4N8NA

Crystal structure of mycobacterial ftsx extracellular domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
102
structure length
102
Chain Sequence
LDRVESQVFLTEDVSANDSSCDTTACKALREKIETRSDVKAVRFLNRQQAYDDAIRKFPQFKDVAGKDSFPASFIVKLENPEQHKDFDTAMKGQPGVLDVLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mycobacterium tuberculosis FtsX extracellular domain activates the peptidoglycan hydrolase, RipC.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Membrane protein
molecule keywords Cell division protein FtsX
total genus 25
structure length 102
sequence length 102
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18075 FtsX_ECD FtsX extracellular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3040 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4n8nA00
4N8OA 4N8NA
chains in the Genus database with same CATH superfamily
5DLFA 2BW7A 2IA6A 4Q8EA 2WB4A 1R8PA 2F4VF 3QJLA 4KGZB 4RUAA 5B0CA 1OQ6A 1ZA2B 3CTRA 3IP0A 5D8HB 3GP9A 2CA9A 1VJWA 2M2BA 2M88A 1W25A 2GMJA 2MMYA 2OEJA 2QFIA 2V8HA 7FD1A 5ETVA 2BQ3A 3VAMA 3D54A 4K7QA 2E9TA 5HBMA 4YP3A 3OSNA 1X0FA 1I94J 4M5KA 5RUBA 1RQ0A 4WFXA 4ZCMA 3UVJA 1S72S 4LMZA 4USUA 2R42A 4O4RA 2DB1A 4ZLJA 1X60A 2R7QA 2IDEA 5FLXU 4TU9A 1YITS 2MHEA 1XIQA 3HT0A 4DX7A 5C7PA 4QIGA 3MM8A 2ADCA 1SKWA 3W2WA 3CWJA 3K0JA 3W5YA 2I5JA 2CQ2A 4L72B 3UPFA 5IV3A 4LF4J 2ACYA 1SJ3P 1SQGA 4JI1F 3A4TA 3RBEA 1H72C 1CC7A 1MU2A 1IKYB 5J1EB 4CM0A 5D4NA 4ED6A 1TK0A 1VK8A 2MZJA 2DKOB 3PYGA 3W2WB 1JK9B 3DOMA 3Q8UA 3J80Y 4RW8B 5D4OA 2VICA 2HHHF 4LRDA 5D15A 2MZ1A 2QZ8A 4HVZA 4QIVA 3D67A 5CYMB 1RT2A 3CCWA 5HATA 3J7AN 4F0KA 1RBLA 1B0TA 3GCWP 1JLGA 4CLSA 5EN1A 2DNZA 5DG7A 2YX7A 3BO2A 3IGNA 1TKDA 1QVGR 3D6HB 5GAGI 3CC7S 3S01A 4J9RA 4MKBA 1NK9A 3W60A 5GAEU 3VVUA 2R3VA 5HMWA 2G4BA 2BMBA 1SC1B 1OIAA 3M2RA 1N32F 1OY6A 2ZH6A 4KHPF 3FSYA 4EO8A 2IBKA 2B3TB 1VLOA 4FF1A 5EWGA 1WF1A 2GJ2A 2HRTA 2RH3A 3PRBA 2RD5C 4H4MA 4PWDB 2OPSB 4C9DA 3P8BB 2HQCA 4FS1A 3AXKA 2F4FA 3HHLB 4O3RA 5IC4B 3KJQB 2XI3A 3QGPA 1GFWB 4X4RA 2HHSA 1Q79A 3GJTB 4L75A 4W90B 4YOEA 2CRLA 3F41A 5HQLA 1RLCL 2YNFA 3IRXB 1RP5A 2VD3A 4GVLA 1U1RA 1SJFA 1FKOB 3T1AA 2CKWA 1Q53A 1RA7A 4P72A 4CT8A 3NXZA 3KUGA 5KT7A 4UQTA 4WFNQ 1T05A 4I2QB 1PIEA 1V6HA 2BJ3A 2GVZB 4IFVA 2XS5A 2QL5B 3M2RB 3MAQA 3CUNA 4NASA 1HNIA 2ROGA 1HHQA 2UXDJ 2HLTA 3JQMA 3A8JA 3Q23A 1H2TZ 2J6SA 3QLHA 1SQEA 1W2IA 1FNOA 1OY9A 2GVZA 3MPDA 4IFVB 1YSJA 1YJNS 2IYIA 2LA4A 2P9GA 3A8EA 2B9EA 2DNQA 3H0PA 2Z2ZA 2N3OA 1G4CA 1WSRA 4JP8A 2QX0A 4IG3B 3KJFB 1EZZB 2K7JA 4FF3A 4Z2XA 4QYZJ 4LF6F 3SDEB 2JWNA 4DQIA 3QGIA 4ZP8A 4ELVA 3I0SB 4BWJA 1WD6A 3SFUA 2B4VA 3LP0A 2W2QP 1FE0A 1RHRB 4XDDA 3FZ2A 3SV3A 4DL0C 5K14A 1YK9A 5DDRC 5KFJA 3GPAA 5DDOC 4G6VB 3Q8PB 3MOZA 1H7WA 3CJ4A 4EO6A 2QA4S 1U1KA 5G4DA 1RAAB 2IVFB 4JI8F 3I56S 1B64A 4QR2A 4URSA 2RRNA 1D9AA 5K5MA 4JV0A 2BW2A 5K8MA 2K8GA 4E2FB 3KXDA 2OGUA 3DOLA 2XHWA 1T05B 1KFSA 2A1BA 1JQGA 1IUJA 3FFIA 3RR8A 4IRCA 2OPPB 4TQRA 5ETPA 3H2VE 4AUKA 3PRDA 2YNGA 1JLBA 4KKOA 4DQSA 2E9ZA 5CD4H 4CT9A 3DXBA 1JXEA 1VRTA 3MURP 1LWEA 2NR0A 1S57A 4Q2LA 5KG6A 4B3RJ 1SB6A 4OHXA 3J81j 4M5HA 2A18A 2JOQA 1VR6A 5KOXA 1RYRA 2DNMA 3TA1A 3UN3A 4UOGA 2C3UA 3B4MA 5AE1A 1JKHA 2QSFA 4LF2A 4JB8B 1ZETA 3PV8A 1TL3B 4HR2A 2YWHA 4CTAB 2R2TA 4YB7A 2PMWA 2HFVA 3POTA 4MFBB 3H20A 4G65A 4ZLPA 5JJBA 4UQGA 4H4OA 4PPDA 4IRKA 3HJFA 4GC7A 2DGOA 1BLUA 4C0HA 2FHKA 3GIIA 2P6SA 2MKSA 2VU5A 4DJBA 2B6AB 2DH8A 4WP3A 1V3RA 2C2EA 4ECXA 1A7GE 1Q8LA 1JLQB 1M1GA 4RUCA 2Z2YB 2J9EA 3TW0A 1KNZA 1VIXA 5KFKA 2A10A 1RT1A 2B7CB 2BKPA 2ZNZA 3CE8A 3US5A 1B99A 4M5DB 3NLCA 2FJWA 2AQ4A 3KK3A 2K3KA 1DLOB 1TKXA 1MMLA 5ITHA 3A13A 2YTCA 3BGUA 3M32A 1P1TA 1JLBB 4KKOB 2W8KA 4PYDA 1Q82T 3CMES 2IY5B 3G6XA 3LANA 3PXGa 2PD1A 3VAKA 1N5QA 3LTOA 4DU7A 2VG5B 3V4IB 4CI0B 2DRBA 1PCAA 1RTDA 1RWMB 2HEKA 1S48A 2Q6CA 4MTPA 4AE5A 2M9KA 1CBKA 1S4FA 2RU9A 3BBBA 4PXEA 2HRYA 3THTA 1XERA 2QTWA 2WTFA 2ATLA 3KOAA 4PRFA 1U24A 3MM9B 4RUHA 3GIMA 4B3OA 1N5YA 2XM3A 4V19J 3CDUA 3JSRA 3RG6A 4FYWB 5JXSA 1WDDA 3SCJE 3R5BA 2CG4A 4KHPJ 3HSJA 1S6PB 3LPYA 1M1HA 4YDDB 4URGA 2H9ZA 2WRMA 2DGSA 5KFIA 1G1XA 1HMVA 1UFWA 3GFZA 3LH2S 5BR8F 1U8WA 5C5JA 1YJ9S 4P71A 1PAEX 1EARA 4HI1A 1NH7A 2DYAA 3KUEA 4WIQA 3M7VA 3QWPA 4ZP6A 2Y8YA 4G1QB 4J5OA 1FEHA 2ZBQA 4KBIA 2DGXA 1F60B 3I6PA 4IUFA 2G9OA 3IG1B 3KMSA 1S0OA 1CS4B 1TTHB 2C2ZB 2DBBA 5F9LA 5LJ3Y 3QT7A 1FRKA 5FLXY 2ZE2B 2ZJPQ 1GXTA 1S79A 1Q95G 3DMJA 3MECA 2YKAA 4PXCA 4CRJA 2VBYA 1VQMS 3C15B 3HO1A 1TP7A 2IRXA 1SKRA 2H3EB 2ILZA 3I5AA 3RAMA 2VQFJ 4OMFG 4HTIA 2L9WA 3AT1B 3LWLA 3DOKA 2XSJB 2WHOA 4Q44A 1T8EA 3NY0A 3TUPA 4O3OA 2ZVIA 1SPBP 4OYMA 2BJ1A 4C8OA 3C46A 2J5AA 3GYXB 3JS9A 2XCAA 1MNEA 4RBVA 4YUDA 1T9XA 4DUZJ 3QRRA 3DI6B 4P6QA 1GMVA 4I0WA 1CJVB 3K8WA 4TYAA 2MY7A 2AGOA 4ZIVA 1T3NA 4DQQA 2H1YA 1TL4A 1FWLA 1UWBA 1QAIA 4F36A 1S76D 4Y34A 3BM7A 1VQ6S 2DH7A 3HFKA 1QSLA 3KDNA 1U02A 2YQ1A 4NA3A 4ZA1A 5EGYA 2AJ2A 4NA1A 3TZXA 3OT9A 4F4KA 3R7NB 1RXOB 2MJNA 2LQ8A 2YKQA 4AXIA 6FDRA 5IM0A 5F8NA 4K0KF 1S49A 2EK1A 3DLGB 4WTYA 2V69A 1RJJA 3IWNC 4PWWA 3AD8C 3K8VA 1UPPA 2RIJA 4Y2KA 4PABA 3ISND 4OYIA 2X3DA 4LF1A 2VKZG 4C7QA 1FWKA 1UWBB 3OR2A 2UU9F 1HLWA 4P7TA 4CP5A 3VAGA 1Z2ZA 1T0TV 4C48A 5KT3A 3GG0A 4ZIWA 3FDSA 4I1TA 4RBTA 3UCUP 2BYCA 3BQ0A 2DPJA 2YKNB 5ETMA 3JTOA 3P5TL 2X3GA 5B0EA 4UUXA 2RT3A 3UO0A 1I5OB 5DG8A 4HDHA 1EP4B 4K0KJ 1IXKA 2FC8A 3AXMA 2BV3A 3GIKA 4OLOA 4Q43A 1X9WA 2N7YA 5D0EA 1S7IA 3NEKA 1CJTA 1H6KX 4ID8A 1RT6B 4J9UE 3H5UA 2PEHA 5FIIA 3OVAA 4HHUA 1ULRA 1RBOB 1F9EB 4JYAJ 1CSJA 2LDIA 1F5CA 5D77A 4UOCA 3HI9A 1MMNA 3OV7A 1YBAA 2HYIB 4M94A 4J90A 5A2QY 2KKHA 3KJNB 4LVNP 2VFTA 3J80U 4C0BA 3OHBA 2D1CA 2XMUA 3HVWA 1AUSL 1QUPA 1U2FA 1VHFA 3N6NA 4P2MA 4WE1A 3WX4A 4YQWA 2MKIA 1VQOS 1XC9A 2HIQA 1AW0A 1JLEA 3KNGA 1H74A 1L3VA 1BXNA 3EX7B 2VQEF 3HCXA 2AW0A 2PI4A 3HPOA 1RI7A 4UY8T 2CNKB 3OFHA 4K4SA 3PFOA 5KFWA 2ZNYA 2FJDB 2B6AA 1KQKA 5KAKA 4MKVA 2FJVA 3EZUA 3TRGA 1HR0J 1R31A 2MGZA 3PYFA 2D9OA 5T41A 1S1XA 1RT4A 3O6QA 4DL7A 4MIWA 2J6UA 2DHHA 1SXLA 2XS7A 1JLFB 1XBWA 2CPJA 3BO3A 3FMWA 5IC6B 3NWRA 3GCXP 4WWSA 3QIPA 2EWHA 2VZ9A 4QOTA 2MDAA 1XR6A 2UUCJ 4HT7A 3M32B 1FNXH 3TYTA 1YQHA 1ZBTA 2FZKB 1PG5B 2IRUA 2PDAA 5KFOA 5L1LA 3TEGA 3HM9A 2HG4A 1NRKA 1T03B 1VC6A 1OWXA 4FPRA 3T6JA 2W24A 1UFLA 3BGFA 1S5ZA 1S9GA 4J9VA 4DLGA 4QZVB 5D0HA 1EP4A 1U1OA 4LF9J 1PYOB 4NI2A 4OI0A 3LAMA 1F5AA 1FFWB 3LF0A 4MMOA 3OUYB 3JTPA 4NMLA 3RUBL 2XQCA 1H73A 4WFAQ 3PYEA 1S97A 4JOUA 1F5BA 2WVEA 4USTA 3W9JA 2MQPA 5CYQA 2ASYA 5KT5A 4DR7F 4MFBA 1PC5A 1R8AA 3MR5A 2UVWA 5HROB 3EDRB 4YHHF 1SIZA 1TK8A 2HZAA 1U2RA 2B0GA 1RT7B 3D7SB 2B51A 1T95A 2KXFA 4UOHA 2C2NA 3RBXA 3DRPB 3GQCA 3TZZA 1ZS6A 3TUJC 5F8MA 4O0IA 2G1DA 2LQJA 3VHQA 4EK2A 4F04B 4DV1F 3W9IA 4OYAA 3F44A 3MR7A 2B43A 2VJVA 3N6LA 2Z57B 1GK8A 3LWMA 4Q45A 3G71S 4TXSA 4OZ0A 3DCAA 2Q43A 2F1FA 2FJEB 1KHWA 4G1QA 1VJQA 3RAQA 1FEEA 2D69A 4H4KA 4XDCA 1TVRA 1FD8A 2DNGA 4NLUA 2KRRA 5L8RC 1RT5B 1C0TB 2OLWA 4KGKA 1DARA 2QL9B 3JTNA 5E3QA 2XY5A 3CCMS 3ZTQA 1S9FA 1AFJA 2MYFA 4M5IA 2V4RA 2B4UA 3W64A 4X4OA 3PRVA 3DLHA 4DR4J 3M2UA 2I0XA 2G2OA 1Q16B 3S1TA 2HMIA 2DO4A 4DPYA 3DLBA 3MM9A 1TQLA 3S8SA 4L76A 4A8YA 1KS2A 3CJSA 3M2UB 2ASDA 1FF2A 4BC7A 1IKVB 3C16B 2A0FB 3VAJA 1ZPVA 4NPOA 2BANB 3I5CA 3HHLA 3IR5B 4LBIA 1R8CA 4RLEA 3DM2A 2Y1RI 4IH7A 4AT1B 4CQ1A 2E1MC 5LSRA 1I1GA 3UCGA 3CF5Q 4LFBF 1IBLF 3A3OB 2E5HA 2CAJA 3SQOP 2A2DA 1TUVA 2MQMA 2VC1A 2M3DA 2KG0A 1X5PA 1Y7PA 3GFYA 3K7RA 2CWXA 3LAKA 2RF2A 3DMJB 1R6VA 3CMQA 3UDVA 2KT2A 3N28A 4DSLA 4X62F 2ZH7A 5LMNJ 3MMBB 1JLEB 2EKYA 4DDFA 2BE9B 2OSRA 3C8YA 2VQFF 4DU8A 1L3UA 4HKQA 5F8JA 3GYGA 1GXUA 3MPYA 1ITPA 2PI5A 4ES1A 1FKOA 2QA1A 5DS7A 2DK2A 3H40A 4NXNJ 2FJAB 2XY6A 1M5PC 4PXBA 5EX0A 1Q7LB 4ZVFA 2BOPA 4U9RA 4CLTA 4J9OA 1Y5IB 3ZTPA 3L7UA 1RE1B 1S1TB 3CNQP 2IDLA 2XTJP 3VR1A 5IFMA 3HT3A 3D66A 2ZKUA 2QL7B 6FD1A 1LWFB 2JX2A 5JMNA 1CLFA 1XJWB 4KC5A 2UZAA 3FBBA 4YHHJ 2EFQA 4C8LA 3UI3A 3IG1A 4ZDNA 4R0JA 3FRZA 3OPKA 1DLOA 4IG0B 2F8MA 4IH5A 3T9ZA 4C0OC 2XGPA 3RTVA 4ED7A 2HZVA 4G3IA 2ASJA 2XYPB 2AEFA 3QQCD 3T1YJ 5ETKA 1UVMA 3GSDA 4CLZA 1BY9A 2E44A 3BBFA 1UZHA 3QRPA 1RWUA 1NK5A 2FLLA 1YX2A 4QYZK 3G8TA 1AYEA 3FCWA 1JXLA 3O3LA 1FFSB 4AL5A 4CLLA 1KBRA 3AJDA 3ET6A 5CABA 1U1PA 4A8FA 2VOPA 4E8UA 1MWYA 2GQ2A 3HD2A 3HKZD 4I69A 3K5NA 2IJFA 2NQPA 1RHQB 1AT1B 2GC8A 1FKPA 4X66J 5AE3A 1E6VA 2RS2A 4ETZA 4PYAA 2DNYA 4I7FB 2HNZA 3TAPA 2XI2A 3K89A 1ZH5A 3BJYA 4ILRA 3BBCA 3NG8A 3P96A 3W8GA 4DL2A 1D09B 1YJ7A 3MHYA 2E9RX 2K2PA 3IBCB 2L9DA 1RT5A 5GMKa 2AJ1A 5E33A 4PG6A 2D3O1 1M5OC 3R5AA 3TQEA 2YX1A 2WONA 4XAKA 1AA1B 3E51A 1R0BG 2HK3A 3KK3B 2DEJA 4K8RA 1RHKB 2IAJA 1XTZA 1T9TA 4K50A 3B82A 2LXUA 2EW9A 1RABB 1Y4ZB 4UW2A 4DZ6A 9RUBA 3V2UC 3BS9A 4B3TF 1CQNA 5FDLB 1RUSA 1REVA 3T41A 2NYHA 5A8WA 3BN4A 2HW3A 2H5EA 2QLJB 3MMCA 4U7UK 4NLOA 3Q83A 1VHIA 3GU0A 4H4OB 4Y28C 5LJ5Y 5B0GA 3TI0A 2IJNA 1NJZA 1FRJA 2GVDB 2JL9A 1RTIA 2W4CA 2HWIA 2AU0A 1UZDA 3PO5A 1GAOA 4DR6J 4FF4A 2IJRA 2B5JB 3AA9A 3FQKA 1RU1A 1IR1A 2HQ3A 1HR0F 3TNVA 3E01A 1TVRB 3MCMA 5MAOA 5KFVA 3KHLA 1VQLS 4E0DA 2FZGB 3NAHA 1IWGA 2J0QD 1MG7A 4I67A 2ZH5A 5A6WA 2YNHB 1NCLA 5T7LB 4IYQA 2CUYA 1C1BA 5GMDA 4F3QA 3DYAA 1DY3A 1VRUB 2J9DA 1X4CA 3D3CJ 3ZZZA 1NJWA 3H59A 3H25A 2KVIA 4OYPA 1XK8A 2IMOA 3TA0A 2ZM6F 4V19X 4X4UA 3UNYA 1WTFA 3AY0A 3NGKA 3PW7A 4M5JA 2R7WA 3MAAB 2PFFB 4TY9A 4WP8A 2OEKA 2RE1A 2AYMA 4P73A 2UUCF 4N8OA 1LXJA 1VCTA 1HD0A 1ICEB 1NHKL 4TU7A 4EZ6A 3NWGA 1TFWA 2W25A 4I2QA 2AGQA 1FDAA 3ILLA 3OVBA 1HL6A 3VAIA 2BA9A 3EXYA 1U6BA 2F4VJ 4JI0F 4KO0A 4UUWA 4LF5F 4ZKAA 2GNKA 3QAUA 4TLRA 1WORA 5IQQA 4DSFA 5HVHA 2JH3A 1N6QA 2JEIA 3DLEA 2W7PA 2R9LA 3HFZB 3AFGA 3FC9A 2MPUA 1X7VA 5ETQA 3MR3A 2BQUA 1NK4A 3CCUS 3JQJA 5CQGA 1RB0A 3ZZUA 5DZ7A 4DF8A 3ULHA 2M7SA 2OPSA 4HT5A 3J7YI 2BE2A 2HFUA 2ILYA 4H4MB 2QLWA 5DRKA 4ZPDA 5HL7Q 4FN5A 4M5DA 1XMOJ 1X5TA 1VGYA 1JNRB 2NXEA 3RU0A 3MTKA 2CNLB 4EU0A 1L5UA 2ZEJA 3GG1A 1Y3KA 2QMXA 3BKUA 4ZPWR 5I3UA 3CJ2A 3QIPB 5AXNA 2ZUGA 1W7WA 1VQ8S 1CJUB 5CHCB 4KO0B 1M0SA 3EGNA 2ZBIA 4F02A 3M05A 2ZH8A 3J7A1 2GIFA 3KHHA 5CYMA 3OR1A 4J9MA 1K0TA 4J37A 4RW8A 3BEGB 1RACB 4ED2A 4QCLA 2BOAA 3ETMA 3DGPB 4M8LA 4R5PA 4KE5A 1BQNA 3Q2TC 1AZSB 1WHXA 4Y6IA 4A8XA 2R7SA 2BJ7A 1G2EA 5LM7E 1XMBA 2VDIA 2AEMA 3J7YU 2DT9A 4QJVA 2DHAA 3DRRB 5L39A 2LFVA 1YVFA 3EGWB 4USMA 3P4UB 2V8GA 3DDNA 2E1AA 4ID5B 2IC3A 3KHGA 1XMQJ 1CG2A 4ZVQB 3PW2A 1UVIA 4PG5A 1MN7A 1HFEL 1T3OA 1WC3A 2AHOB 3NCPA 1HIYA 3SQGB 1N34J 3H5SA 4CYUA 4LRAA 3KLEB 3MEKA 4RKUC 3MMAB 2XO7A 5J1EA 4OYOA 2XYGB 4J9LA 4ECZA 1P8GA 4WFYA 1YHQS 2XS2A 3W66A 5C25A 3UCZP 3NRBA 4YB6A 1REGX 2R8HA 2DISA 2JLEA 3SQGA 4ECTA 4MKYA 3VAFA 2XBPA 5KT4A 4A8KA 4ZITA 4U7UD 1WKJA 1LKZA 5EDWA 1OQ3A 1TU0B 3GV8B 5KFNA 3PJWA 3DRRA 3B78A 5B0BA 4D3HA 2V63A 4CNYA 1KONA 1UKUA 4QPTA 2VG6B 5H9EJ 4KJIA 4X62J 2HNDA 5E7OB 4QPXA 2PO4A 2HHTA 2HGMA 3E8OA 1HWLA 2IA0A 3DGPA 4RNFA 2H4YB 2DNKA 2BACA 1PYTA 4ENOA 2QC3A 3RB3A 2BX6A 1JJHA 2YH0A 1XN9A 1AB8A 2DEIA 4NL5A 3H8YA 2B9YA 2V9WA 2A3JA 4FVCA 4U6PA 3MXHP 1P6TA 1TR0A 4ZHRA 5HLFA 4DV4F 2KM8B 4EUVA 2KYXA 1MMDA 1ZZFA 1APSA 4UY85 1N88A 1NPKA 1S12A 3AB2B 4DL5A 2G2YA 3IM8A 1XNQF 3VGUA 4ED1A 2MEWA 1AROP 1YBTA 4RR5A 2CWKA 2QJ3A 4Y3CA 3OLAA 5L1JA 1UA1A 2XLKA 1Y5NB 1BHNA 4TNOA 4A8WA 1F9HA 5B7WA 2W9CA 4W92B 1RT3B 2XC9A 4Z7CA 2GIQA 4WF9Q 4PR6A 3PCOB 3QFWA 4O0NA 3OL7A 5CCMA 1Q5VA 4C97A 1QTMA 4RW7B 4C3MA 4CO2A 3N0VA 2DTJA 3MCSA 3RZAA 3LW5C 2MXYA 3PKYA 1YJVA 2RQCA 2N4CA 1S1UA 3O2IA 4M5GA 5A6PA 2CDQA 2CQPA 4LREA 5C2GA 1L3KA 5L1IA 4ANDA 4DS5A 2FUG9 2C2KB 5L9NA 3K5OA 3D1OA 4O4GB 2UXBJ 1RADB 2GX8A 2CPFA 4X84A 3M2VA 1JMTA 3WDOA 2CPZA 1T94A 4LQ3A 1OYDA 5F8IA 3KKFA 4Y2CA 2KJWA 3PX0A 2F9JA 3QSIA 4GVBA 1IJEB 2OEMA 3I0RA 4WZQA 4LFBJ 2C3PA 4K4TA 1SKSA 3R1HA 1ZOTA 5F9NA 4IH6A 3C6UA 5E3AA 2Z58B 1RT2B 4A4JA 2MZQA 4NX9A 2VBWA 8ATCB 3TAMA 2R7UA 5M2PA 3BGLA 3CULA 4JI2J 5KFMA 3WIUA 4R8UA 3Q8YA 2P8IA 5KFQA 4JV2A 4N41A 2D9PA 1ZM4A 2CJBA 1YJRA 3CDBA 5JUMA 4ZVPB 1HMVB 2D74B 2IIHA 2XEXA 2RF2B 4QIFA 5LSLA 1UMJA 1NEEA 2QYCA 3AB4B 2Y1LB 3D4JA 3OJUA 4ECRA 3RBDA 2HVEA 4ZS6A 3U02A 4HACA 4B9VA 1DAXA 3GILA 4CH0S 1CEZA 2W7AA 2D3OR 1OYEA 3OTEA 4IDKB 4ZCLA 4DN0A 3JB9k 4TLQA 4LF7J 2HPUA 2EG2A 4FXVA 1Q7YT 1LW0B 1MWQA 1NU4A 1WWHA 3T6BA 2OIHA 4KYZA 4KIAA 2V2KA 4NYOA 4ZVUB 4NZ7A 3MM5B 1AFIA 2B4OA 1ZTTA 3EM1A 3OQ2A 1GMUA 4PEOA 4X64J 2PMHA 2FJXA 4F3MA 3GFHA 2D41A 4W98A 1U47A 2UUAJ 5FJ4A 5F0UA 1ZPWX 4OLPA 5K20B 1PBUA 1C4CA 2GZOA 3Q8QB 4P2SA 4M5LA 4DV1J 4WK3A 4QWDA 3OFGA 4ZVTB 1YBUA 1JIHA 5B09A 1J2VA 1RTJA 5C24B 2RDJA 3SYZA 2E5LF 2HMIB 2ZD1A 4OJ1A 5CCLA 2OFGX 5T14A 3R5GA 3PHEA 2DR6A 2IYGA 4CLKA 3BQ2A 4EZ9A 4XO0A 4JV5J 1WOOA 1SCJB 5K8NA 1T7PA 5K9FA 4RNMA 4PAAA 1FJ7A 3VCDA 2V34A 2BJ9A 1HQEB 2DXDA 3MDFA 2MGZB 4DCPB 2PT0A 2CIMA 3U1LA 4DUYJ 4N5SA 1UVNA 3T1HJ 2FB0A 4NLSA 2HNYA 3DDKA 4U8VA 2ZBCA 2ABYA 2RJZA 2UUWA 4IOAQ 4PKDB 3BGRA 2NCKL 1EETB 1PILA 2IVMA 4KH0B 3ZXWA 1KRPA 1SQFA 1YRXA 3FSXA 1PKUA 1F2HA 1S1WA 2HNYB 2IBOA 3EJMA 3HHLD 2F8EX 3L9ZA 3FGVA 5AT1B 5C42A 3G6ES 4DS4A 3KTQA 3RRHA 3FEZA 3UWTA 2PE8A 1WOSA 2W4PA 1HQEA 2RS8A 3ZFVA 4DV3F 1YZ7A 4JI5F 4LJMA 3PEJA 1F2GA 1A9NB 3H5XA 3LO3A 4P2XA 4FDFA 4ZN3A 4EBCA 1IBMF 4NWBA 5E0OA 2B7BB 3R97A 5A2QU 1N32J 2DGWA 1K1SA 2Z0GA 3IWXA 2C2MB 1M90T 2UVRA 4PUOA 3SCKE 2Y0BB 2Q6BA 2HRUA 1YIJS 1TKZB 1Y11A 4USWA 1KR4A 1KHVA 3W9HA 3LGHA 1NSQA 4DL6A 4RL1A 3WZ0A 5DLGA 1L3TA 4JI2F 4KHRA 2EFGA 2J0XA 2KG1A 2WW4A 3PVXA 2ZJQQ 4MYUA 2OP5A 2V94A 4L3NA 3TANA 4ZLNA 2KFNA 2DHXA 4LIRA 4F26A 1FK9A 1NAQA 3AD9C 3HD1A 4DEZA 3CVKA 3B6BA 4H54A 3R2DJ 1R89A 2WOMB 4WK1A 4QWCA 4F4YA 1ZTWA 2UV8A 2HQIA 3DRSB 1ROFA 4JI3F 3DLJA 5GADI 2GO9A 5F3ZA 2NS1B 1ZAXA 3BH7B 3Q2SC 4RPFA 5E2QA 4DPXA 5LXYA 2X1AA 3LUYA 2EFPA 2BDPA 4B3TJ 4K4YA 4GO5X 2XMJA 1RWXB 4HACB 2JFKA 2XMKA 2FLPA 2P9EA 1NK7A 4DSJA 2CZ9A 4DQPA 2HGNA 3O44A 4ECVA 3RRGA 3L7OA 5KFXA 1FE4A 2DGTA 1JJCB 3CDAA 5F41A 5AE2A 2R7OA 4ZVOB 2LU2A 3UDEA 1S6UA 2EC2A 4XPEA 4NCBA 3DLKA 4ZLLA 1HWJA 4USJC 1VQ5S 1GX6A 3BR9A 3VGSA 3QRQA 4LF8J 3HMJG 5KFLA 4FYXB 4A47A 4USVA 1UA0A 2EXUA 4RBUA 1DTTA 2Q79A 1V5IB 2DHSA 3V81A 1Z4UA 3B54A 4EFAC 1HBOB 1WTBA 1Q0NA 5CZXA 1IKVA 3C16A 1ZZNA 3MR6A 2GMHA 4NLRA 3DLEB 4RWWA 4DV2F 1NZAA 2B5JA 2VG6A 3JAMU 3TAQA 3ICLA 3BYRA 3CXCR 4JI5J 3ZTSA 2R2UA 1HARA 2DIVA 4NOHA 1SC4B 2QLBB 1QTNB 2XMMA 3AQOA 2BJDA 5ETOA 1SIWB 4AYBD 4DG1A 5L38A 2V4QA 4NCGA 1KD1T 2HQGA 2YNHA 2ZITA 4ITSA 3R6LB 5T7LA 4OI1A 3TP2A 4DN9A 2HS0A 4DR2J 2BQRA 5E3PA 2FYXA 4DFMA 1LV5A 4DOZA 3C14A 1IWAA 1RAGB 1BQMA 3CJQA 2EC0A 1C0TA 2IHR1 1Q4RA 5EUHA 1RBAA 4QU7A 1FD2A 2XULA 3VGVA 4LBPA 4ECQA 3I87A 1IBKF 4GMKA 3RJMB 1RISA 3HJVA 3SIPB 4D3GA 3KYLA 2NREA 4KR0B 3TVYA 4FXDA 3NGRA 4DXLA 3NGDA 3KLGA 2MQQA 1RAIB 2ROEA 4JYAF 2O3DA 3ITHA 2DHGA 2QT7A 2GS8A 5KFEA 2HZCA 2N82B 3KLVA 2WVCA 3DLGA 1X9MA 3AH6A 4DV0F 2OSQA 1S4EA 4OQJA 3IS9B 1SJ4P 3LA0A 4DSKA 4F8RA 3MCOA 4ZVSB 1N5TA 4ZP9A 1WUUA 3T5KA 1OS5A 2O67A 2HVDA 4X2BA 2OI2A 1N36J 4FYVB 4CWBA 3M6XA 2L08A 2NUHA 2B8QA 1GX5A 1WC5A 2V0NA 1KDNA 2L3MA 3N5FA 1D9DA 5KFBA 4X4PA 2VPWB 4MT1A 2DGVA 3UDLA 1HYSB 3L95X 1R8HA 1SL1A 2AIRB 4ZK7M 1Y00A 4LIWA 1C4AA 1KLMA 4L73A 4C8NA 1NSAA 1PSDA 3R9LA 5L1KA 1KC8T 1C2PA 3VV2B 3W65A 1KVIA 2DNHA 2RUGA 1WDTA 4A46A 5KFZA 4HLBA 2N4DA 4KV8B 1VQYA 3HLUA 4BWMA 5DQGA 1QLNA 1B0VA 1H2UX 1TKXB 4F50A 2HIYA 3T19A 2OJ3A 3I55S 2OTLS 2XG8A 4O23A 5KG3A 2HBYB 1HQUA 3HSDA 4MK9A 2YPYA 3ZZYA 1D8YA 2ZDPA 1FVSA 4PUOB 4P10A 2JHEA 3Q24A 3ADAC 2CPHA 3MEGA 3AJ1A 4CLYA 2XZWA 3FMBA 1UFKA 4F2RA 1HBNB 3MUTP 1Y10A 2ZZNA 3VZHA 4BHQA 2EKNA 3NGUA 4ICLA 4P75A 3TJ8A 3BPDA 1U2CA 5D4LA 2IM2A 4LFAJ 4WE1B 4IG0A 2HAFA 1GNKA 2MLYA 2BZ2A 1CULA 1LFWA 2V2QA 3AA8A 1YJTA 3POTB 8RUCA 5HP1B 2VJUA 2E1CA 3CCJS 3PACA 3PR4A 1TAUA 1N5VA 2RKIA 2V50A 4ZVEA 5KG0A 1SKUB 5L46A 2XO6A 1RWKB 2LP4A 1ZM3A 4IQXA 2COLA 2QSWA 2XZTB 3AJ2A 1WHYA 2NLWA 3CIZA 3IR7B 2CJAA 2LCWA 2VASA 3D0GE 3HVTB 4FKXA 1WEXA 1BQNB 4HTJA 4KGMA 4KQZA 1NKCA 1HW9A 1XWLA 2RKIB 2W01A 3QPIA 4L3KA 3VF0B 3WBZA 3MM6A 5GVQA 3KK1B 1J5EJ 4B3MF 4PQUB 4NE9C 1D1UA 2EVZA 4OYZA 2IMWP 4CLFA 1VK3A 1Q8BA 2YBVA 1TV6A 2PSZA 5E5NA 3MUMP 1BC6A 4ICLB 4RW9A 3CT9A 3MEEB 1U0SA 4F7VA 2P6TA 4DWIA 4LSNB 3OHAA 1FESA 4JI1J 1TFYA 3VQTA 3J81U 3MFHA 3U27A 4C6AA 3CD0A 2DNLA 5ETLA 2ZH2A 1NNDA 4O44B 4DR5F 3N5BA 4QBUA 2RMLA 3D9BA 2BKOA 1VRQC 3M8QA 4WU2A 1EIYB 2YKMB 1BMQB 1PJ5A 2AEJA 1U1NA 5SZTA 1F0XA 4DR1J 3T5JA 1S1WB 5AXMA 2XY7A 3K58A 1KTQA 4F25A 4X65J 2YKNA 1S1VA 2KTQA 1EQ0A 2WSFC 1CJVA 1DBDA 1Q8IA 2AJFE 2AX1A 3DN9A 3OXFA 4YS2A 1LOUA 5GAHU 2D3ZA 3NS6A 4Y2AA 3AD7C 2RVJA 4DUYF 3D6TB 4YFUA 3EGVA 1DTTB 2H54B 3W1YC 5B08A 1X4GA 2A6OA 3JSMB 5IT4A 4I2PB 4CIOA 3BYPA 4NXMF 3KG0A 4X65F 3SZ2A 1RZMA 2F3JA 3D0IE 2FZCB 2FY8A 2IM1A 3PW5A 1GEHA 1X8DA 5CAAA 1Y3JA 1CJKA 1ZA1B 3GFXA 1QAJA 2MKJA 3SFGA 3ZTOA 3P49B 4I6AA 3M8ZA 2QEXS 2MQ8A 4Y2MA 3V5RA 3MEEA 7AT1B 3CC2S 1S1VB 3QAEA 5IWAF 1ZYQA 5KOWA 3GJRB 5G0RA 4ZP7A 1RT7A 3EYZA 3DYAB 5DGAA 1HNVA 2JEJA 1N54B 3HK2A 3Q0AA 3JSMA 2VL1A 1C1BB 3CCZA 3MM6B 2CPIA 2C3MA 3M8QB 3KK1A 4F4ZA 1B70B 2J0WA 1FDBA 4PG7A 4EBDA 4R25A 1J5EF 4B3MJ 3RW6A 1N4LA 3A3NB 1DQ8A 2FHJD 3FEYB 4Q8FA 1IN0A 5LSOA 1UAWA 1JLAA 2B4PA 4GVBB 3PIOQ 1NDCA 2ZM6J 4R0EA 5IZHA 2VPXB 3CB4A 1WHWA 1SJQA 4HDGA 1UVJA 4PWDA 4M95A 2M8DB 2BBEA 2GVDA 2YWEA 2WBMA 3ZC4A 1N33J 3PY8A 2DO0A 5KFAA 2HVHA 1UVKA 1VQ9S 4N7TA 3VGTA 5IT0A 2P2CB 1HBNA 3V4MA 5KFGA 2K7KA 2E7WA 1U4BA 1OJ4A 4RW7A 1S1TA 2CZ4A 2KN4A 2GQQA 2V68A 3UE2A 2W8LA 3OTDA 1P9QC 2HHPA 2PGCA 2YWKA 3CJ3A 3V81B 2FLNA 3IR6B 2EEYA 3F56A 1SV5A 4OZ3A 4DFKA 4GKJJ 1UWAA 4NLGA 2QYGA 3F73A 3NNCA 3C6UB 2RU3A 1JLCA 2KHCA 1OY8A 3RBZA 2KDOA 4DL3A 3M8RA 4DV2J 1HBMB 2Z30B 2OFHX 2HWHA 2XMTA 2C22A 2ASLA 4FNIA 1M5KC 2GFFA 2DPIA 5HK4A 3IO1A 3QJJA 2QLXA 4ECUA 5LMUF 3B4DA 1RGVA 3DC2A 3V6DB 3NNAA 4IKAA 3D1QA 2YVSA 3QO9A 4NRTA 4FBUA 3I9ZA 3JAMY 2AYBA 1WC0A 4MKAA 3UVJB 1U6ZA 1HNZJ 3C6TB 2Y1JA 2C1EB 1CC8A 3DM2B 1QM9A 3IRXA 4CO0A 1FX4A 1Y0HA 4ZJLA 1N52B 2AZ1A 2BANA 2W4DA 3P45B 4NLXA 3W62A 3M8SA 2GMLA 4RJVA 3WC2A 2F8HA 1WACA 3IN5A 3TR5A 3PTWA 3UD4P 1NK0A 2D7SA 4MH8A 3Q8SB 4DQRA 4KB7A 4DV6J 4WKRA 4NLDA 1HYSA 3C6TA 1HNWJ 4B9NA 4QU6A 1LWEB 2FC9A 5KG1A 4BBYA 2DCUB 2EG1A 1WI6A 2JRSA 2BM0A 3GR1A 4K59A 1R8BA 1M5HA 3O1LA 2O01C 3QBCA 4Q2MA 2I6WA 1BUXA 2D3UA 2XNQA 1HWUA 1RWVB 1TL7A 3QO9B 4P7VA 1H7XA 3SEOA 4WP9A 1B4SA 3TOQA 3E2EA 3IS9A 2QA4G 1WJ9A 2E1RA 3J7ZT 3MEDA 2CNOB 4FZVA 1K1QA 4L6V3 4RUBA 2UUBJ 2KFZA 2VFUA 1DRZA 3U7JA 1VRTB 1CVJA 4GO7X 1C0UA 4Z37A 4WCEQ 4EBEA 5CYJA 5C42B 4ALZA 5HP1A 4ECWA 4IOCQ 4OZ2A 2E66A 3EGZA 4B3OB 2POKA 1Z2LA 2LLZA 2YWFA 3A1YG 1RAEB 1RLDA 2BXJA 2BVZA 3GIJA 4ZPVR 1NSPA 3CC4S 2Y0SD 4R5PB 3C14B 2I5JB 1CJTB 2CG8A 2MKHA 3GJSB 5SUHA 2Z56B 1PAUB 3FNNA 4ELUA 3SCIE 3CDWA 2HHQA 2B56A 1D0EA 3FBCA 4B02A 2CPXA 1R43A 5E41A 5GAEI 1WF2A 1VFJA 3NGTA 2A6MA 4PPZA 4AL6A 5C25B 3NNHA 3W7BA 4DPWA 4NZ0A 1FVQA 4RW4A 2HK2A 2MQNA 3D3BJ 2VBZA 3K2YA 3MMAA 2AF6A 1Q1KA 2ZOGA 3HF5A 3ONQA 1KWMA 3QT5A 1IR2A 1UEKA 4FP9A 3MWBA 3BH6B 3KFWX 4UZCA 4ANEA 3UR0A 4DV7J 3CJ5A 1QSSA 3J81Y 2KJVA 4C8ZA 2MY8A 2P9CA 3KLHA 2W1BA 2KXHA 4U7CA 2OUGA 4HL9A 5KFPA 5BYQA 3D68A 3KLIB 5C2CA 1FI4A 1B7FA 5K14B 1QE1B 1UETA 1YJUA 2ROPA 3ZZ0A 2ZBPA 4OL8A 1HNWF 3C2PA 1XQIA 4YR3A 2JFDA 2WAQD 3L4BC 2HS3A 1IM6A 1AZSA 1TKTA 2CJ9A 5LOQA 3OTOF 2CQBA 2V67A 4JI7J 2AKWB 3H98A 3H7HB 4RW4B 3AHPA 3Q86A 4KGXB 1T9WA 3M1VB 2JNJA 5I4MA 2ZHAA 2KO1A 3MPVA 1FRHA 4RNNA 2VKRA 3MCNA 2DXEA 5DM7Q 2OKQA 3DLKB 2R8JA 1U0HB 2KRBA 2BRLA 2UVUA 1CQMA 3KHRA 3IM9A 5J2QA 4CDIA 4XIUA 1X5SA 3M9MB 1R27B 1HD1A 1N33F 5A8KA 3PYDA 1XNRF 4ED5A 2X7IA 1X0PA 4LR8A 2VBXA 4WFZA 1RWNB 2PMZD 3MAAA 2QFJA 2MLXA 2QMUB 4WBFA 5DJBA 1JLGB 1TL5A 4DPUA 3F0NA 2FJBB 1WKLA 5DQHA 3DRPA 3MD3A 2HFNA 2XSJA 4HHHA 1QUVA 3AOAA 3EVMA 3HZGA 1TUWA 4LSLB 3BSOA 1VBZA 2M5YA 4JI6J 3TUZC 2Z4PA 4NMXA 1NDLA 1X31C 1YKWA 3UN5A 2JC1A 3ZTRA 5CA5A 3E01B 5M2RA 3M8PB 4DSEA 3C15A 1IKXA 1JNZB 2EK6A 2LECA 3OTCA 1DTQA 2VG7A 4B3SJ 4KH1B 3PW4A 4KSEB 4IR1A 3CJTA 2VG5A 2EFVA 2O66A 3MR2A 5ADZA 1N34F 4M63A 1E6YB 4NI2B 1EJ7L 3HVAA 4N76A 1F6TA 2VB6A 3M2VB 4BCAA 1I51B 4EMDA 3UD3P 3DRXA 1Z1ZA 2X51A 3OSPA 1XMQF 3D28A 4DV0J 1N5YB 3BSCA 3CO9A 4OJGA 2ERRA 1GQEA 4OYWA 4ES2A 5FDLA 4AQYF 5LMNF 1KFDA 2L41A 2BJEA 3T3FA 4ZPCA 1EETA 2I38A 3NS5A 4FKYA 3R7SB 1A0OB 1S99A 5J2QB 2FD2A 4H4KC 4ED3A 1VQNS 1HNXF 2XB2D 4NLTA 5E3RA 4DUZF 2IPOB 3ZZPA 2B9XA 3JQKA 1DFDA 1S9EA 4I68A 4ATNA 4OV1A 2E29A 2G0JA 5IWAJ 3PNIA 1NHUA 3V6DA 5ETRA 2WBRA 3HFVA 3BO4A 4N56A 2MQLA 4OI2A 1SL2A 3QGGA 4QQBA 3TEHB 3IAM9 1K8AT 1S6QB 1ACMB 2HQDA 1HBMA 1RHUB 2F63A 4C8YA 3G6VA 5AJ3J 2FVRA 3KLGB 3P6YC 3O5TB 4IDKA 3OXGA 3TVZA 2E7VA 4O3QA 2YWGA 4WYLA 1NB7A 4WU3A 1JKHB 1N0VC 2CVIA 3N6MA 1NKEA 1J5OA 2H51B 4OX9J 2HBQB 2HHXA 1KTVA 2ZWPA 3Q8RB 4DV4J 3IAS9 3A3PB 3MUVP 1BQXA 1RHJB 4I64A 2F40A 4PCQA 2GAHC 4C8MA 3S6EA 2VQEJ 1HWIA 4FPIA 2OH2A 3MMJA 1T9UA 4GRSA 2ZHBA 2UXCJ 2Z8QA 3SSRA 2CQDA 3CCRS 2G0IA 3DHXA 2UV8G 4OJHA 5KFTA 3TAMB 5D3GB 4QWAA 4MIAA 1OSDA 2V6AA 4DG1B 2ZVSA 3CJRA 3K59A 1LWFA 3UFCX 1M5VC 4DR3J 4DR7J 3SCLE 1NJIT 3P5BP 2LQ5A 1WSVA 3R8YA 1H0HB 4A8QA 1JLAB 3RAXA 2RHSB 3RGIA 1HBUA 3WC0A 3BSAA 1IJFB 4GKKJ 1LXNA 2MZTA 2V2ZA 2JEGA 1WG1A 1YTYA 2RB7A 4NLWA 3T9NA 4WYWA 1RWPB 3DXSX 3TZYA 2MKKA 1GMWA 1TELA 2JLFA 2GCFA 4OHVA 3AAWB 2YWWA 3G82B 1YWXA 5GAHI 1EAYC 3RRKA 3CCES 4OI4A 4RU2A 1HNZF 2YNIB 4KHMA 4DZDA 3OFFA 3PIPQ 3MFIA 3SMZA 2JVOA 4DCJB 1EKRA 2GGPB 2ZC4A 3I0RB 1FRXA 2ALYB 2NSCA 3QIDA 3KUHA 3R5JB 3U1MA 3VWSA 3X1LB 1FJGF 3MPUB 5KG4A 3R5CA 2V2VA 2H65B 3UNGC 5EWFA 2N3LA 4I6YA 2FDNA 3LPEA 3EPGA 3TQ1A 4F2SA 1UJ4A 2R7VA 4BC9A 4E98A 1R0AA 1Y5LB 3K17A 3ZNJ1 1HI1A 1QY7A 3DRSA 1QJHA 3IFEA 2ZKTA 2WSCC 3M1VA 3H4BA 3BF4A 1MROB 2OD4A 5DDQC 4K4WA 4LF4F 4FS2A 2LQ9A 1KSPA 2BRKA 4NXNF 3W2VB 4ANCA 2WVDA 3D6MB 5K8PA 3W5XA 5HQ8A 2W7OA 2W9CB 3HHNB 1RCXB 3ENVA 1D3WA 1SBRA 2BE2B 2NXUA 3D0HE 4DPOA 5IS2A 3OLBA 2W9BB 4X4NA 4BDPA 1XR7A 2LYVA 1M5SA 2HBRB 4TVAB 2Z2MA 1RT1B 3K57A 2C2RA 2AJ0A 3G8QA 3T1HF 1OO0B 1R7IA 3MZIA 3UN2A 3A8IA 5J2NA 1G6BA 4QYRA 3PJXA 4CNZA 4ILLA 5HAOA 1LK5A 4LSNA 4YR0A 1UW9A 1URRA 2AX0A 2Q1LA 5D0RA 4ECSA 1UJ5A 1F1BB 1SUQA 2XCPA 1S7HA 4CLWA 4I6WA 2CPYA 3G87A 4C3LA 3BQ1A 4ZVRB 4EYIB 1RAJA 3FZBA 1U26A 4Y00A 5DM6Q 1JJ4A 2BE7D 3IBFB 2CJQA 1DHMA 3V6HA 2L9NA 1IR0A 4C2MA 2VOOA 2MHNA 1BGXT 1SC6A 2VPZB 3N4WA 1C1CB 2BABA 1U6FA 4ER8A 2HVIA 3RR7A 1FKPB 2XYHB 2AZ3A 3NCQA 4QR1A 3Q8VA 4QWBA 2E5JA 2OMOA 4DUTA 3WQPA 5KT6A 3D2WA 1GTEA 1NKBA 2E5IA 4Q0BB 1TKZA 2W2NP 1NSKL 4AFFA 2XNRA 4J91A 1QDUB 1QSYA 3D1HA 2N7CA 4NLPA 2MSTA 1NDKA 4UOFA 3DKDA 1LEOA 2CNNB 1NM2A 2QIFA 5U47A 2Y1IA 2HGLA 1Q86T 2QGFB 3IXQA 3J7Z5 3BREA 3DGVA 1KOHA 2V8PA 1VLYA 5IOLA 4IFYB 5CH7B 1RTIB 4K4ZA 4V1Ak 4Y65A 4JV5F 2CQHA 4KRWA 2RQKA 3QZ8A 1YLXA 5IT9Y 1PO6A 1E6YA 4NYZA 4FYDA 2DCLA 3DOMB 1UJ6A 3HHEA 3DU5A 2FLOA 2F7VA 5I3UB 2LMIA 4B3RF 3ENAA 1U8SA 3FCVA 2RAQA 1UVLA 4LRFA 3TA2A 4Q7AA 3M8PA 4EYHB 2M52A 1FA0A 3SDEA 2UVVA 2ZZTA 2Y3YA 3AQPA 1JWWA 4LSLA 2IC3B 7FDRA 3TVKA 1LW0A 3T5LA 2UXCF 1VQKS 2OAUA 4FNHA 1PJ6A 4WIIA 1X4FA 3ZO7A 1N5SA 3EWGA 3PHTA 1YG0A 1HWKA 3KDOA 4K5SA 4OHZA 3JXOA 4EGLA 1KQGB 4MK8A 5EHHA 1UEUA 2J8AA 3KWMA 2GO8A 2KYZA 5DETA 2FQQB 2U2FA 4EI2A 3IMQJ 2J9DE 3OR1B 2XMVA 4PQAA 1WG5A 1MWZA 1LWCA 1R3NA 1SC3B 2YQ0A 3ELHA 3OTBA 1RK8A 2VV5A 2VFVA 4J9QA 2J7KA 3THPA 4QW8A 2NXNA 5HSPA 4ILMA 2YNGB 1T9VA 2HFZA 5KFYA 4C11B 1IKWB 3HXMA 1FFGB 1SVDA 5HANA 2C2OB 4C4WA 2MSSA 5KFFA 2QV6A 4DFJA 2HFOA 3GIRA 3NKYA 1FJCA 3NOCA 4MAKA 1ZAVA 2WB1D 2FHMA 1KEKA 3CW2C 3GZ7A 4O3PA 2M4MA 2PA8D 2NXJA 1FKAF 3I9V9 2FVSA 1KN6A 1S9EB 1X4BA 2MKCA 3G2XA 4YMEA 2DRDA 1BWVA 1HNXJ 1K0VA 5GMEA 3PZPA 2X1FA 3CCTA 4UZBA 2LEAA 4UTGA 2HHWA 1PBAA 3KK2B 2HS4A 2IM0A 1FXRA 1VQSA 1HPZB 5A76A 5A8RB 5BR8J 2OPQB 3OVSA 3T1YF 5F8LA 3TWZA 2CQ4A 3I0SA 4HH1A 3BB5A 4DR1F 3IA0A 2CJKA 4DR4F 2DNPA 1KKHA 3EZOA 4A48A 1RT3A 1TUGB 2GJFA 2ZDOA 3A12A 2K06A 3FQLA 3GSIA 3MI7X 3TJAA 4ZN1A 5HI7A 1NXIA 1U0HA 3GE9A 2FGOA 2J9CA 3GLJA 5B0DA 4J9KA 2KB2A 3VAHA 1HA1A 4O3NA 1N48A 2WZ1A 4F3OA 1W26A 2R7RA 1BE4A 1BQMB 2AJQA 4AD6A 2NZCA 2ZJRQ 4O3SA 1Q5YA 1FRMA 2OPRB 1WOPA 1Q78A 5A8KB 4IRDA 2F5GA 4NLQA 3FEXB 3HDSA 3IBWA 4WXWA 5ETNA 5J2MB 2IAJB 1R6YA 5E3CA 4JI6F 1IBMJ 2AT1B 3MAHA 4ZJQA 5I42B 1Y9OA 3FRYA 4F4XA 1RCOB 3NBPA 1VQPS 4BS2A 1MW7A 4IR9A 4KPYA 2CPEA 4YEAA 2QN6B 3M8WA 4IQMA 5KT2A 3MD1A 1UCNA 2KVQE 2GIRA 4OZ5A 5HBMB 5IT9U 1U45A 4OV6A 1NZ8A 3D6FB 2CQ3A 1U25A 1QAYA 4DPTA 4C11A 3R2CJ 2NPIA 3ZZTA 2G13A 1E6VB 4N77A 1MROA 4EWTA 2KFYA 4Q5VA 1XR5A 2O1PA 5D78A 1FTRA 3W5ZA 4OFZA 3HKWA 5G0RB 3WIVA 1N36F 3KLHB 1J27A 4DMZA 1NHVA 1RDRA 3E3XA 3MF5A 4YDXA 2DIUA 3BGOP 4DR2F 4P52A 4B08A 3KJVA 2HLUA 1DQ9A 2HURA 3OL6A 3EZ5A 3CEDA 4Y0FA 2I2YA 3AODA 2WCXA 2AYGA 1X5OA 2V8DA 4LSZB 3GV7B 3HP6A 1SL0A 3R5DA 2LVWA 1WI8A 5GAGU 4ZVHA 1UPMB 1RSCA 3LGNA 1RKJA 4F0HA 2Z2LA 5B0FA 4PG8A 3CMAS 1VRUA 4LF7F 4ED4A 3KLIA 3MM7B 1U1MA 4XTTA 4I2PA 2MQOA 2H48B 1FXDA 4U8YA 5DZ6A 4NEZA 1U49A 3RW7A 4N47A 4WTOB 1V3SA 1O6XA 2UXBF 2VA2A 4LF8F 1SH0A 3M6WA 3CJKA 3H2LA 2OMLA 1N56A 3V6KA 2IVYA 5D6GA 1VIOA 2LDYA 4IOBA 5KFRA 1S6PA 1YZ6A 4RX6A 3LQVA 4UT4A 3BSNA 1TL7B 4FXWA 1SV5B 1T11A 2NYIA 3BDPA 3B8HA 3ET6B 4JI8J 2EFNA 3NCRA 2CQ0A 1JX4A 1PYSB 2WSEC 5CYQB 4IFYA 4DX5A 5A8WB 5JVGQ 1TL1B 5GADU 1TMJA 3MEDB 4JI3J 3QZ7A 4JI0J 5F0WA 3IGVA 2JJ4D 3GONA 3K5LA 1RTDB 4KY3A 1RT6A 5LL6d 3OUYA 5J2NB 5DO2A 4B9TA 1S6OA 2DY9A 1J5OB 2NPFA 2CJYB 2GA7A 4DV5F 1QVFR 2ZZMA 1HQUB 1RWOB 3EVOA 3I32A 2E1PA 2HQFA 4LRCA 5IXUA 4KPCA 1C0UB 4LBHA 1FT8A 4WKYA 5HQMA 1GXLA 5KTQA 4I56A 3KG4A 1IBKJ 2DRAA 2Y9HA 1DZ5A 1RU2A 1LK7A 2YY3A 3L7PA 3LOUA 4YY3J 2KI2A 4TY8B 2ZH1A 3BGRB 3SV4A 3HHKA 1HKAA 5FD1A 5HJXA 4PZVA 4DV5J 1NK6A 5H1SV 3GJQB 3NGSA 1LNQA 2AJ4A 1R0CB 2XGQA 2QO3A 4B9SA 1NO8A 2KXNB 2AGPA 1T02A 3GMGA 5BJRA 3LP2B 1U09A 4F4WA 1FERA 3MMBA 4DV3J 8AT1B 2GHVC 2PIIA 4ZPBA 2MZSA 2DNRA 3H2UB 4URQU 1NPRA 1KLNA 2ALZA 4JI4F 4OYXA 1PJ7A 4LR9A 4OX7A 2ZD1B 3PW0A 1O0PA 3OJSA 5A0YB 3ISNC 3VZIA 1QE1A 2DGUA 4DCOB 1KVJA 4IO9Q 2MTLA 4HEA9 4IO1A 4LR7A 1VQ7S 3N79A 4MK7A 2AWZA 1TK5A 2H4WB 4MYTA 3M8YA 1P1LA 5THWA 1N8RT 3I31A 2RSQA 1NBEB 2YQ3A 3DNCA 1JLQA 2WW8A 3LGMA 5F8HA 2LEBA 2DR8A 2J7UA 2UP1A 3VALA 4KAIA 4LFAF 2R2RA 1SJ1A 4M1KA 5AJ3F 1IKXB 1RTHA 4KFBA 4Y2IA 1YGYA 4RW6A 3GWCA 3TJ9A 3CCSS 4CO5A 3TX8A 3EUNA 2YKMA 5KFCA 2C3OA 1SJRA 4NCGB 4QW9A 4ZCIA 3MMCB 1RTHB 4HH0A 3W3SA 4FVMA 1REVB 2AV5A 1K47A 2KT5A 3LP0B 4X66F 3R6GB 2R4FA 5KFHA 1RHMB 1K9MT 3NAIA 1A6LA 4ECYA 4C8KA 3MOJB 2V8VA 3OW2R 1TV6B 2YNIA 5ETTA 5D4PA 2R8KA 1RWWB 2KHDA 3DRYA 3FVYA 4DI6A 4XPCA 3CPWR 2C3YA 5HVGA 1QD1A 3HVRA 5D0GA 4A8MP 3X3UA 2XSFA 5A0YA 2VA3A 5LT5A 3SBMA 4PG4A 2XLIA 3D5MA 3QATA 1NUEA 4XK8C 1I94F 4B9UA 4CH1A 3N01A 5IQ6A 3DOLB 1VI7A 3UD5A 2C28A 3ILJA 2HFSA 1WEZA 4ZOSA 4RU9A 4J9PA 1KVKA 2GHPA 2CQ1A 1TKTB 3EVWA 4QR0A 1VS3A 4WPAA 1H38A 3M6VA 4NYPA 3V6JA 4G1IA 4B9MA 1T9YA 3QT6A 3N9UC 1CULB 1URNA 1SH3A 1HNVB 1QAXA 5EX3A 3IRWP 4RW6B 3DHWC 5H9EK 3SI8A 3L09A 2JLGA 1VC5A 4QIEA 2QG9B 4CM2A 3CGIA 3UR3C 4R8UB 3CCVS 4ETXA 4ZPAA 1IQZA 1RKIA 3V4IA 1NH8A 2ZOMA 2L48A 4FBTA 1L3SA 2CQGA 2LEPA 4M5NA 1G7CB 3G6YA 4AL7A 1MLAA 2VIHA 4KTQA 4RW9B 5HMZA 2OHDA 1HHTP 3Q22A 1LW2A 1LWCB 1XMOF 5ETSA 4TU8A 2Y8WA 2HVZA 3GB0A 5L9XA 4MJKA 1BD6A 4X4VA 3BDEA 4CZCA 2P5VA 4O44A 2K1RB 5F8GA 1DJ0A 2AYEA 4PXDA 2CYYA 4C98A 3BR8A 5CXTA 3PJ9A 4UF4A 1HNIB 1IQTA 2RILA 2VUGA 4B17A 1WHVA 2UUTA 5HVFA 2U1AA 2VH7A 2VG7B 4ZHRB 1W2BR 1S0NA 3ETOA 4ED0A 3PFEA 3A8KA 3HSZA 3LP2A 3G96A 2ZWOA 3K5PA 1JLCB 4G1PA 2PC6A 1TAQA 2V4JA 5J1NA 2M70A 2WVFA 4LT6A 2Q66A 1I6JA 2XMAA 2DH9A 4ED8A 5HROA 2RQ4A 1WC4A 3P3DA 5DQIA 1ELOA 4LF6J 5IV4A 1JJ2R 2EBEA 3DLLQ 2MZRA 3I96A 4OI6A 3HVTA 2ZH3A 1AUDA 3QGHA 1KOOA 4K4VA 2GQCA 2EFOA 2CPDA 4LRBA 4NLVA 1FRLA 4P2FA 2KM8C 1U1LA 2DR9A 4WZMA 2HSEB 1FX2A 2CZVC 3ITHB 2QMWA 2I1RA 3FUYA 3GYNA 5J2PB 1PC4A 2C42A 2K1RA 2XWXA 1HI0P 1P9YA 1VBKA 3OR2B 3R27A 3NP5A 4K2JA 2XLJA 3KNAA 4DX8H 2KZZA 3PX6A 1S10A 2DR7A 3TARA 2UU9J 1FO1A 4B9LA 1T03A 2R7XA 3CDEA 3QMQA 2ZC3A 1ZM2A 2R2SA 5J2PA 3ILIA 4NLYA 1YRUA 4F4AA 3PX4A 4A8OA 4YB1P 1O8BA 2ATCB 1ZM9A 1D9FA 4LFCJ 1V3ZA 1Q81T 1TL1A 5AXKA 4CYUB 3KLEA 3KJVB 2JEFA 2EI5A 1K44A 2VPYB 4JI7F 4JI4J 1MN9A 5KFUA 2NZ4A 3ENWA 1RTJB 4USHA 5C24A 4Q0BA 1YI2S 2C2DA 3MM7A 2RRBA 4ZJOA 1TMMA 1O51A 1UTAA 3W63A 1DQAA 3QNWB 4FYYB 4J9NA 1EB0A 1V5VA 2EBGA 2MB0B 1IKYA 3BKTA 2BJ8A 2J8SA 3HHLC 1IVZA 2X1GA 2A2CA 3M30B 2G0CA 2JDJA 4NRUA 4HYKA 4JUZA 1WF0A 4NCAA 2G1HA 2XMWA 2ZHOA 3SSQA 5IM0B 4OX9F 2OELA 3JSBA 1FDDA 4ZPTR 1N6QB 3NMRA 4OHYA 3PO4A 4LFCF 2XZDB 1EHWA 3G9CA 1HI8A 3FKBA 5JVHQ 4F67A 2UUBF 3UW1A 2X1BA 5EWEA 4DBQA 3CCLS 4DSIA 1JXVA 1LQ9A 4OJ3A 4FF2A 1WC6A 4ES3A 3FBEA 3VVTA 4ZMMA 4LF9F 1NLKL 1ZAWA 2CDRB 3DI6A 2CVEA 2CXEA 3EPIA 1WC1A 3BV8A 2HWTA 2HBZB 1P27B 3M30A 5BYSA 5LXRA 3M4XA 5DGBA 4ZVGA 2W9BA 3TUIC 2OO4A 3HZEA 4CH7A 5KG7A 4JV1A 2JZ5A 1VOMA 2AMCB 2YKPA 5I42A 2O5DA 1N0UA 1TZ0A 3OBIA 4W4MA 4X4TA 5KFSA 3EMTA 5J2MA 2FHOB 3IWLA 3H42A 3DFEA 4Z7YA 3GTYX 3RB0A 3FK4A 2DD8S 1VMBA 2E7XA 2KL8A 1EQMA 3MECB 4DX6A 2IM3A 4NEYA 3KK2A 2ZE2A 1NPPA 3M6UA 3M9OB 3DDIA 4DR3F 3I5BA 4P9SA 2JVRA 4OZ1A 2PA3A 2RDIA 1D8ZA 4YN3B 4RZRA 1R0AB 3BKFA 2LA6A 2YXLA 2GW8A 3PEHA 2ZH9A 3IC1A 2HHHJ 3PM9A 1YDLA 4JBCA 2LKZA 2WK4A 2FPHX 4KFBB 3FBFA 1SI9A 1HW8A 3KLFA 4HHJA 1IBLJ 5I3PA 2HHUA 1C1CA 2W2OP 2ZBRA 4DLEA 5CZVA 5HJYA 1FDNA 5BXIA 4ELTA 2R7TA 4K4UA 1IKWA 3MPWA 5H9FJ 3ZNUA 4NA2A 2UUAF 3R1LA 1F9FA 4GKJF 4NZ6A 5HMYA 2NUUG 4DR6F 1MSWD 1CJKB 1VYAA 2FTRA 2FIUA 2ZOFA 1B7YB 2V5HG 3AOCA 3ENQA 3I4HX 1S1XB 2HHVA 3CSKA 3SSSA 3Q89A 2RRAA 2ADBA 3KG1A 2DVIA 2J6TA 4LF5J 5KG2A 1RYSA 3H5YA 3EICA 2W9AA 4RWXA 1HPZA 3I82A 5M2UA 4GC6A 1M1KT 2GJIA 3LALA 2GV1A 1FWPA 4C3KA 1XNRJ 3CD7A 4RNHA 1CPZA 4TY8A 2VONA 2HNZB 1FJGJ 1PGZA 1S9GB 5D3GA 3PG9A 5MLCV 5KFDA 1NK8A 2YH1A 4TKTA 4NXMJ 2VC0A 1S1UB 1WELA 3ILOA 1OPIA 3CIMA 2ACMA 3UQSA 2LXIA 1RA6A 1WKKA 2DITA 4ZCKA 2UXDF 5HMXA 3M9NB 3W2VA 1NMEB 1FNMA 2VFSA 2QLFB 1WEYA 1S0VA 4L74A 1DURA 4GKKF 3R3TA 4N8NA 4OI3A 3MTJA 2AD9A 3EXCX 5B0AA 3RB6A 1EX8A 1RT4B 2GAGC 3BN7A 3S7RA 1CS4A 1I3OB 2VF3A 1KQSR 1YJWS 1NDPA 2XHCA 2DXFA 1LWXA 2FHJA 1NB2A 3QT8A 5I3QA 1RAOA 1FRIA 1B3TA 4CCHA 4J7CA 2WVBA 5AXLA 3SXLA 4CLPA 3AOBA 1FCAA 2MKYA 4I7FA 2CQCA 2I9SA 5HLFB 2HKEA 4U95A 5J1PA 3NL0A 2QRRA 3GV5B 3THVA 3QFHA 3MGJA 4LUBA 2XWYA 4RNOA 1S77D 2DJWA 1X4EA 4RO0A 5HN0A 3HHDA 3HSGA 3CCQS 2V4JB 1VBYA 1FJEB 3RYLA 2E5GA 2YPZA 4OZLA 1BWEA 2J0SD 1VBXA 3VTIA 3FFIB 1HBUB 1GT8A 3G4SS 2RDDA 3NOGA 3BPSP 1XNQJ 2BR0A 2KZMA 3LP1A 5K8OA 3WHIA 4M5MA 3MM8B 5KG5A 1G3OA 1JB0C 4CO1A 1U48A 1NJXA 5H9FK 2KU7A 3O8WA 3NS7B 3CD6S 3EE3A 4TYBA 3K5MA 3FJ2A 2OTJS 3C19A 1LW2B 4YB5A 3BZQA 3LP1B 3WX8A 4U67Q 4BLGA 3G86A 3PDNA 2GHWA 2VHGA 4DL4A 4A8SA 1X9SA 1NJYA 4KV8A 2R8IA 2MLZA 3R7BB 3CJ0A 3QJPA 3CJKB 4USKA 6AT1B 4OZNA 2CQIA 4OIXA 1UEVA 1WG4A 2B9WA 1GTHA 4IG3A 4LQ9A 1B0PA 1H98A 1OSCA 1RAFB 1VISA 4S0MA 3DOKB 4ID5A 5DG9A 2DNNA 3W61A 4HI2A 1AXQA 3QYYA 2Q3PA 1SUQB 2PFDA 2ZH4A 2CJXB 2RHQB 2RUSA 1S6QA 9ATCB 3QLHB 4QIWD 2AP6A 3OTOJ 2EPIA 3OD2A 3DU6A 4K5RA 4ERDA 2FVQA 4AXJA 2JC0A 3MM5A 4DR5J 2DGQA 2CADA 4DHVA 1Q8KA 2V9KA 3PR5B 3H90A 4K4XA 2E5LJ 1UL3A 2LQBA 3NBPB 2BKNA 2J76E 4WJBA 2PN6A 4B3SF 2G2ZA 2ZFHA 2I8EA 2NSBA 4DV6F 3EDQB 2LXFA 4DF4A 2ZUAA 1X4HA 2H5IB 2R8GA 4U96A 3RB4A 1CJUA 4EEYA 3OL9A 1GH8A 4CLUA 1RAHB 1KP6A 2YNFB 4PQUA 4DV7F 1FK9B 1RTZA 1KQFB 3ZZRA 2OPPA 1VC0A 4CO4A 2OPQA 5A8RA 3I4PA 4X4SA 3KLFB 2SXLA 3L3CA 3FCHA 5CD4A 2M8HA 1WNEA 3W8PA 3G82A 3NMAA 1LFPA 4PWUA 2APOA 2KH9A 2RNEA 3T5HA 1O5JA 1V9OA 3CJ8A 2CFXA 2M0GB 3HX9A 4WXOA 3TX0A 3UDCA 3VQSA 3G8SA 5LMUJ 4OYBA 1XEZA 4F0MA 3H4DA 3C3LA 1UP1A 4QWEA 2YKOA 4MIBA 2F9DA 4I4BA 4OZJA 1VDHA 2OPRA 5HO4A 2K3IA 1OPZA 1DTQB 2DNOA 3OXLA 1FXLA 1EKSA 2KT3A 4CO3A 2H5JB 5BYRA 3MEGB 2FY1A 1HBOA 3OL8A 2NXCA 3PKMA 4YR2A 2HAIA 4KGVB 1U7LA 1IBCB 5DDPC 3CD5A 2MJUA 1F3VA 4TQSA 2IRYA 1SH2A 2BUNA 3FSIA 3ZZOA 2RQMA 2IFXA 1GMWD 2F65A 2B8PA 4YY3F 3KMQA 2QA2A 5F3TA 1K73T 2OD6A 1X4AA 1YRTA 1MU2B 1F3FA 2GGPA 2W2PP 4AQYJ 3OFEA 1UW4A 1FHTA 1S59A 3C66A 1X4DA 2BEFA 1OMSA 2DY1A 3GR0A 3JSYA 3CO0P 4K2XA 2FVCA 4TN2A 3TZWA 1H3DA 1S0MA 1KLMB 2FVPA 4DFPA 2VFRA 2BM1A 2YX4A 1HQ2A 1HHSA 1IM4A 3QWUA 1JLFA 4OX6A 2VDHA 3TO8A 1U1QA 2WONB 4O4GA 1VQ4S 4USIA 4J9SA 2LU1A 4OX8A 3QSYB 2DR5A 3JYTA 2J7WA 4KT0C 3U1NA 4X4QA 2VODA 1TL3A 2WOMA 4CTAA 2QE5A 2FGCA 2W2MP 1H2VZ 4OHWA 2PEBA 3HULA 4P74A 4WFBQ 3ISZA 4LVOP 4X64F 2HNDB 2JSXA 3JYTB 1FTCA
chains in the Genus database with same CATH topology
5DLFA 2IA6A 4Q8EA 2WB4A 1R8PA 2F4VF 3QJLA 4RUAA 5B0CA 1OQ6A 3CTRA 5D8HB 1VJWA 2M2BA 2M88A 1W25A 2GMJA 2MMYA 7FD1A 2V8HA 5J2QA 2BQ3A 2G4BA 3VAMA 3D54A 2E9TA 5HBMA 4YP3A 3OSNA 1X0FA 1RQ0A 4WFXA 4ZCMA 1S72S 4O4RA 2DB1A 2R7QA 4TU9A 1YITS 2MHEA 4QIGA 3MM8A 2ADCA 1SKWA 3W2WA 3CWJA 3K0JA 2I5JA 2CQ2A 4L72B 3UPFA 2ACYA 1SJ3P 4JI1F 3RBEA 1CC7A 1MU2A 1IKYB 5J1EB 5D4NA 4ED6A 1TK0A 1VK8A 2MZJA 3W2WB 1JK9B 3DOMA 3J80Y 4RW8B 5D4OA 2HHHF 4DR4F 2MZ1A 2QZ8A 4HVZA 4QIVA 5CYMB 1RT2A 3CCWA 1B0TA 1JLGA 2DNZA 5DG7A 2YX7A 3BO2A 3IGNA 1TKDA 1QVGR 5GAGI 3CC7S 3S01A 4J9RA 4MKBA 1NK9A 5GAEU 5HMWA 1OIAA 3M2RA 1N32F 2ZH6A 4KHPF 3FSYA 4EO8A 2IBKA 2B3TB 4FF1A 5EWGA 1WF1A 2GJ2A 2RH3A 3PRBA 4H4MA 2RD5C 4PWDB 2OPSB 4C9DA 4FS1A 4O3RA 3HHLB 2XI3A 3QGPA 4X4RA 2HHSA 1Q79A 4W90B 4YOEA 2CRLA 3F41A 1U1RA 1SJFA 2YNFA 3IRXB 1RP5A 2VD3A 1FKOB 3T1AA 2CKWA 1Q53A 1RA7A 4CT8A 4UQTA 4WFNQ 1T05A 4I2QB 1V6HA 4IFVA 2XS5A 3MAQA 3M2RB 3CUNA 1HNIA 2ROGA 2HLTA 3Q23A 1H2TZ 2J6SA 3QLHA 1SQEA 1W2IA 1FNOA 4IFVB 1YSJA 1YJNS 2IYIA 2LA4A 2P9GA 3A8EA 2DNQA 2N3OA 4QYZJ 4IG3B 2K7JA 4FF3A 4Z2XA 4LF6F 3SDEB 2JWNA 4DQIA 3QGIA 4ZP8A 4ELVA 3I0SB 4BWJA 1WD6A 3SFUA 2B4VA 3LP0A 1FE0A 4XDDA 3FZ2A 3SV3A 4DL0C 5K14A 5DDRC 5KFJA 5DDOC 4G6VB 3Q8PB 3MOZA 1H7WA 3CJ4A 4EO6A 2QA4S 1U1KA 5G4DA 2IVFB 4JI8F 3I56S 1B64A 4QR2A 4URSA 2RRNA 1D9AA 5K5MA 4JV0A 2BW2A 5K8MA 2K8GA 3DOLA 2XHWA 1T05B 1KFSA 2A1BA 1IUJA 3FFIA 3RR8A 4IRCA 2OPPB 4TQRA 3H2VE 4AUKA 3PRDA 2YNGA 1JLBA 4KKOA 4DQSA 2E9ZA 5CD4H 4CT9A 3DXBA 1JXEA 1VRTA 3MURP 1LWEA 2NR0A 4Q2LA 5KG6A 4WZMA 1SB6A 4OHXA 5KOXA 2A18A 2JOQA 1RYRA 2DNMA 3TA1A 2C3UA 3B4MA 5AE1A 1JKHA 2QSFA 1ZETA 3PV8A 1TL3B 4CTAB 2YWHA 2R2TA 4YB7A 4UQGA 3POTA 4MFBB 3H20A 4ZLPA 5JJBA 4IRKA 4H4OA 4PPDA 3HJFA 2NQPA 4GC7A 2DGOA 1BLUA 4C0HA 2FHKA 3GIIA 2P6SA 2MKSA 4DJBA 2B6AB 2DH8A 1V3RA 2C2EA 4ECXA 1Q8LA 1A7GE 1JLQB 4RUCA 2J9EA 3TW0A 1KNZA 1VIXA 2A10A 1RT1A 2B7CB 2ZNZA 3CE8A 3US5A 4M5DB 3NLCA 2FJWA 2AQ4A 3KK3A 2K3KA 1DLOB 1TKXA 1MMLA 2YTCA 3BGUA 3M32A 1P1TA 1JLBB 4KKOB 2W8KA 1Q82T 3CMES 3G6XA 3LANA 3PXGa 2PD1A 3VAKA 1N5QA 3V4IB 2VG5B 4CI0B 2DRBA 1RTDA 4MTPA 1S48A 2Q6CA 4AE5A 2M9KA 1S4FA 2RU9A 4PXEA 2WTFA 1G1XA 2HRYA 3THTA 1XERA 2ATLA 3KOAA 4PRFA 1U24A 3MM9B 4RUHA 3GIMA 1N5YA 4V19J 3CDUA 3JSRA 5JXSA 3SCJE 3R5BA 2CG4A 1S6PB 3LPYA 4YDDB 4URGA 2WRMA 2H9ZA 2DGSA 5KFIA 1HMVA 1UFWA 3GFZA 3LH2S 5BR8F 1YJ9S 5C5JA 4HI1A 1NH7A 4ZP6A 3QWPA 4G1QB 4J5OA 1FEHA 4KBIA 2DGXA 1F60B 3I6PA 4IUFA 2G9OA 3IG1B 3KMSA 1S0OA 2DBBA 5F9LA 5LJ3Y 1FRKA 5FLXY 2ZE2B 2ZJPQ 1GXTA 1S79A 3DMJA 3MECA 4PXCA 2YKAA 1VQMS 2VBYA 3HO1A 1TP7A 2IRXA 1SKRA 2ILZA 3I5AA 3RAMA 4OMFG 4HTIA 2L9WA 3LWLA 3DOKA 2XSJB 2WHOA 4Q44A 1T8EA 4O3OA 4C8OA 3C46A 2J5AA 3GYXB 2XCAA 1MNEA 4RBVA 4YUDA 3DI6B 4P6QA 4I0WA 2AGOA 3K8WA 4TYAA 2MY7A 1T3NA 4DQQA 1TL4A 1UWBA 1QAIA 1S76D 4Y34A 3BM7A 1VQ6S 2DH7A 3HFKA 1QSLA 4ZA1A 4NA3A 5EGYA 4NA1A 4F4KA 2YKQA 2MJNA 6FDRA 4AXIA 5IM0A 5F8NA 4K0KF 1S49A 2EK1A 3DLGB 4WTYA 1RJJA 3IWNC 3K8VA 2RIJA 4Y2KA 3ISND 2VKZG 4C7QA 1UWBB 3OR2A 2UU9F 4P7TA 3VAGA 1Z2ZA 5KT3A 3GG0A 3FDSA 4I1TA 4RBTA 3UCUP 2BYCA 3BQ0A 2DPJA 2YKNB 3JTOA 3P5TL 2X3GA 5B0EA 4UUXA 2RT3A 5DG8A 4HDHA 1EP4B 1IXKA 2FC8A 2BV3A 3GIKA 4OLOA 4Q43A 1X9WA 2N7YA 1H6KX 4ID8A 1RT6B 3H5UA 2PEHA 5FIIA 3OVAA 1ULRA 1CSJA 2LDIA 1F5CA 5D77A 4UOCA 3HI9A 1MMNA 3OV7A 1YBAA 2HYIB 5A2QY 2KKHA 4LVNP 2VFTA 4C0BA 3OHBA 2D1CA 2XMUA 3HVWA 1QUPA 3WX4A 1U2FA 1VHFA 3N6NA 4WE1A 4YQWA 1VQOS 2MKIA 1XC9A 1AW0A 2HIQA 1JLEA 3KNGA 1L3VA 3EX7B 2VQEF 2AW0A 2PI4A 3HPOA 1RI7A 4UY8T 3OFHA 4K4SA 3PFOA 5KFWA 2ZNYA 2FJDB 2B6AA 1KQKA 5KAKA 2FJVA 3EZUA 3TRGA 1R31A 2MGZA 2D9OA 5T41A 1S1XA 1RT4A 3O6QA 4DL7A 4MIWA 2J6UA 2XS7A 1SXLA 1JLFB 1XBWA 2CPJA 3BO3A 3FMWA 3QIPA 2EWHA 2VZ9A 4QOTA 2MDAA 1XR6A 4HT7A 3M32B 1FNXH 3TYTA 1YQHA 1ZBTA 2IRUA 2PDAA 5L1LA 5KFOA 3HM9A 2HG4A 1NRKA 1T03B 1VC6A 1OWXA 4FPRA 3T6JA 2W24A 1UFLA 3BGFA 1S9GA 4DLGA 4QZVB 1U1OA 1EP4A 4OI0A 3LAMA 1F5AA 4MMOA 3LF0A 3OUYB 3JTPA 4NMLA 4WFAQ 1S97A 4JOUA 1F5BA 2MQPA 5CYQA 2ASYA 5KT5A 4DR7F 4MFBA 1PC5A 1R8AA 3MR5A 2UVWA 5HROB 4YHHF 1TK8A 1SIZA 1U2RA 2B0GA 1RT7B 2B51A 1T95A 2KXFA 3DRPB 3GQCA 3TUJC 5F8MA 4O0IA 2G1DA 2LQJA 4DV1F 3F44A 2B43A 3N6LA 3LWMA 4Q45A 3G71S 4TXSA 4OZ0A 3DCAA 2Q43A 2F1FA 2FJEB 1KHWA 4G1QA 3RAQA 1FEEA 4H4KA 4XDCA 1TVRA 1FD8A 2DNGA 4NLUA 2KRRA 5L8RC 1RT5B 1C0TB 2OLWA 4KGKA 1DARA 3JTNA 5E3QA 2XY5A 1S9FA 3CCMS 1AFJA 2MYFA 2V4RA 2B4UA 4X4OA 3DLHA 3M2UA 2I0XA 1Q16B 3S1TA 2HMIA 2DO4A 3DLBA 3MM9A 1TQLA 3S8SA 4A8YA 1KS2A 3M2UB 2ASDA 1FF2A 4BC7A 1IKVB 3VAJA 1ZPVA 4NPOA 2BANB 3I5CA 3HHLA 3IR5B 4RLEA 1R8CA 3DM2A 2Y1RI 4IH7A 4CQ1A 2E1MC 5LSRA 1I1GA 3UCGA 3CF5Q 4LFBF 1IBLF 2E5HA 2A2DA 1TUVA 2MQMA 2VC1A 2M3DA 2KG0A 1X5PA 1Y7PA 3GFYA 3K7RA 3LAKA 2RF2A 3DMJB 2KT2A 3N28A 4DSLA 4X62F 2ZH7A 3MMBB 1JLEB 2EKYA 4DDFA 2OSRA 2VQFF 3C8YA 4HKQA 1L3UA 5F8JA 3MPYA 1GXUA 2PI5A 4ES1A 1FKOA 2QA1A 5DS7A 2DK2A 3H40A 2FJAB 2XY6A 1M5PC 4PXBA 5EX0A 1Q7LB 4ZVFA 2BOPA 4U9RA 4J9OA 1Y5IB 1S1TB 3VR1A 5IFMA 3HT3A 2ZKUA 6FD1A 1LWFB 2JX2A 1CLFA 4KC5A 2UZAA 2EFQA 4C8LA 3UI3A 3IG1A 4ZDNA 4R0JA 3FRZA 3OPKA 1DLOA 4IG0B 2F8MA 4IH5A 3T9ZA 4C0OC 2XGPA 3RTVA 4ED7A 4G3IA 2ASJA 1UVMA 3GSDA 1BY9A 2E44A 1RWUA 1NK5A 2FLLA 3G8TA 1JXLA 3O3LA 4AL5A 4A8FA 2VOPA 1U1PA 4E8UA 1MWYA 2GQ2A 4I69A 3HKZD 3K5NA 2IJFA 2GC8A 1FKPA 5AE3A 1E6VA 2RS2A 4ETZA 2DNYA 4I7FB 2HNZA 3TAPA 2XI2A 1ZH5A 3BJYA 4ILRA 3NG8A 3P96A 4DL2A 2E9RX 3MHYA 2K2PA 2L9DA 1RT5A 5GMKa 2AJ1A 5E33A 4PG6A 1M5OC 3R5AA 2YX1A 2WONA 4XAKA 3E51A 3KK3B 2IAJA 1XTZA 4K50A 3B82A 2LXUA 2EW9A 4UW2A 1Y4ZB 3V2UC 3BS9A 4B3TF 1CQNA 5FDLB 1REVA 5A8WA 3BN4A 2HW3A 2H5EA 3MMCA 4U7UK 4NLOA 4H4OB 5LJ5Y 4Y28C 3TI0A 5B0GA 1NJZA 2IJNA 1FRJA 2JL9A 1RTIA 2W4CA 2HWIA 2AU0A 3PO5A 1GAOA 4FF4A 2B5JB 3AA9A 3FQKA 2HQ3A 1HR0F 3TNVA 3E01A 1TVRB 5MAOA 3KHLA 1VQLS 4E0DA 3NAHA 2J0QD 4I67A 2ZH5A 5A6WA 2YNHB 5T7LB 4IYQA 1C1BA 4F3QA 3DYAA 3ZZZA 1VRUB 2J9DA 1X4CA 1NJWA 4M94A 4V19X 3H59A 4OHYA 2KVIA 1XK8A 2IMOA 3TA0A 2ZM6F 4X4UA 1WTFA 3AY0A 3NGKA 3PW7A 2R7WA 2PFFB 4TY9A 2RE1A 2AYMA 2UUCF 4N8OA 1LXJA 1HD0A 4TU7A 4EZ6A 3NWGA 1TFWA 2W25A 4I2QA 2AGQA 1FDAA 3OVBA 1HL6A 3VAIA 2BA9A 3EXYA 1U6BA 4JI0F 4KO0A 4UUWA 4LF5F 4ZKAA 2GNKA 3QAUA 4TLRA 5IQQA 4DSFA 2JH3A 1N6QA 2JEIA 3DLEA 2W7PA 2R9LA 2MPUA 1X7VA 2BQUA 3MR3A 1NK4A 3CCUS 5CQGA 3ZZUA 4DF8A 3ULHA 2M7SA 2OPSA 4HT5A 3J7YI 2BE2A 2ILYA 4H4MB 5HL7Q 2QLWA 5DRKA 4ZPDA 3H25A 4FN5A 4M5DA 1X5TA 1VGYA 1JNRB 3RU0A 3MTKA 4EU0A 1L5UA 3GG1A 1Y3KA 2QMXA 4ZPWR 5I3UA 3CJ2A 3QIPB 5AXNA 2ZUGA 1VQ8S 5CHCB 4KO0B 1M0SA 3EGNA 2ZBIA 4F02A 3M05A 2ZH8A 3J7A1 3KHHA 5CYMA 3OR1A 4J9MA 1K0TA 4J37A 4RW8A 3BEGB 4QCLA 4ED2A 4M8LA 4R5PA 4KE5A 1BQNA 3Q2TC 4Y6IA 1WHXA 4A8XA 2R7SA 1G2EA 1XMBA 3J7YU 2DT9A 4QJVA 2DHAA 3DRRB 5L39A 1YVFA 3EGWB 2V8GA 3DDNA 2E1AA 4ID5B 2IC3A 3KHGA 1CG2A 3PW2A 4PG5A 1HFEL 1T3OA 3NCPA 3SQGB 3H5SA 3KLEB 2XO7A 3MEKA 4RKUC 3MMAB 5J1EA 4J9LA 4ECZA 1P8GA 4WFYA 1YHQS 2XS2A 5C25A 3UCZP 3NRBA 4YB6A 2R8HA 2DISA 2JLEA 3SQGA 4ECTA 4MKYA 3VAFA 2XBPA 5KT4A 4A8KA 1LKZA 5EDWA 1OQ3A 3GV8B 5KFNA 3PJWA 3DRRA 3B78A 5B0BA 4D3HA 4KJIA 4CNYA 1KONA 1UKUA 4QPTA 2VG6B 5H9EJ 2HNDA 5E7OB 4QPXA 2PO4A 2HHTA 2HGMA 3E8OA 1HWLA 2IA0A 3DGPA 4RNFA 2DNKA 2BACA 3RB3A 1JJHA 2YH0A 1XN9A 4NL5A 3H8YA 2B9YA 2V9WA 2A3JA 4FVCA 4U6PA 3MXHP 1P6TA 1TR0A 4ZHRA 5HLFA 4DV4F 2KM8B 4EUVA 2KYXA 1MMDA 1ZZFA 1APSA 4UY85 1N88A 4DL5A 3AB2B 1XNQF 4ED1A 1AROP 4Y3CA 3OLAA 5L1JA 2XLKA 1UA1A 1Y5NB 4TNOA 4A8WA 5B7WA 2W9CA 4W92B 1RT3B 2XC9A 2GIQA 4WF9Q 4PR6A 3OL7A 5CCMA 4C97A 1QTMA 4RW7B 4C3MA 4CO2A 3N0VA 2DTJA 3MCSA 3RZAA 3LW5C 2MXYA 3PKYA 1YJVA 2RQCA 2N4CA 1S1UA 3O2IA 5EN1A 5A6PA 2CDQA 2CQPA 4DS5A 1L3KA 5L1IA 2FUG9 5L9NA 3K5OA 3D1OA 4O4GB 2GX8A 2CPFA 4X84A 3M2VA 1JMTA 3WDOA 2CPZA 1T94A 4LQ3A 5F8IA 3KKFA 4Y2CA 2KJWA 3PX0A 2F9JA 4WZQA 1IJEB 3I0RA 2C3PA 4K4TA 1SKSA 3R1HA 1ZOTA 5F9NA 4IH6A 3C6UA 5E3AA 4A4JA 1RT2B 2MZQA 4NX9A 2VBWA 2R7UA 3TAMA 5M2PA 3BGLA 3CULA 5KFMA 5KFQA 4R8UA 4JV2A 4N41A 1ZM4A 3CDBA 2CJBA 1YJRA 2D9PA 5JUMA 1HMVB 2D74B 2XEXA 4QIFA 2RF2B 5LSLA 4LMZA 1UMJA 1NEEA 2QYCA 3AB4B 3OJUA 4ECRA 3RBDA 4ZS6A 3U02A 4B9VA 1DAXA 3GILA 4CH0S 1CEZA 2W7AA 2D3OR 4IDKB 3OTEA 4ZCLA 4DN0A 3JB9k 4TLQA 2HPUA 2EG2A 4FXVA 1Q7YT 1LW0B 1NU4A 1WWHA 3T6BA 2OIHA 4KIAA 2V2KA 4NYOA 4NZ7A 3MM5B 1AFIA 2B4OA 1ZTTA 3OQ2A 2FJXA 2PMHA 4F3MA 3GFHA 2D41A 1U47A 5FJ4A 5F0UA 1ZPWX 4OLPA 1C4CA 3Q8QB 4P2SA 4WK3A 4QWDA 3OFGA 3SYZA 2E5LF 1JIHA 5B09A 1J2VA 1RTJA 5C24B 2RDJA 2HMIB 2ZD1A 4OJ1A 5CCLA 2OFGX 5T14A 3PHEA 2IYGA 3BQ2A 4EZ9A 4XO0A 5K8NA 1T7PA 5K9FA 4RNMA 1FJ7A 3VCDA 1HQEB 3MDFA 2MGZB 2PT0A 2CIMA 3U1LA 4N5SA 1UVNA 2FB0A 4NLSA 2HNYA 3DDKA 2ZBCA 2ABYA 2RJZA 2UUWA 4IOAQ 4PKDB 3BGRA 1EETB 1PILA <