 4J37A 4A4JA 5B08A 2DNPA 1YG0A 2DNLA 4DSIA 4LF8F 3T5LA 4B9LA 3LPYA 2JFDA 1HNIA 2ZDOA 1HQEB 2LXIA 2XMWA 5I3PA 1QSSA 3FVYA 4J9PA 1FO1A 1WG1A 2ZITA 4HHJA 4HYKA 5A8KA 4W92B 1FK9B 3DI6A 2BJEA 2JC0A 2AJFE 3T3FA 2MQMA 1X0FA 1LOUA 2CYYA 2C2DA 3SMZA 2R8IA 4OQJA 4QR2A 4HH0A 3BSCA 1C4AA 2OP5A 3BGRB 4ZVGA 2HHPA 3KLIB 3FZ2A 2R7VA 4OZ5A 2IA0A 1VK8A 3JAMY 2MKCA 5G0RA 3F41A 1N88A 5B7WA 4NA2A 4U7UK 4FNIA 1L3KA 2CPHA 5M2PA 4F3MA 1QM9A 2CJ9A 1T95A 5AE1A 1FA0A 2G0CA 1F2GA 3CCUS 5IQ6A 4HTJA 5HBMA 2VG6B 3CD7A 3I96A 4PR6A 2RKIA 4EBDA 2R7TA 2HNYB 4OLOA 3LH2S 2V8DA 3KK1B 4KPYA 3BEGB 1U6FA 1R8CA 4QBUA 1XBWA 4OZ0A 1B0TA 1HBOB 2OH2A 3THVA 1KSPA 1UP1A 1IQZA 1JXLA 2CJQA 3KJVA 2DISA 1ZYQA 1GXUA 4DV6F 4F50A 1DTTA 1SI9A 2CPDA 4MFBB 3TA0A 2VOOA 2CQIA 2JC1A 2OPQB 2C3MA 3HHNB 2WK4A 3TAPA 4ECSA 4RW6B 3QIDA 5F8HA 3ZZOA 1ZTTA 2P6SA 3KK2B 5D4NA 4NCGA 2AX1A 3N9UC 3MM9A 3DCAA 1IKYB 2Y1IA 2E1CA 4NZ7A 4USIA 3UI3A 3TAMA 3R27A 2FVCA 2OJ3A 4OI1A 2RS2A 4K50A 1FNXH 2PA3A 1RA6A 3SDEB 2C3YA 2P9EA 4B17A 4FBUA 2DH9A 4JI4F 2HYIB 2DRAA 2LEBA 1HBNA 3DLKB 3IR5B 4UW2A 2VASA 2CZVC 3BS9A 3MEGB 3K7RA 5B0FA 2MZ1A 3ULHA 1JLAA 3MFHA 1L3SA 3E8OA 2WAQD 1UETA 5DG8A 1FTCA 4ZS6A 4I6YA 3HO1A 1U1LA 2G9OA 3W2WB 1WI6A 2PT0A 1DAXA 1IN0A 5H9EJ 1XWLA 1DZ5A 3QYYA 3K5OA 3CJ2A 3MD3A 4PXBA 3C46A 2RRAA 1IKVA 1KTVA 3HJFA 3MPVA 4DEZA 5GVQA 4H4KA 3I4PA 2WB1D 3AY0A 4NLUA 2AJ4A 3P3DA 5HMZA 4ZVEA 1D0EA 3DLEB 3MMCA 2LLZA 2D3ZA 2KM8C 1HD1A 1KHWA 2DHXA 1K1QA 4DR5F 4I64A 1SV5A 3VAFA 1V9OA 4X4SA 1QE1A 2YNGA 5E5NA 1KN6A 5A8RA 2E1RA 3IS9B 5KFMA 5GAGI 2GMHA 2KKHA 4MYUA 4RLEA 3SCJE 2JLGA 5DM7Q 1FJEB 4C8KA 1VQKS 2QMXA 3C6TA 3AA8A 3UNGC 2JL9A 2MKKA 2KXNB 2R9LA 3I9V9 3KTQA 1Y3JA 2LEAA 3IWXA 4IFYB 1S76D 2Y0SD 1SUQB 3EGWB 3HKWA 5DDPC 3DMJA 5DM6Q 2I38A 3D0IE 2W9CA 5F8LA 3KYLA 1PGZA 1FKOB 1OQ6A 1WHWA 1S1VA 4G3IA 2A10A 3PR5B 1VIOA 2CJKA 2DB1A 4NOHA 2XG8A 4DHVA 4ED3A 3RRHA 3RR8A 1S77D 1UAWA 1KQGB 4ILMA 1G1XA 3M4XA 3O3LA 2MPUA 2JZ5A 2LQBA 2V5HG 3BR8A 4ITSA 3LANA 4TU7A 3OVBA 2KJVA 1JLEB 4QIWD 4C11B 4Y3CA 5KFQA 1NJWA 4IRDA 3KLHA 3V4IA 3G8QA 2W7PA 4XDDA 3GV8B 3V2UC 5I3UA 2V0NA 1X5TA 5HP1B 3R5DA 4NLVA 5KAKA 2EG2A 3OFHA 5JUMA 1Y9OA 4G6VB 3FSXA 1YJWS 3SI8A 1VK3A 2CPIA 3AH6A 1S0MA 5D77A 2D3UA 3TW0A 3CTRA 3CVKA 3G6YA 5LMNF 2DR8A 5C42B 3DLGA 3ITHA 1YIJS 2E5JA 3E01B 1UVLA 4MH8A 4TN2A 4CO2A 2M8HA 2VBYA 5DLFA 1SXLA 1FDBA 2NPFA 2QLXA 2AQ4A 3D5MA 4EEYA 1KLMA 2FJWA 4ED8A 4CH7A 3VR1A 1X9MA 1NB7A 3F44A 1TL5A 2MKHA 3M2RA 4NLQA 4I2PA 3U1MA 4DSFA 4WFBQ 5HI7A 1U6ZA 3HHLB 4DQQA 1HPZB 4O44A 2FVPA 4NLSA 4ID5B 5GAEU 4DR2F 3MMJA 3EPGA 2JFKA 1DHMA 2L41A 5T7LA 1NKEA 1S1UA 4OZ1A 4FPRA 2LQ9A 3RW7A 1U1QA 1DFDA 5K5MA 1E6YA 4IDKB 5L39A 3BJYA 3JSBA 4F2RA 5KT2A 1VRTB 4X4VA 2ZH4A 1SH3A 1RTDB 1HQUB 1UJ5A 2FD2A 2AD9A 5CCLA 3HKZD 1V3ZA 4ZCKA 4ED5A 4CO1A 1DARA 4FF1A 2ZJPQ 3EZUA 2VBXA 1NK9A 3TO8A 4KKOB 1TQLA 1MWYA 1TAQA 5KG5A 3T9NA 2N82B 4IG3A 3M9MB 4IOAQ 4Q2MA 1SQEA 2V4JA 3JB9k 5B0AA 2F7VA 3S7RA 2J0QD 4F4ZA 2VFRA 3PW0A 2RQCA 4FS2A 2OPPA 4QCLA 3DN9A 1SKWA 3R1HA 1AUDA 4X62F 3U02A 4QWBA 1KC8T 4H4MB 4WYWA 1VQ6S 1O51A 3NGDA 2IHR1 4MK8A 2BE2A 2HHXA 1TL1B 2KT2A 2A2DA 3FQLA 4OX9F 5F8IA 4DR4F 4IQMA 4J9LA 1Y5LB 3LUYA 1O0PA 1JLQB 1QAJA 2I9SA 5F9NA 1VQNS 3CULA 1BQMA 4MK9A 1TKZA 1RK8A 3SCLE 1QVGR 1S49A 1YVFA 2ROPA 4DFKA 4B9NA 4EBCA 3G86A 1SJ4P 1SIWB 2RD5C 2W9BA 1RYSA 1H2TZ 3UPFA 3P6YC 3QJLA 1U47A 3DLGB 3ITHB 5DS7A 3TI0A 4B9MA 1IKXB 4I68A 4RW8B 1NK7A 4M95A 2DNQA 1RT6B 3AQPA 3UCZP 2YKNB 4RW7B 2BABA 4DQPA 2HHVA 2UXBF 2ZH1A 3AB4B 3MMBA 3PKMA 3QIPA 3GIMA 1LXJA 4CNZA 3KHGA 4Q8FA 4B3SF 5KFSA 2LQ5A 5FIIA 4DLEA 3GFHA 5A2QY 4F4YA 2B4UA 2R7OA 1CC8A <