4N8NA

Crystal structure of mycobacterial ftsx extracellular domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
102
structure length
102
Chain Sequence
LDRVESQVFLTEDVSANDSSCDTTACKALREKIETRSDVKAVRFLNRQQAYDDAIRKFPQFKDVAGKDSFPASFIVKLENPEQHKDFDTAMKGQPGVLDVLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mycobacterium tuberculosis FtsX extracellular domain activates the peptidoglycan hydrolase, RipC.
pubmed doi rcsb
molecule keywords Cell division protein FtsX
molecule tags Membrane protein
source organism Mycobacterium tuberculosis
total genus 25
structure length 102
sequence length 102
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18075 FtsX_ECD FtsX extracellular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3040 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4n8nA00
4N8NA 4N8OA
chains in the Genus database with same CATH superfamily
2MEWA 3CULA 1IBKF 1VQ5S 4Q0BB 2B4UA 1GXUA 4B02A 4LBIA 1BD6A 4LUBA 5J2QA 2A18A 4OHXA 2KZZA 3HJVA 5E3PA 3WZ0A 1VK3A 3OVBA 3VAIA 3BKFA 1P27B 5KFMA 1P9QC 3EZOA 4KH1B 5GADI 2ZBIA 3MURP 1VDHA 2AMCB 4RUHA 3FNNA 1DARA 2Y0BB 1IQTA 4K0KF 2ZH9A 2IA6A 3VTIA 3PIPQ 4YFUA 3C15A 4C2MA 3W65A 3GIKA 3TJAA 3PW0A 5BXIA 3THVA 2E5IA 5KT5A 1R8AA 1VR6A 4XAKA 2AX0A 2E7XA 3HX9A 1YWXA 2OD6A 1TTHB 2VQEJ 1MROB 4NLRA 4FBUA 1NLKL 4ED2A 2A6MA 1YKWA 2BOAA 4I2PB 4CM2A 2JX2A 1BMQB 1EJ7L 1N36J 4WYLA 4V19X 3JSMB 3GYXB 1N6QA 3KK2A 1FKPB 4DFMA 3BBFA 4YDDB 3SIPB 3K8VA 4H4KA 3J80Y 1XK8A 3HULA 3KKFA 3GFZA 4ZPWR 2IDLA 3LUYA 2ZKTA 4J9MA 1HMVA 2C2KB 4URSA 1M5KC 1MMDA 4J9OA 1KBRA 1Q86T 1TAUA 4OJ3A 2QX0A 2JSXA 4NI2B 3OUYA 3HHLA 3BKUA 2F9JA 2VICA 3IM8A 2GNKA 5CYQB 5KG3A 3CIZA 2G4BA 4O4GB 1FRHA 3G8SA 4IDKB 1YG0A 1QJHA 2OEMA 4KRWA 2ACYA 1R27B 1ELOA 5F41A 4X4UA 3QJPA 2D3O1 4MH8A 1VQYA 4DX5A 4OYPA 3MTKA 5F8GA 5J2MB 1N56A 3H5YA 1Q0NA 3O5TB 5CH7B 1PBUA 3SXLA 2R8IA 5L1KA 3RYLA 4DV0F 4M5GA 4CO0A 1C1CA 3FUYA 2ZJPQ 1F60B 4ALZA 1S1UA 2D3OR 5KT2A 1LXJA 2KFZA 7AT1B 4C0BA 5HMZA 1PJ7A 2UUBF 2J8SA 4C9DA 5JVGQ 1RT4B 3IR7B 5HI7A 1VQ4S 2M8DB 3T6BA 3IBCB 4CM0A 1YIJS 4WF9Q 2HK2A 4YY3J 4JI4F 4ZVGA 3PW7A 4Z7CA 2R7RA 1RTZA 3SCIE 3VAGA 3MAAA 4RUCA 1B7FA 4LBHA 2RB7A 3M2UA 3J81U 3CDWA 4Z7YA 3DHXA 4IO9Q 3S6EA 4DR6F 4WZQA 3MEGB 3NS5A 4RNMA 4CRJA 4U8VA 1YBAA 3CJKA 3DHWC 1TVRB 1S59A 2L9DA 3ZTPA 2Q66A 3DCAA 1KR4A 4X4NA 3QWUA 1TZ0A 2FUG9 2QIFA 1JIHA 2J0QD 5F0UA 5IV4A 2M88A 2HHXA 1WWHA 2BQUA 2PC6A 1PCAA 2E66A 2MZRA 1Q8BA 2RRAA 2CQIA 3J81j 3G71S 3AJDA 4QYZK 5D0EA 4BC9A 4LF5J 9ATCB 3A4TA 4PXBA 2HHPA 3EJMA 4YMEA 2DR6A 4X64F 2HHHJ 4CYUB 4YDXA 3CJ4A 2H54B 3AQPA 3DMJA 3RTVA 1DTQA 4H4MB 1WJ9A 3T1HJ 1TV6A 4P73A 5CXTA 5KFUA 1GMWA 4ES2A 1MLAA 5GMDA 6FDRA 3OD2A 3BEGB 3HT0A 4PWUA 4IG3A 3MEEA 1HBUB 4RW9B 1REGX 3QFWA 3HKZD 6AT1B 1SC1B 2NQPA 2AZ1A 1Q95G 2XBPA 4ANEA 1T02A 2QYGA 2NUHA 4TYBA 3QPIA 2E9RX 1K44A 2CWXA 3K17A 1N5YB 1FEHA 4USWA 5K20B 1SIZA 3A1YG 2ZJQQ 2C3YA 2XLIA 1WHWA 2FJWA 4OI1A 1PKUA 3KFWX 4MTPA 3LP2B 3FC9A 1A6LA 2BKPA 4N56A 2VG6B 3DYAA 3TAMA 1U26A 1UWBB 4P6QA 5FD1A 3ZZUA 4RUBA 3O3LA 4N76A 2B5JA 2MKCA 4NA3A 3AQOA 1S57A 2XNQA 1U1OA 4CH1A 4XDDA 4FBTA 3THPA 4G1QA 2G0JA 1Q8IA 2OTLS 2YPZA 3I0SB 3KUGA 4JI6F 5I42A 3VGSA 2VJUA 2HS0A 3JSRA 4JI2J 2E7VA 3NOGA 2XS2A 1XTZA 2OI2A 4LF1A 1TU0B 1VS3A 3HT3A 4ELUA 2QLWA 1WDDA 1GT8A 2DHXA 2RS2A 2IRUA 3H20A 3DOKB 3MZIA 3EGNA 3G87A 2CPFA 3VHQA 3QT5A 2BDPA 1NB7A 5IT9Y 4A8QA 4LMZA 1NHVA 3TEHB 3ZZPA 4IUFA 4O3PA 3W2WA 2Y8YA 3VAJA 5D8HB 1ZZNA 2HNYB 4Q8FA 4IFYA 3R7SB 2KO1A 3RAQA 4DR3J 3M8ZA 1J5OB 5I3PA 3ZXWA 4LR8A 4ED8A 4U7CA 4DV7F 2VPXB 1S72S 1MU2B 2KM8B 3TZYA 4RBVA 1JXLA 1QE1A 1YJNS 1DJ0A 3BM7A 3CWJA 2W4DA 1UA0A 1X0PA 2XWYA 2M8HA 1J5EJ 1OMSA 2BJ1A 2HQDA 2WVBA 3ZNUA 1FDDA 1X4AA 3D28A 1U7LA 4B08A 2ZFHA 1WTFA 2DXEA 4NLYA 2BUNA 1VJQA 1HI1A 4UOGA 3O2IA 2L48A 4DJBA 2QYCA 3Q8YA 1KC8T 3BGOP 3HSDA 1WKLA 4DR7J 4DV6J 5LMNJ 2HS4A 4M95A 3TEGA 2R7TA 2CUYA 1UW9A 1V6HA 2R8GA 4NLGA 2ZEJA 3P45B 3EDRB 4ANDA 3PACA 2QLFB 4MK8A 2UV8A 4J5OA 1HNVA 5HMXA 3BS9A 1S77D 2KVQE 1MMLA 3O8WA 1BQNA 2OFGX 2ATLA 1R6VA 2FVQA 1OPIA 2HQ3A 3BGRA 1V5IB 2ZWOA 1H73A 4F04B 4B9UA 2YNFB 2GHWA 2F7VA 2RDJA 2VDHA 4RL1A 3GWCA 1NJWA 2B8PA 3IWNC 2WVDA 2ZOGA 3NGDA 5E5NA 4KFBB 5C7PA 4RW8B 2X1FA 2R7VA 2XMVA 3N5BA 3LWLA 1NDPA 4B3SJ 2AJ1A 4ANCA 1SPBP 3HHKA 2A1BA 4WKYA 5FLXY 3DOMA 5HAOA 1SKWA 1P9YA 3X3UA 4URGA 4QQBA 4PWDB 1YJTA 2B43A 5ETSA 3TUIC 1XR6A 1JX4A 1FK9B 3GLJA 4P7VA 4B9SA 2IDEA 1L3UA 3TYTA 3HFKA 1WUUA 3ENAA 2RQ4A 1G6BA 1VQ8S 1SQEA 4DR5F 2CZVC 2DO0A 3T5JA 1HLWA 2DR8A 4R5PB 2JEGA 1S9GA 4GKKJ 5IT0A 1T0TV 2RT3A 4TLRA 5HP1B 3CJ5A 3QRQA 4B9TA 3DRXA 2W9BA 2JOQA 4OX7A 3BZQA 5T7LA 4ED3A 3M6WA 2AYBA 4CP5A 1BLUA 5FJ4A 3PNIA 3MUTP 1T05A 3MHYA 2UVRA 1HNXJ 1U09A 2VFUA 2C1EB 3HD1A 3I5AA 1VC6A 2DR7A 3UN3A 4AQYJ 4C8LA 2V2QA 1FRIA 1H3DA 4IH7A 5H9EK 3OTOJ 1H38A 1SC3B 3ZZRA 3NGRA 5A8WA 1QAYA 1EP4A 3RB3A 1OWXA 2DGWA 1FWKA 1K8AT 4C8OA 4EMDA 3T5HA 2OPRB 2BM1A 2OPSB 2F9DA 1AT1B 2GHVC 2IHR1 2LEBA 2AQ4A 2DJWA 1WOOA 3FFIB 4DDFA 1JKHB 5E2QA 2OH2A 2W24A 1YITS 3H0PA 3OFEA 1S6OA 3JTNA 2QSWA 1H7XA 1D8ZA 1W26A 2B4VA 3ADAC 1XJWB 5L46A 1LXNA 3NAHA 3NEKA 3H2LA 1IKXA 3R9LA 2DPIA 4PPZA 3I5CA 2OLWA 1S76D 1X9WA 2HG4A 1RJJA 3HVTA 4K4YA 4G65A 4LFBJ 3VWSA 1RXOB 2MQQA 2EG1A 1CS4B 3C16B 3P8BB 2HGNA 4QOTA 2V8HA 4O0NA 3W61A 5C2GA 3GSDA 2BA9A 4ZCKA 4P71A 2DO4A 4JBCA 5D0HA 3AY0A 2HQCA 1NJYA 5LMUF 2LMIA 4CO3A 5IM0A 1RT2A 2VG5A 3F73A 4JV5F 3W66A 1UEUA 3HVAA 2YVSA 2CPEA 2HURA 3UD4P 2FPHX 3QSIA 3EMTA 2ZBCA 4FP9A 1WKJA 3JAMU 3VAFA 5D15A 2HMIB 2ASLA 4YB6A 4DPTA 3MUMP 1OJ4A 4U7UK 1EETB 2P9CA 3BR9A 3EVWA 5AXNA 4JV0A 3MEDA 4DQPA 4B3TF 4USHA 3NGKA 2MQOA 2EVZA 2NSBA 1IBKJ 3CJRA 3A3NB 4FXWA 4NYOA 3L9ZA 3T5LA 2KL8A 2J0XA 2LVWA 1NK9A 1S12A 2JEFA 3TI0A 1GX6A 3DOLB 1Y0HA 2VH7A 1NSKL 3RGIA 3LP0A 2Y1RI 1YRXA 5ETTA 4ZN3A 4K0KJ 4M5KA 1CJVA 2WONA 1WTBA 5HO4A 2H4YB 4ZLNA 2GVZB 3B78A 2OEKA 3M8PA 4BWMA 2YKMB 4TLQA 4C11A 2HAFA 3U02A 3IA0A 3CO9A 1O8BA 3RU0A 5B0DA 1O0PA 2RF2B 4FS2A 2WRMA 5C25B 5ETLA 3BQ0A 3ELHA 4HACB 4LIWA 4DZDA 1V5VA 4F02A 2MDAA 4LIRA 3LF0A 1HWJA 5B0EA 1XMBA 3HCXA 2FVSA 1T7PA 2DGUA 3KLFB 2ZHBA 2M4MA 4QIWD 2FJXA 1LKZA 2CVEA 4JI0F 4PG6A 3KJVA 3Q8PB 4RLEA 2HBRB 4C4WA 2V4RA 4C8NA 2YNHB 2J76E 3CC7S 4DSEA 2MTLA 2KKHA 2MY7A 4NZ7A 1M5PC 1OS5A 3BQ1A 2VFRA 3OXLA 4HHJA 2VL1A 1N5SA 2VG7B 4EYHB 2Y3YA 2ZZNA 2B3TB 4QIFA 5KFOA 1FDBA 5E3QA 5MLCV 3FBCA 5EWEA 1HI0P 1QDUB 2ADBA 4NLXA 4MMOA 1YRTA 2QA4G 1HQUB 4ZVTB 2XSFA 2XO6A 4QCLA 2V2KA 3QYYA 4EGLA 1LOUA 3MOZA 4TU9A 2ZE2A 2BM0A 4YR3A 3C15B 3KUHA 2HQIA 1JLGB 2ZBRA 3SEOA 3DI6B 3V4IA 2WZ1A 3GB0A 2X51A 3D2WA 5EUHA 3G82B 1NDCA 4M63A 3TJ9A 1SL0A 3LGHA 1KONA 4ZPCA 1X60A 4ZJOA 2CYYA 2YNGA 1ZM9A 4JI3F 4J9KA 3T9ZA 2CJAA 3FBFA 4RW7A 1KRPA 2IYIA 2BJEA 1CPZA 2RAQA 1NB2A 4ENOA 1QSLA 2JFDA 2EFPA 3SFUA 1S9EB 5GAGU 5L1JA 3CCTA 1N6QB 3TVKA 1UEKA 1PAEX 3DLJA 3RRGA 5B08A 4Y34A 1B99A 4O3SA 2GV1A 4ZLPA 1RT6B 4DLGA 2V9KA 4JI4J 4DLEA 4ILRA 2FZGB 4P2MA 3GONA 3HHDA 2HVDA 1FNOA 3H4BA 1S6PA 3KLHA 2IVMA 3OV7A 1GK8A 1RTHB 3OR1A 4LF6F 1T3NA 4DR6J 4KHMA 1RZMA 4DSFA 3GPAA 1NRKA 1S1WA 1VFJA 1VQOS 2FTRA 2MLZA 1Q5VA 5IOLA 2XMAA 1SH3A 1B3TA 4EBDA 2M5YA 2E5GA 3MR6A 3OFGA 3WX4A 4C8MA 4USKA 2R7XA 4WP9A 2A6OA 1HBMA 3HFZB 3CJ2A 2R7SA 2X3GA 3V6DB 3W8GA 2F63A 2GVDA 2BANB 4OYIA 1HNZJ 2XCAA 3VAMA 2BJ7A 1C0UA 2HK3A 5A6WA 3C6TA 3OL6A 2LQ9A 4X64J 3Q23A 1J27A 2WTFA 4C48A 3ZNJ1 4X4RA 4PKDB 2YWGA 4NZ0A 4ZVFA 1NSPA 2AHOB 1FF2A 3G6VA 2BOPA 2PT0A 3IWXA 4NLDA 2IPOB 4FF3A 4CZCA 2CIMA 1PGZA 2MSTA 1UKUA 3D6MB 4H4KC 1RTIA 2YX1A 1Q4RA 5BYSA 1YVFA 3JTOA 3V6KA 1O5JA 2RHSB 4RWXA 5DDOC 4YHHF 4HYKA 4OZ5A 1E6VA 4U95A 3LP1B 1YQHA 4YN3B 3ILJA 4UOHA 1IR1A 4KE5A 4A47A 5L1LA 1X4HA 4KR0B 1CQMA 5KFNA 1QD1A 1HW8A 1MWQA 5DQHA 3HHLC 1SH2A 4ZOSA 2JLGA 3G6ES 1U47A 1NH7A 2BBEA 3M1VB 5LJ3Y 4N77A 3KK3B 3WIUA 4LFCF 4LF2A 3TQEA 3RR8A 3DLLQ 2VFSA 4DX6A 2CNNB 3AJ1A 3Q8SB 1UA1A 4IKAA 4ZCIA 2QC3A 4Y28C 3MMAA 1VC5A 1YZ7A 1S1XA 4YR2A 3KHRA 4BLGA 3N5FA 3NXZA 2QTWA 4ZHRA 4JI6J 2MJUA 4KQZA 3W9JA 3HK2A 2JC0A 1U1KA 1BXNA 2DNKA 4FXDA 4USJC 1WSRA 3IRWP 3Q0AA 2NR0A 4OJ1A 4CTAB 1VI7A 3THTA 4E2FB 1MWYA 4DSKA 2DD8S 1TV6B 4MIWA 1F6TA 2EC0A 1PG5B 3O6QA 5HVGA 4ZPAA 1IM6A 4ECSA 1UVLA 1Y9OA 2M52A 2C2DA 2DH9A 3OSNA 4H4OA 2E7WA 3V5RA 5KG2A 4IFVB 1HQ2A 4I6AA 3VVUA 4ED7A 4Q0BA 4DV7J 1G1XA 3I9ZA 2J9CA 2OPQB 1U8WA 3ZFVA 2OFHX 3DC2A 2OSQA 1M1HA 3TAMB 1QUVA 2K8GA 2HNZB 2GHPA 2BKNA 3T1YF 1JQGA 4YEAA 4Q44A 1UVMA 2HRTA 4QWCA 3F0NA 4K4VA 2B5JB 1SJ3P 3EGZA 1FESA 1W2IA 1ZA2B 2XSJA 4X4TA 2FLLA 2PEBA 1WF0A 1TUGB 4QYRA 2NCKL 3A12A 2FY8A 3W8PA 3IBFB 4FF1A 1QAXA 1A9NB 3JQMA 1PYOB 1KQGB 2MB0B 1Q53A 1RBOB 2ZC3A 5KT4A 5LM7E 2AU0A 2E1PA 4NXMF 1HW9A 2H5EA 4OYAA 2UVVA 4CLKA 4YOEA 1KSPA 4M94A 4B9VA 1S10A 3CMAS 4KHPF 1BWEA 3ZZ0A 4AE5A 3CD5A 3EVMA 2BABA 3IBWA 2AF6A 4TY9A 1EZZB 1JJCB 1HI8A 1MROA 5A2QY 1XEZA 2MZQA 2I2YA 1VRUB 2IM2A 1KD1T 1AA1B 4J7CA 2DNPA 2H1YA 2WHOA 2KTQA 3W2WB 1Y5LB 4DN0A 5ETRA 2EWHA 1PAUB 1DQAA 4DQRA 1JLBA 4I2PA 2V8GA 4J37A 3OW2R 3JSMA 2B9EA 2DXDA 1FKPA 2B6AB 2OGUA 1YGYA 3QNWB 5EWFA 3JXOA 3F41A 3AH6A 2IIHA 4RNNA 1R0AB 2DEIA 2L08A 5H9FJ 5E3CA 1CLFA 1ZA1B 2IRYA 3OFHA 1RU2A 1NHKL 3CMES 2HVIA 3OTCA 2VB6A 2VHGA 4F36A 5ETKA 2YWEA 4RO0A 4NI2A 2AEJA 7FD1A 2UVWA 1IKVA 3TQ1A 1XR5A 2CPIA 4C3KA 2VA3A 1HPZB 2F4FA 1RCOB 2LQJA 3KJFB 4OZJA 4ZVPB 3CCMS 3IM9A 3DLEA 4Z37A 4IDKA 2YQ1A 3GYNA 5DG8A 2QG9B 5F8NA 2DIVA 2QO3A 1XWLA 3DDNA 8RUCA 4Q45A 1R6YA 3L95X 4DR5J 2UUAF 5B0BA 1S7IA 5J2MA 1YJWS 4KHRA 1X5TA 2CZ4A 2GMJA 2L9WA 3K58A 5THWA 4RU2A 1B0TA 5B7WA 3OL7A 3RBXA 2BYCA 3IGVA 3HLUA 3GTYX 4L72B 2HHQA 3GP9A 2BE7D 1IJFB 3TUPA 4CLLA 2KN4A 4LFAF 1Y3KA 2HVHA 2DIUA 1AUSL 3N01A 1W7WA 2MLYA 1IWAA 3RG6A 4B3RF 3G6XA 1HNVB 3RRKA 3G86A 5ETQA 3OTEA 1RT4A 3QGHA 1BQNB 4Y6IA 1ZPWX 1KQKA 2I5JB 3FDSA 2ZZMA 2AV5A 1WF2A 1Y10A 1KVJA 4I1TA 2HBQB 1TK5A 2RD5C 3MEGA 1HHSA 1BQMB 3O1LA 3UNYA 2E5HA 1TVRA 5J2NA 4D3HA 1RWWB 1KP6A 1VRQC 5CQGA 5E7OB 3M6VA 4PYDA 2L41A 3CCQS 1LQ9A 5L39A 4ZA1A 3R5GA 3MMCA 1K1SA 2WCXA 1RI7A 4IOAQ 2VQFJ 1WC1A 2POKA 4DQQA 3FZ2A 3N28A 4AL5A 3FMWA 3VF0B 3GZ7A 4OX9F 4DS5A 1CSJA 2ZITA 3AA9A 2ASDA 1RBLA 2QJ3A 1S1VB 5HVHA 5HN0A 4RW4A 1F3FA 3CNQP 3CTRA 2HWTA 1VBKA 4CYUA 3TZZA 3JQJA 5JMNA 5LMUJ 2YPYA 4JV5J 3P49B 5DQIA 1T05B 3RB6A 4RBUA 2C2EA 3BBBA 5A6PA 1UMJA 3BN4A 3NG8A 4DUZJ 4NLVA 5GMKa 2D69A 1RWKB 1HBUA 2MKHA 4RW9A 2EW9A 1GX5A 3B54A 2WBRA 2KI2A 4B3TJ 4NMXA 4NOHA 2BQ3A 2G2ZA 5MAOA 1M5OC 2BRKA 4ZITA 2VU5A 2HGMA 4OHYA 1SXLA 2ZDPA 3MFHA 2MKIA 5KTQA 2B56A 3KHHA 1NO8A 2PEHA 1RACB 3LP2A 4I2QB 3SFGA 3FEZA 1SKSA 1Z2LA 4P7TA 2G1HA 2VG6A 5EX0A 1NCLA 3DGPA 3TP2A 2HRYA 1JJ4A 4ZLLA 1FXRA 3W2VA 5LXRA 2QLJB 4A8XA 4IRDA 3OT9A 2D41A 5GMEA 1UVJA 5AJ3F 3PEHA 3HJFA 4NLOA 3I0SA 5A0YB 5CAAA 2NYHA 4FYXB 2D7SA 3DRYA 3ITHB 3HHEA 5KFEA 4A4JA 3OQ2A 3Q86A 1IR2A 2YWKA 2BX6A 4ZLJA 5EN1A 3TNVA 3LPEA 4IOCQ 5F3TA 4TY8B 2V8DA 8AT1B 1REVB 1IN0A 3NS7B 3DOKA 4BS2A 2NSCA 4U9RA 2GIQA 1NZ8A 4DEZA 1WC3A 4JI0J 1RHQB 4A8KA 5A8KB 2LP4A 4EUVA 2B4PA 4PR6A 4USIA 3WC2A 3BH7B 2ERRA 3ISND 3MOJB 4K4UA 2HNDB 4WU2A 4CT8A 3C46A 1SV5B 4DFKA 1LFWA 2X1BA 3PY8A 4ILMA 2BJ3A 2FJDB 1ZYQA 4DN9A 1R0BG 4TVAB 1SBRA 1MU2A 4WFAQ 3GR0A 5IC6B 1M90T 1RYRA 2JFKA 3H42A 3SV3A 3J7YU 3IRXB 3NCQA 1WORA 3BSCA 1GXTA 3AB2B 1FFSB 1TL1B 2KYXA 2WONB 4KGXB 1VK8A 4CIOA 3DRSA 2C3PA 2RNEA 4NCGA 4ZJQA 1S6QA 1PYTA 2V9WA 3EGWB 1CJUA 2W1BA 1NSQA 4A8MP 4MFBB 4NYPA 1FNXH 3W5ZA 4ZP6A 4GO5X 4RPFA 1N4LA 2HYIB 5BR8F 2MQNA 1Q7LB 4JI3J 3ZTOA 2ZZTA 4OZNA 4WPAA 3V81B 3CCZA 1RA6A 3AT1B 3J81Y 2O01C 3GFXA 2DBBA 1C4AA 1SJFA 5IT4A 1CJKB 2GQ2A 4P52A 3NMAA 3NLCA 3DFEA 2PO4A 1HQEB 2AJ4A 4OJHA 1FRXA 1YJ7A 1RHKB 5IXUA 2MZSA 1DRZA 2CPHA 4TU8A 1LNQA 5KT6A 3DRRA 4O3NA 4OJGA 5ITHA 2NYIA 4FKYA 4HH1A 1KHWA 3I0RA 1N48A 1B4SA 9RUBA 2X7IA 2GMLA 3IGNA 2YNFA 2FY1A 2I6WA 4PABA 1UVNA 5DJBA 1FE4A 4Y0FA 2EKYA 3M2RB 2VF3A 4KFBA 3EICA 3HD2A 4RW8A 4YQWA 3K0JA 5HROB 2I1RA 3PFEA 2QFIA 1H2VZ 4K7QA 4NLUA 4DPYA 1KQFB 3QLHA 2UP1A 1R3NA 2HPUA 1M0SA 3BDEA 1X4FA 3MTJA 5KFJA 2JL9A 1Z4UA 2BR0A 2Y1JA 4PWDA 3FSYA 1FK9A 2L3MA 5KFGA 2OEJA 5AT1B 4R5PA 4DMZA 1NK0A 2XCPA 2VBZA 4OZ3A 3UE2A 4NCBA 1RA7A 1C0TB 1LFPA 2J9DE 4ED5A 1WHVA 1FE0A 3EYZA 4LSLA 5D78A 4OYXA 4C0OC 2EBGA 4F4KA 2E1AA 1QUPA 5IT9U 3TAPA 4N7TA 1HNIB 5DDPC 1G4CA 4L73A 2QE5A 4NX9A 4F25A 1Q79A 3GJTB 3M6XA 4A48A 1KVKA 3HXMA 5I3UA 2RU3A 5J1EB 1Q78A 4NXNJ 1YJUA 2QRRA 3CC2S 4I4BA 1I3OB 4CO4A 2UU9F 1IKYB 5DETA 4YHHJ 1N54B 4K4WA 1G7CB 4K5RA 2WB1D 1HWLA 4IR1A 4KPYA 2UUTA 1NK5A 4ZMMA 2N3LA 2CADA 2YTCA 2ASYA 4FVMA 2VOPA 3NCRA 4F4YA 2OPRA 3H40A 1RTDA 1N33F 4EK2A 2OPSA 4JI8F 1PJ5A 1M5HA 2MPUA 3R7NB 2U2FA 2BVZA 1UPMB 2HSEB 2FJEB 3FFIA 3FJ2A 1HBMB 2IMWP 3U27A 4U96A 1KKHA 5F8HA 3KK1B 2KT2A 3K7RA 4ZIWA 3ILOA 2YKPA 1GFWB 2WSCC 2JWNA 4OI2A 2CNOB 4DU8A 1C0UB 3W60A 4F4AA 3OJUA 5L9XA 4PG4A 4P72A 4DR1F 1CS4A 3C16A 4DFJA 2R2UA 5AXKA 3R3TA 4GC6A 1NPPA 5DM7Q 2CQPA 2W7OA 2R8KA 3PCOB 1SI9A 4F2RA 1S4EA 2F5GA 3A8JA 4IH6A 1RCXB 4UQGA 1I6JA 5K9FA 3MM9A 1K0TA 4YS2A 4W98A 4U6PA 2FLPA 1EETA 1YX2A 4MK7A 2C2NA 1TUVA 1E6VB 3DLHA 4QR2A 3CJQA 1VIXA 5EDWA 4DI6A 1T11A 4KO0B 1LWXA 1IQZA 2SXLA 4Q2MA 1SUQA 2V4JA 4LF4F 1DZ5A 4M8LA 3GIMA 1GEHA 1RAFB 5FLXU 4RJVA 3CF5Q 3D6TB 3DOLA 3D1QA 3FCWA 3T1YJ 4QR1A 2BXJA 3QRPA 5DLFA 3GG0A 1WI6A 4UF4A 3W63A 2V50A 2DCLA 3HF5A 4AFFA 1S1TA 1SVDA 2K7JA 4OI6A 2IM1A 2VPZB 4F67A 2QGFB 2HBYB 3ZZTA 2F8HA 2GVZA 1IXKA 3DDIA 4K4TA 2DITA 4B9MA 4Y00A 3BYRA 3D68A 3QIDA 3CCVS 1Y7PA 2XZWA 1JLAA 3QGGA 2L9NA 1YBTA 2RF2A 4NXMJ 2R2SA 5C25A 4HDGA 3I6PA 4D3GA 4HACA 4DUTA 3AD8C 3PR4A 5CD4H 5D4OA 4KHPJ 4X65F 1S99A 2N4DA 4F0KA 3EUNA 3D67A 2FJAB 3KLFA 1B0VA 2OPPB 3SMZA 4OHWA 2BQRA 1HNWF 2XYPB 3LH2S 4CNYA 1AB8A 4CO2A 4UOCA 2P9EA 2P6SA 2Z4PA 2ROEA 2FHMA 4DSIA 4X66F 3M7VA 2YQ3A 3RRHA 5KFSA 2UUCF 2R8HA 3M8QB 2JNJA 3AHPA 5H1SV 1WG4A 2M2BA 5KFWA 3CJ8A 4B3OA 4ZVUB 2HZAA 3WBZA 1RT3A 4DPOA 2KFNA 3R8YA 2J8AA 1FTRA 2VG7A 5KG6A 1URNA 4O3RA 1H74A 1T94A 5DG7A 5KFFA 4ERDA 1HYSA 3A8EA 3VV2B 2QLXA 1VQNS 2C3UA 1XERA 4KB7A 2RS8A 2XSJB 2LU1A 1FFWB 3R5DA 3NNHA 1Z1ZA 1HQUA 3HHLD 2DNMA 1RDRA 1S49A 5HATA 4IRCA 2DGQA 1FA0A 1RHRB 4IRKA 1JLGA 1T9YA 5D0GA 4ETZA 1MMNA 3DI6A 2EFVA 4C0HA 1RE1B 2MGZA 1JJHA 4RWWA 3G82A 4CLUA 1WOPA 3NRBA 5IWAF 1Y3JA 3R1HA 2ROGA 2ZBPA 1RWXB 3MAHA 3JTPA 2VKZG 2WOMB 4ZPDA 2AZ3A 3UI3A 1T9VA 2H5JB 3H5SA 2QL9B 5C24A 3TRGA 2BACA 3SQOP 3HI9A 4LFAJ 3AFGA 4EEYA 1OQ6A 4G6VB 1HARA 1ITPA 2XGPA 5GAGI 3T9NA 1RUSA 2DNOA 3BDPA 1S9EA 2C3OA 4B3RJ 2BJDA 1JLBB 1KOOA 3RBZA 3PDNA 4Y2AA 2UV8G 4ECXA 4ELTA 3W5YA 1FJGJ 1N5QA 5B0CA 4JV1A 2DYAA 5KT3A 2VDIA 1TKTB 2ZHAA 3HSZA 1RT6A 3KLGB 4JB8B 2KYZA 2OO4A 4DL4A 4DXLA 3T19A 2HFZA 4PQUB 5BYRA 2ROPA 1JJ2R 4FKXA 1GTEA 3SBMA 1U1PA 2BE2B 3R2DJ 2RU9A 4I64A 1RTHA 3D3CJ 2E9TA 2D1CA 1C1BB 5AXMA 1FKAF 1IKVB 2YNIB 3CB4A 4ECRA 2KU7A 4EYIB 3Q2SC 4YP3A 1HWIA 3DLEB 3JAMY 2MZJA 4QR0A 4DV4F 2HHVA 2QA2A 4CLFA 2J9DA 1N8RT 4M5MA 2DNNA 2HW3A 4LRCA 1ZAVA 3V6DA 1WD6A 4OX9J 2R7WA 1D0EA 2BANA 2W01A 3QJJA 2HHWA 3SQGB 2EEYA 4OQJA 4DU7A 4P75A 1JK9B 2R4FA 1VC0A 4DZ6A 1AFIA 4WWSA 5KFXA 4I0WA 2KRBA 2Q79A 3I55S 3X1LB 4FXVA 1X4EA 1TUWA 3CPWR 3MM5B 2HVEA 5KFQA 2HKEA 3Q22A 1SQGA 3VZIA 5IC4B 4DX8H 2XEXA 1VHFA 1FWLA 4WE1B 1GMWD 1SKRA 1TL3B 1V3ZA 4I56A 1I5OB 4PWWA 3MM8B 3UDLA 2LDYA 2G1DA 3DGVA 1H2TZ 5KG5A 3LP1A 2F65A 5DDQC 2ABYA 1RK8A 3NCPA 4OIXA 5HBMB 1X5SA 3KLIB 2UXCJ 3D0IE 5J2NB 1L5UA 3LGMA 4XK8C 2FHJA 2JRSA 2EKNA 3M1VA 4HDHA 2OELA 4Z2XA 3KK3A 2XHCA 2W7PA 3MMCB 4DR2F 1BE4A 4M5DA 1R8BA 4R0JA 4L76A 3HSJA 5LL6d 4MYTA 1D1UA 4ECZA 3ILLA 4BWJA 1RAGB 1QM9A 4DS4A 3BBCA 1XNQF 4HT7A 1RT7B 5AJ3J 5DGAA 2VD3A 1L3TA 4RW4B 4Y2KA 2MHNA 2CA9A 3PO5A 3R97A 5ETPA 4O23A 5DM6Q 1H6KX 1YJRA 3GFYA 4CTAA 3OVAA 3HDSA 1KQSR 2Q1LA 3I32A 2M0GB 2N7YA 1M1GA 4UTGA 2IBKA 4C7QA 1XMOJ 3GV5B 1DTTB 4LT6A 3UD3P 1N52B 1W25A 1S6UA 2D9PA 4IQXA 2DGOA 1L3SA 4J9QA 4MKBA 3HFVA 2GJIA 4X4SA 3NP5A 2LA4A 1EAYC 2HHHF 4KBIA 4WIQA 4LRAA 1EHWA 1O6XA 1NKEA 4M5LA 4IFVA 1KS2A 4ZP8A 1NEEA 3V4MA 2A2CA 2AJ0A 1FJCA 3M9OB 2OPQA 3CEDA 3N9UC 1UW4A 3T1HF 4O3QA 4DV5F 1K73T 3FQKA 2HFUA 3SV4A 3NBPB 3CSKA 3DGPB 2HNZA 4LVNP 1HWKA 5D4PA 2U1AA 1CC8A 3W2VB 2FB0A 3CUNA 3BR8A 2PE8A 1DBDA 1EX8A 3PYEA 2CFXA 3HKWA 3I5BA 3W5XA 1UZHA 2V63A 4GVBA 1NJXA 1ZM2A 3UDCA 2CQBA 4L6V3 4UQTA 4L75A 1NK8A 5IQQA 5BR8J 3D0HE 1U49A 4DL7A 1ZPVA 3EZUA 4RR5A 3MM6B 3FSIA 4KY3A 4N8OA 4UOFA 1U48A 4JV2A 3AOAA 2ZH3A 3NOCA 3BKTA 2NXCA 3HP6A 4H54A 2B51A 1VRUA 2PA3A 2F3JA 4W90B 1CJTB 2R7QA 4X62F 3E01B 2MYFA 2VJVA 2AIRB 3KUEA 2ZH8A 1XC9A 4BDPA 3W1YC 1OPZA 4BHQA 4J9NA 3M30B 1RTJA 4JI2F 2EC2A 4RU9A 1QVFR 2B6AA 4F7VA 4ZJLA 2Z58B 1R0AA 4DR4F 2OAUA 3TWZA 5C5JA 3CDBA 1TMMA 3UO0A 1OY8A 1D09B 3ET6B 2OUGA 3FEXB 1RAIB 2H4WB 4R25A 2BJ9A 2PIIA 4O44B 2IJNA 3TUJC 5F3ZA 5M2UA 2W9CA 1CULB 5IV3A 4CQ1A 5LOQA 1YK9A 3AOCA 8ATCB 1ZAWA 3DRSB 4I6WA 3US5A 4F3OA 4HTIA 1HPZA 3EE3A 4X4PA 4NCGB 5CHCB 1S6QB 1FWPA 2GFFA 4WYWA 4WFBQ 1R7IA 3ZZZA 1CJUB 4KKOA 2V5HG 3JS9A 4EFAC 1U0HB 2IC3B 1TFYA 5D77A 3FCVA 3S1TA 4ZVSB 4XIUA 1OQ3A 2E1MC 2I9SA 1TKDA 1VIOA 4PQAA 2KXNB 1DHMA 1WEYA 3AD7C 1A7GE 2W2PP 2AD9A 1J5EF 1LW0A 4B3MF 3KTQA 4QU7A 4CDIA 2XMTA 1X4DA 4IH5A 1RT5B 1AUDA 2QMXA 2ZVIA 5HMYA 4MJKA 3BSNA 3DRRB 5LSLA 3GILA 3RW7A 4LRFA 5ADZA 3BO3A 2KT3A 3TUZC 2CJKA 3IG1B 2IVYA 3IO1A 2I5JA 3I0RB 4KH0B 1H0HB 1G3OA 2UU9J 4KYZA 3OFFA 4HLBA 5KG4A 3G4SS 5D0RA 1VQMS 4DR7F 3BO4A 1DFDA 3LWMA 1FRLA 2KM8C 2ZOMA 4AT1B 3K5PA 3G6YA 4DL3A 1R8PA 4YR0A 1UFKA 4ZVRB 3CVKA 2Z8QA 4ZPBA 1T9TA 1BQMA 4C8ZA 1FRMA 1H2UX 4LSNB 1DAXA 1N33J 3QLHB 4JI8J 2C2MB 2VKRA 4LQ9A 2NPIA 4TNOA 3PRBA 3VAHA 3H4DA 1IUJA 2ZHOA 3CC4S 4I68A 3KMQA 3KLEB 2GQCA 4WK3A 3MCMA 2B0GA 2MQLA 2G9OA 1UETA 4ECTA 5AE2A 3SI8A 3QJLA 3PIOQ 4QIEA 4KT0C 4NEZA 4HL9A 2KRRA 4DV1F 1VQ7S 3ULHA 5KFIA 4LSLB 4UY85 5E41A 3DKDA 1S1VA 5A2QU 4DR1J 1F2HA 2H3EB 3EPIA 2RE1A 1HBNA 4YB5A 3AB4B 5KG7A 4F4ZA 3J7AN 3ISNC 4USTA 3GFHA 5I3UB 4DL6A 3BPSP 2FLNA 1IVZA 3DRPB 1UFWA 1CG2A 1PJ6A 3QBCA 3CJSA 2CJ9A 2GO8A 5I3QA 3PRVA 2BW7A 3M32A 4CT9A 4PEOA 3GV8B 4QIGA 2OHDA 1SB6A 2ZKUA 1RAAB 4FF4A 2DHAA 5KFBA 2AJ2A 4K59A 1FHTA 2WB4A 2PI5A 2ZH6A 5L1IA 3NKYA 1APSA 3UCGA 1NKBA 3MWBA 2KVIA 2ZNYA 4FVCA 3PR5B 1RTDB 3HO1A 3HPOA 3Q2TC 2ZD1A 3E3XA 3TA1A 4QYZJ 4R8UA 3C6UB 4DPUA 2F40A 3G8TA 2EK6A 2JC1A 2ACMA 4K4ZA 4QIVA 1WDTA 4I2QA 5KFDA 4FF2A 2NZCA 3SSSA 2W9AA 2ZDOA 3RJMB 1QAJA 2H5IB 4Q2LA 4K4XA 2UXDF 2G0IA 5J1PA 1KEKA 5GAHU 5DDRC 1U1RA 4A46A 1FT8A 3OTOF 2VUGA 4WTYA 3FGVA 4GC7A 3KLVA 2AW0A 4S0MA 3QSYB 4WTOB 2X1GA 1RLDA 3MPWA 4DCJB 2NXJA 4MIAA 3KNAA 2AEFA 2V2ZA 1T9XA 4HKQA 1S0NA 5A0YA 2E5JA 2XZTB 4XDCA 3ITHA 1C2PA 3QT7A 4U7UD 2IYGA 2R2TA 4X65J 4JYAF 4TY8A 5CZVA 2ILYA 1REVA 2KJWA 2X1AA 1N0VC 3T3FA 5EGYA 1T9WA 2DNLA 4Y3CA 1HNWJ 3MM9B 1AW0A 1QTMA 3DM2A 2I8EA 2Z56B 3SCLE 1VQSA 3MDFA 4OV1A 4NYZA 5A8KA 2VPWB 3NMRA 3L09A 4X66J 5T41A 1JLEB 3VALA 2HWHA 3H8YA 4CNZA 5DZ7A 1RWVB 2LA6A 2M9KA 2HNDA 2CQ0A 3FRZA 3LGNA 1UJ4A 4N47A 1T3OA 1SV5A 4EWTA 1SUQB 5HQLA 2V4JB 3UD5A 2G0CA 1SL1A 3FSXA 3PW4A 1ZTTA 3MEKA 2MLXA 5D3GB 3J7YI 3IRXA 3R5CA 1N88A 1S1TB 1U4BA 2JLEA 1K1QA 3M8SA 2ZUAA 3K89A 2E1RA 1TL1A 2DY9A 3UQSA 3UVJB 4TU7A 3P3DA 1QLNA 2LCWA 3POTB 4W4MA 3NNAA 3PVXA 2DR9A 1JLAB 3LW5C 4QW8A 3QMQA 5KFLA 4CO1A 3CD7A 3VR1A 3OTBA 1ZTWA 4MFBA 4LSZB 4UUWA 1N5VA 3OXGA 4ID5B 1TK8A 2J5AA 4F4WA 4JI7F 5IWAJ 1RWOB 2GGPB 2CQDA 3CDEA 1XQIA 3MUVP 5JXSA 2XNRA 3V81A 4C3LA 1NH8A 3BGLA 2AGQA 4PYAA 3CIMA 4PG5A 1CJKA 1HKAA 2LEAA 4G1PA 1JNZB 1HQEA 5AE3A 5HLFB 2R9LA 1NM2A 3CJ3A 2GZOA 5KFKA 4K2XA 1RAHB 4NA2A 1PBAA 3Q24A 3IFEA 1SJRA 1GAOA 3QIPA 3TZXA 1N0UA 1IBCB 4B3OB 1RT3B 4FYVB 1Q82T 1T8EA 2FC8A 1CC7A 2V8PA 1MN9A 2JH3A 1HYSB 2CJBA 2OP5A 5FDLB 4X4QA 4LF9F 3M2RA 4DCOB 1BC6A 4OI3A 1I51B 4J9PA 4WP3A 5HROA 2DNRA 5KFAA 2DGXA 2DEJA 5ETNA 3C14B 2QFJA 3QT6A 3PHTA 5CYMA 5I4MA 1I94F 2JEJA 2CDQA 4OI0A 3MMJA 1HA1A 3AA8A 1NDKA 5KOWA 2MGZB 1ZETA 4DV4J 4WKRA 4MK9A 3OJSA 2AYGA 3I4HX 3BPDA 1RAOA 2XGQA 3DXSX 4OHVA 4QZVB 2PMWA 3QGPA 2MMYA 4DHVA 1XNRF 2OTJS 2PD1A 5LJ5Y 2KB2A 4DV0J 4LF7F 2CPXA 3EWGA 2OIHA 1C0TA 2NXEA 3VAKA 1GXLA 5C24B 3T5KA 4URQU 4RNOA 1RWMB 1WEZA 2XYGB 3GR1A 3LA0A 2COLA 1HNIA 2UZAA 2UUBJ 1FDAA 2BE9B 2AGPA 3A3OB 1TKXB 2GW8A 5J1EA 4M5JA 1NBEB 3CCRS 2WK4A 2EI5A 4DG1A 2P5VA 1NK7A 4K2JA 4N5SA 2HWIA 3T1AA 2MXYA 2NREA 2CWKA 1IKYA 1F9EB 2DKOB 3EXYA 4IYQA 4DQSA 1LWFA 2P6TA 4NRUA 5F9NA 1PYSB 3FEYB 1YZ6A 4KGMA 1EKRA 1HR0F 1HD0A 1TL4A 2V67A 1X4CA 2W2OP 2I38A 1RADB 5A8RB 4J9LA 1F5CA 3BQ2A 3BSOA 4NWBA 4V19J 2Y9HA 2F1FA 3CJTA 3V6JA 3BSAA 1VRTB 4DF8A 2GJFA 4DR2J 1NNDA 4CLYA 3PHEA 2PFDA 1ZH5A 3KK1A 3EPGA 1JLCA 3D9BA 3HZEA 2CQ4A 4Q7AA 2FC9A 3OL9A 1XNQJ 2HRUA 4NZ6A 2MZTA 1SQFA 1HFEL 3R5BA 3MAQA 2IFXA 2OMLA 4L74A 1TQLA 4MKYA 1RB0A 3ZTQA 4ZVHA 5GAEI 3MXHP 3IS9B 1Z2ZA 3PJWA 2PA8D 4USVA 2HIYA 2UVUA 3W3SA 5H9EJ 2B8QA 3PKMA 4P2FA 2V4QA 2VBXA 1U45A 4PRFA 3BB5A 2OJ3A 3N6MA 1UWAA 4DF4A 2YKAA 2GX8A 4RNFA 3P96A 4OX8A 3D1OA 2KJVA 1AXQA 1WF1A 4HHUA 3TARA 2IY5B 4I7FA 1HNZF 2F4VF 1YSJA 4DL2A 1LWCB 1Q8LA 4RZRA 1HBOB 4FDFA 1FTCA 2DGVA 3MPDA 3SSRA 3E8OA 2HFNA 1U02A 3BV8A 4KO0A 1VBYA 4RW6A 4KGVB 1K9MT 2FJBB 3PX6A 2IRXA 1IBLF 1X8DA 2DISA 2XM3A 4C3MA 4FNHA 3KG4A 4FN5A 2N3OA 2RHQB 2MQMA 5DZ6A 4DV5J 5HMWA 3EDQB 1GMUA 2C2RA 4RNHA 4NPOA 4CLPA 4M5DB 5D4LA 1FXLA 2N7CA 4LJMA 1GH8A 1NZAA 3S8SA 1RWUA 2CJQA 1FO1A 4I6YA 1PSDA 2W2MP 4TN2A 2ZC4A 3MPYA 4M5IA 4YUDA 3IAS9 1DY3A 2XY6A 2ZUGA 4LRDA 2VA2A 2J7UA 2GMHA 3QO9B 1LK7A 3EXCX 2BZ2A 3PX0A 3R6LB 4QWEA 5ETOA 1V3RA 4JUZA 4EBEA 3ZTSA 1NKCA 3KJQB 3R6GB 4EZ6A 4EBCA 1MNEA 2DPJA 5RUBA 2E44A 2OPPA 3DLGB 2D9OA 2DR5A 2APOA 3MPVA 4TYAA 5JUMA 4UW2A 2H65B 4X62J 5SUHA 4ID8A 2HVZA 4O3OA 1RABB 3UFCX 2EK1A 4ETXA 4B9LA 2DB1A 4JI1F 1OY9A 3M8QA 1R89A 1TL7B 1SJQA 4ES3A 2UXBF 4DR4J 4DUYF 4AL7A 3NNCA 3C2PA 3NGUA 4L3KA 2FQQB 4DV3F 4WZMA 2YX7A 2CRLA 4DWIA 1WKKA 1T03B 1NXIA 3M6UA 3AD9C 2VZ9A 1IKWB 2GO9A 3MR5A 1EKSA 3VGUA 2CNKB 4FNIA 4GVBB 2IAJB 5K14B 1WC5A 2AWZA 5FIIA 2QEXS 3MECA 3BH6B 2AYMA 2K3KA 3LAKA 2EFOA 2FLOA 3P5BP 1WI8A 3TAQA 5JJBA 5KG0A 4WFNQ 3BO2A 2W2NP 1NDLA 1UTAA 2FVPA 3B8HA 5HK4A 5IZHA 4UY8T 2A3JA 3MM7A 2WSFC 2XYHB 3CCUS 3AOBA 3PYDA 5KT7A 1NAQA 4PCQA 2K06A 2WOMA 2RQMA 1CQNA 4B3MJ 2C22A 2V68A 1L3KA 2DRBA 1EB0A 1BQXA 4LBPA 2W4PA 1X7VA 3LALA 1ZAXA 5DS7A 2N4CA 3NY0A 4OYZA 3SDEB 4UZCA 4DCPB 4QPXA 4OI4A 2LFVA 3OL8A 1X9MA 4NLPA 4DBQA 1RTJB 1NPRA 3MR3A 1KVIA 2QL7B 1UVKA 3FK4A 1TKTA 2OSRA 2LLZA 3AAWB 1RGVA 4WFYA 2H9ZA 3KLGA 3GE9A 2WBMA 2GAHC 1U2RA 5HJXA 2ZM6F 4PQUA 2W8LA 3F44A 2V6AA 3CCES 1Q16B 2YWWA 1KFDA 3VVTA 2M70A 3M2VB 3HMJG 2BE2A 3DLBA 2W9CB 4QU6A 2CXEA 3D0GE 2CPDA 5EX3A 3B82A 1C1BA 4TQRA 5G4DA 3BN7A 2YNIA 1S97A 1JLQB 2MKJA 2V8VA 1LWEB 4OMFG 4DV2F 3MD1A 2M7SA 3DDKA 2EFNA 4KKOB 1U0SA 3NGSA 4IO1A 2QZ8A 1FKOB 1X5OA 3UNGC 4F3QA 4F0MA 1QVGR 2HZCA 1KTVA 2KH9A 3PG9A 1AFJA 5B0AA 3K5OA 3MMBB 1TKZA 2DRDA 3GIRA 3SQGA 3WDOA 3B6BA 4DV1J 4ZS6A 2Z0GA 1LW0B 1LW2B 2FIUA 1WHXA 1UVIA 4FPIA 3RB0A 3DLKB 2E5LF 2HZVA 3UCUP 3MM5A 1V9OA 2MKKA 4WBFA 5G0RB 2QV6A 4ICLA 4XTTA 2MKSA 3L3CA 4JP8A 4P2SA 4F0HA 4A8SA 4L3NA 4USUA 2QSFA 4EU0A 1Q8KA 2HBZB 4WE1A 4J9UE 4U8YA 2WW4A 1UCNA 4FYWB 2V94A 2XMMA 1TL3A 5C42B 1QSYA 4GKJF 1WC4A 4OX6A 1GQEA 4J9SA 3HVRA 3MM8A 3C3LA 1MWZA 1VLOA 1IM4A 3IC1A 3C66A 3JYTA 4MT1A 1L3VA 1JWWA 1OYEA 4X84A 3WC0A 3LTOA 1ULRA 2M3DA 5HBMA 4ZIVA 3KLIA 4OLPA 3N4WA 4ED4A 3UCZP 1KHVA 2BEFA 1F9HA 2K1RB 2VONA 5HSPA 1ZS6A 3V6HA 1FEEA 3FZBA 1M5VC 5AXLA 3KMSA 3QFHA 1S0VA 2UXDJ 4G3IA 4WIIA 3FCHA 4ZP7A 2MSSA 2YKNB 1O51A 3IXQA 1IR0A 1VBZA 3L7PA 4PUOB 5F8JA 1G2EA 4IOBA 4KPCA 1RQ0A 4UZBA 1RT7A 4K5SA 3LAMA 2XWXA 3FVYA 2XHWA 1Y11A 1GTHA 3UPFA 2QL5B 1HBNB 2D74B 4WJBA 1RYSA 3OVSA 3G8QA 1DLOB 4Y2IA 2O3DA 1JB0C 1VLYA 3H59A 3IAM9 4LF8F 4JYAJ 2WAQD 3VGTA 1EARA 2W7AA 3HZGA 3TVZA 2FD2A 3J80U 1UPPA 4CO5A 1FDNA 1YDLA 4PZVA 2VQFF 3PFOA 3TX0A 3M32B 3D6FB 1XBWA 2FZKB 4DSJA 1DTTA 1JLFB 2IM3A 4QWDA 1YHQS 2LXUA 4QW9A 4HI1A 2YH0A 1U2CA 4CH7A 3QQCD 2CKWA 3AODA 2BW2A 3Q83A 1RP5A 3EGVA 5T14A 4LVOP 2ZD1B 2ALYB 4R8UB 2J7WA 2ZNZA 3N79A 2O5DA 3M05A 3FMBA 3OR2B 2DNQA 2VBWA 3EM1A 3L7UA 1FJ7A 3G96A 3NBPA 1JXEA 4DUZF 4RBTA 4WXWA 1VQPS 1KLMA 3DN9A 3CCLS 5HVFA 3OPKA 2CAJA 4F3MA 4M5HA 2LXFA 5K8MA 1NSAA 2F8MA 4OFZA 3P5TL 1FVQA 3PEJA 3G9CA 4ECYA 4NLTA 2C3MA 3N6LA 4JI7J 4Q5VA 2HLUA 2B9WA 3FKBA 3D5MA 4KV8B 1E6YB 1SC6A 4WFXA 4DFPA 2FVRA 2P2CB 2Q3PA 5DG9A 2O66A 3MM6A 4AD6A 1ACMB 1EIYB 4FYDA 2CJYB 2PDAA 4QWBA 4Q8EA 4DPXA 3HM9A 3DM2B 1OSDA 2FHOB 2WVCA 2LECA 1YLXA 1CJTA 2AYEA 2XTJP 1NU4A 3E01A 4EI2A 4G1IA 5J2PB 2VOOA 1SJ4P 4OZ0A 2B4OA 3M30A 3BYPA 1KNZA 1BGXT 3L4BC 3OSPA 5E33A 5EWGA 4PAAA 2AKWB 2O67A 3K5LA 3EX7B 3D54A 5LXYA 3ET6A 1JMTA 3PW2A 3I82A 1FJEB 4O44A 2ALZA 2AJQA 1RHUB 3KOAA 2GCFA 1M1KT 3PRDA 2HFOA 3A3PB 3Q8VA 4LF9J 1CULA 4AXJA 1B0PA 3T41A 2XS7A 3BF4A 2FVCA 2ZH7A 2GAGC 1YTYA 2GA7A 3TR5A 1I94J 1TMJA 2ZWPA 4J9RA 4IG0B 1FX4A 4OLOA 4ECVA 2EXUA 3A8KA 3U1LA 2R3VA 2ZH5A 1U0HA 2IC3A 3GJQB 5J2QB 4ZP9A 4N8NA 3U7JA 2K3IA 1XNRJ 1NHUA 3RAMA 4F2SA 3R5AA 4LF7J 5GADU 4JI5F 3IN5A 1M5SA 4IR9A 4K8RA 1QAIA 5KFYA 4ECQA 3TJ8A 2HAIA 2DRAA 5H9FK 1YI2S 1KWMA 1RT5A 3PYGA 3HVWA 3NAIA 2RDIA 5K8OA 4OYBA 4JOUA 1RWPB 1YRUA 4C98A 2D3UA 2W4CA 2CPYA 2PN6A 3PZPA 1UJ5A 2MJNA 4B9NA 3QIPB 1SCJB 3IG1A 4K50A 3I31A 4ZK7M 2RJZA 4M1KA 3MCSA 2VC0A 4J91A 3R1LA 1NUEA 4TXSA 2KG0A 1RKIA 2QN6B 5EHHA 1RAJA 2YX4A 4KGZB 5L38A 4LF6J 2YH1A 2LXIA 4OV6A 4U67Q 1HR0J 3KG1A 1S4FA 3I96A 4I69A 5CCMA 1LK5A 2RUSA 2F8EX 4LSNA 5CYMB 1EQMA 4KJIA 2C2ZB 3RUBL 3KK2B 2VASA 3IR5B 2Z30B 4ZVOB 3CD6S 4NA1A 3BGFA 3ZZYA 4WFZA 2G2YA 3CW2C 4OL8A 3D4JA 3I4PA 1HMVB 3OLBA 3KLEA 1R8HA 1ZM4A 1S5ZA 2K2PA 4CLTA 4EO8A 4RX6A 2HHUA 2CQ2A 1X5PA 3J7Z5 1FFGB 3TO8A 4WP8A 3H5XA 3OUYB 3HHLB 2FGOA 2V69A 1X9SA 4I67A 5LT5A 1TK0A 3VGVA 3FBBA 2BMBA 5CD4A 3VCDA 4OZLA 4PXCA 4P10A 1QY7A 4KSEB 2ZH4A 2NZ4A 4NLQA 4NCAA 2MQ8A 2YXLA 1KTQA 2EFGA 3H7HB 3PM9A 2D3ZA 3RB4A 3RR7A 4MAKA 1RWNB 2IJRA 1S0MA 1B70B 5K5MA 3DRPA 4QWAA 5DO2A 3KHLA 4DG1B 1TFWA 2FYXA 1KOHA 4HR2A 3SCJE 3K57A 3CGIA 3M9MB 3DXBA 2XLJA 2F4VJ 3RBEA 3KNGA 3RZAA 2KHCA 1LWFB 4CH0S 1ZBTA 1C1CB 5KFTA 4PG8A 1U6BA 5KFZA 3U1MA 1S1UB 1FNMA 2JHEA 1FI4A 1YJ9S 1U1LA 4E98A 5M2RA 2EFQA 2IBOA 3PO4A 3M4XA 3TA2A 4Q43A 4ED0A 1IBLJ 3C6UA 4IQMA 2DK2A 4LFCJ 4NXNF 1DQ9A 1F5BA 4ZVEA 4A8WA 5GAHI 1JLCB 2AGOA 2XY5A 3MAAB 3KDNA 1D9DA 2EPIA 4ED6A 3D1HA 3M2UB 3WQPA 3SYZA 3Q89A 3NL0A 4AUKA 1H72C 1Y00A 3MFIA 2HLTA 1RLCL 2CQCA 3CJKB 4ECWA 2C42A 1MSWD 4BCAA 1XN9A 1LV5A 4OZ2A 4UT4A 2RQCA 1CBKA 3HSGA 4X2BA 4LR7A 3I9V9 1IJEB 3FBEA 5CABA 4AXIA 3TOQA 4OHZA 2V2VA 2B9XA 1S79A 2XLKA 4I7FB 1N34F 2RKIA 3CO0P 1MG7A 1AZSA 2RRBA 5B0GA 4NEYA 1Q1KA 4JI1J 1JLEA 3QATA 3GU0A 2R42A 2XULA 1RHJB 3B4MA 2XS5A 1RT1A 2XI3A 2HFSA 3R7BB 1Q5YA 2AT1B 4RW6B 2UXBJ 2J0SD 1WG1A 3DMJB 4DUYJ 3GCWP 4LREA 1NJZA 1DTQB 1SKUB 4OYOA 1S48A 3UW1A 2MY8A 3W7BA 2A10A 4LQ3A 3H5UA 4DV3J 2J7KA 3D6HB 5D3GA 4IG3B 3PX4A 3MEEB 5CCLA 3PW5A 2FJVA 2YWFA 2R2RA 2BKOA 4NRTA 3MGJA 3IWLA 3ZZOA 2DNGA 2P8IA 1B7YB 1NPKA 3UVJA 1VBXA 1WHYA 1D9FA 2CPJA 3K8WA 3PYFA 4OYMA 4KGKA 5BYQA 3POTA 2FGCA 4KTQA 2Z2ZA 2A0FB 2CG4A 3M8WA 4ID5A 1VHIA 3H2VE 2VBYA 3GYGA 3KHGA 3VZHA 3BJYA 3CMQA 2GGPA 3VQTA 3W64A 3H98A 1AROP 3DYAB 1KDNA 3KXDA 4ATNA 2YY3A 2LEPA 2Z2YB 1IBMF 3QZ7A 5HLFA 4HEA9 2HFVA 4G1QB 2LYVA 2ZOFA 4RKUC 5DRKA 1N32F 5I42B 3M9NB 3NWRA 3C8YA 1F0XA 3RAXA 2R8JA 2Q6BA 1R0CB 2W25A 3GMGA 2DVIA 2HHTA 2MHEA 3M8YA 4MYUA 1RSCA 4A8FA 3ZC4A 5C2CA 2ZH1A 3JQKA 2ZM6J 5K8NA 3E2EA 4CLWA 1XMQF 1JXVA 1WOSA 1QTNB 2NXNA 1D3WA 2JVRA 4QBUA 2IJFA 5FDLA 1W2BR 3K5MA 5D4NA 3NGTA 3IMQJ 4XO0A 2JJ4D 4PXEA 4IFYB 4DV2J 1DQ8A 2Z57B 4PPDA 3C14A 3MECB 1K47A 3EVOA 2XMKA 4M5NA 4J9VA 1X31C 4FZVA 4PG7A 2O1PA 2J9EA 5DGBA 4FYYB 4HT5A 3HHNB 1U1MA 2UUAJ 4DL0C 5F8LA 5E0OA 1QE1B 1T95A 3S01A 3MM7B 5CZXA 3ETOA 1QSSA 4O4RA 5KFHA 2QMWA 2DHHA 5HJYA 4WK1A 2YBVA 4FPRA 3QRRA 2RUGA 4UUXA 1VOMA 3GQCA 1BUXA 1P1LA 2E5LJ 4DQIA 4QJVA 2Q6CA 2XI2A 1U1NA 1MN7A 1S0OA 4LR9A 5CYQA 3F56A 1S7HA 1X4BA 4O4GA 4F4XA 1TKXA 2OMOA 3LPYA 2OD4A 2KT5A 3RW6A 2Y1LB 3O44A 2IA0A 1FVSA 2LQ8A 3JB9k 2VC1A 4WCEQ 4GKJJ 1T9UA 2V34A 1X4GA 4NMLA 2Y1IA 4XPEA 2VQEF 4O0IA 1U25A 3KDOA 2DGSA 4ZVQB 1B64A 1UP1A 2PFFB 2ASJA 2W8KA 2DY1A 3GJSB 5ETMA 2ZJRQ 5IQ6A 5A8RA 2LQBA 5IS2A 1D9AA 1GNKA 3W62A 3SZ2A 1N36F 2HIQA 1F5AA 2DXFA 5AE1A 5F8MA 2FHJD 1FJGF 3FQLA 1VRTA 3BGRB 1U1QA 3A13A 4HVZA 2CQHA 3H25A 1RKJA 2CVIA 4USMA 3MR7A 2V0NA 5SZTA 2VFTA 1J2VA 1ROFA 3QT8A 2PMZD 1D8YA 4DOZA 3OBIA 1TKZB 3P6YC 2PMHA 2KHDA 2DNHA 2CPZA 2BRLA 5KFCA 5HL7Q 2Y8WA 4WXOA 1HWUA 2LDIA 3OHAA 2PI4A 3MF5A 3KWMA 4N41A 3IS9A 2C2OB 2XY7A 4LF8J 3R5JB 3DOMB 3WIVA 1VQ6S 3M8RA 4ICLB 2XMUA 2C28A 2QLBB 2ILZA 2GIFA 2VV5A 2CNLB 1PO6A 4P2XA 1FD2A 3CCWA 3T6JA 5ETVA 2XO7A 1S9GB 2HQFA 3SCKE 1Q81T 3QAUA 1U6FA 1LWCA 1FRKA 3JYTB 1HBOA 3ENQA 3UDEA 1HL6A 2W9BB 5CA5A 1XR7A 3I56S 2KXFA 3WX8A 3R2CJ 4ES1A 5T7LB 2AP6A 2FHKA 2DHGA 2KDOA 1CVJA 4H4MA 1FERA 2ZVSA 2AX1A 2J6SA 2HGLA 3ISZA 3UN2A 4YY3F 1WACA 5A8WB 4Y65A 1EP4B 1Q7YT 4EZ9A 4C8KA 1X0FA 1OY6A 2NXUA 1UL3A 1AYEA 4E8UA 3TA0A 1N5YA 1I1GA 5KG1A 2DCUB 4F50A 3QO9A 6FD1A 5CYJA 2J6UA 2UXCF 2W2QP 3L7OA 2GS8A 4DX7A 1UFLA 1R43A 5A76A 3P4UB 5K8PA 2MQPA 3PJ9A 2DNZA 2XC9A 3QAEA 1RAEB 4BC7A 1PIEA 2MKYA 3MR2A 1U2FA 2B9YA 1PC5A 2DH8A 3TX8A 1VGYA 1MW7A 1P1TA 2CJXB 1UWBA 3U1NA 1VJWA 3V2UC 1UAWA 3DLGA 1TELA 1P6TA 1IKXB 2CQGA 1Y5NB 3JSBA 1CEZA 2WW8A 4LF5F 3HVTB 1EQ0A 1F9FA 3GCXP 1FX2A 5HQMA 2WSEC 2J6TA 3GJRB 3DU6A 3NWGA 2G2OA 3CDAA 1TL7A 1UEVA 3EZ5A 3MCNA 3AJ2A 3J7A1 1Y4ZB 5F9LA 5IM0B 4ELVA 3CCSS 1RT2B 2VG5B 2QA4S 1KLNA 5L9NA 2CQ3A 3Q8UA 4F8RA 2IM0A 3CJ0A 3OHBA 2LU2A 3D3BJ 3GG1A 2RH3A 3UWTA 2KXHA 1RHMB 3PTWA 4RUAA 7FDRA 2HHSA 1KLMB 1XMOF 1ZOTA 2AEMA 3KG0A 1T03A 3ZO7A 1IKWA 1KN6A 2IAJA 3MEDB 2KG1A 2HNYA 1TP7A 5K14A 1J5OA 2HQGA 1NMEB 2VPYB 1SJ1A 1ZZFA 4CLZA 2B7CB 1NK6A 4Y2MA 2QA1A 3VQSA 3J7ZT 4ZPTR 2JZ5A 2DTJA 1OSCA 4V1Ak 4B17A 2KFYA 2VFVA 4JI5J 2Z2LA 3LP0B 4ZKAA 4X4VA 1WC0A 3ETMA 2GQQA 3H90A 4C97A 1CJVB 1F2GA 3GIIA 5KOXA 3D7SB 4P9SA 4ZCLA 2ZH2A 2A2DA 3M8PB 3SDEA 1ICEB 4C11B 2GIRA 1HIYA 4NLWA 2GC8A 2DNYA 3ICLA 3PKYA 1V3SA 4NASA 2RSQA 3CT9A 3Q8QB 2CQ1A 1WG5A 4NLSA 2HEKA 3QZ8A 1H98A 4HH0A 3BREA 3GV7B 3M2VA 5D6GA 3H2UB 4PXDA 1Y5IB 4HI2A 2XZDB 4HHHA 2AJFE 3KJVB 1JLQA 3FRYA 4EO6A 1LWEA 5HQ8A 4WU3A 4DR3F 1WSVA 1UJ6A 2QT7A 3GIJA 4ITSA 2QMUB 2R7OA 1YJVA 1FKOA 1VQ9S 2CG8A 4ZCMA 3TANA 1NK4A 2K7KA 4QPTA 1C4CA 1FCAA 5E3RA 3LQVA 4ECUA 4KAIA 5LSOA 1IWGA 1WC6A 3MMBA 4ZPVR 2ATCB 1VISA 3AXMA 1LW2A 1R8CA 2RIJA 4J90A 2CDRB 4F26A 4FS1A 3OLAA 3DLKA 4LRBA 2JVOA 2ZE2B 1FD8A 4TKTA 4CWBA 5G0RA 2OKQA 3V4IB 3UR3C 3DU5A 4W92B 1WNEA 4KIAA 5F8IA 2EG2A 3MI7X 3MD3A 1RU1A 1TAQA 3K2YA 1VCTA 4KC5A 3QWPA 2YNGB 1YBUA 1K0VA 5KAKA 5DQGA 4CCHA 5C42A 4R0EA 1H7WA 4RW7B 4DV6F 5LMNF 4NL5A 2X3DA 5KFPA 2NPFA 4DL5A 5U47A 3JSYA 5HP1A 3NS6A 5IFMA 2YWHA 5DLGA 5JVHQ 3MCOA 4Y2CA 4BBYA 2IMOA 2DT9A 3W9HA 3WHIA 3UDVA 2BJ8A 2LKZA 2DGTA 5KFRA 2P9GA 3TW0A 2K1RA 1ZM3A 4MKAA 4GVLA 4P74A 5F0WA 2RQKA 2JDJA 1S9FA 2RRNA 3CCJS 1UZDA 2PSZA 2NUUG 1PILA 1TR0A 4ER8A 2Y0SD 1S6PB 3KLHB 2ZBQA 2H48B 2YKNA 2UUWA 1U6ZA 3OR1B 4PUOA 5B09A 5E3AA 3IR6B 2RDDA 2YKOA 1S1WB 4B3SF 5M2PA 3RBDA 2RILA 5HANA 1DLOA 2E9ZA 1BY9A 4ZN1A 2BV3A 5L8RC 2NS1B 3TVYA 4AYBD 4OZ1A 1JKHA 3ENVA 3K5NA 2HS3A 2YQ0A 2XMJA 4MKVA 2JEIA 3BGUA 3G2XA 2G13A 2MZ1A 2GJ2A 2VIHA 2VODA 2GVDB 1RISA 1N34J 1JNRB 3ZTRA 4XPCA 4E0DA 4GKKF 1P8GA 1JLFA 4GMKA 3W9IA 3TZWA 3C6TB 2EBEA 3OXFA 1VYAA 2XQCA 3CXCR 4YB1P 2FZCB 3SSQA 2N82B 1BHNA 1DURA 3CE8A 4DPWA 2JLFA 1URRA 1XIQA 5J1NA 3E51A 5GAEU 4A8OA 2R7UA 1HHQA 4HTJA 4X4OA 3DNCA 1BWVA 4LF4J 2DHSA 3LOUA 4YB7A 1PC4A 2XB2D 3OR2A 2PGCA 3N6NA 1HNXF 1SC4B 3CDUA 2E1CA 1SIWB 4A8YA 2FDNA 1OYDA 1WEXA 3UN5A 2DH7A 1RTIB 1FXDA 4CI0B 4AQYF 4TQSA 3GSIA 2HMIA 3D66A 1VQLS 4GO7X 2CZ9A 3ILIA 2H51B 2Q43A 2E29A 3B4DA 1VMBA 2WVEA 4MIBA 3Q8RB 4ILLA 3LO3A 3R27A 3ONQA 3I87A 3CD0A 1F1BB 4C8YA 5B0FA 3N0VA 3K59A 2RMLA 4ZDNA 1OIAA 3MPUB 3PJXA 4KV8A 1E6YA 1KFSA 5BJRA 4AL6A 1F3VA 3C19A 3AXKA 2NLWA 4OYWA 1A0OB 4ED1A 3MMAB 3PXGa 3PV8A 2WVFA 1S1XB 1IBMJ 3OTDA 1RBAA 2RKIB 5KFVA 1AZSB 3KJNB 2XG8A 2ADCA 1SL2A 4ZHRB 4GRSA 2J0WA 3LANA 2YKMA 4LFBF 1N32J 1TL5A 3IP0A 5J2PA 1VQKS 2UUCJ 1OO0B 1RT1B 4C6AA 1HHTP 3QGIA 2KZMA 5GVQA 2XMWA 1FRJA 3KYLA 2LQ5A 1SH0A 2IVFB 1GMVA 4K4SA 1LEOA 3UR0A 1U24A 4DSLA 5LSRA 1XMQJ 1U8SA 1N5TA 2I0XA 4NE9C 2B7BB 3A8IA 1HD1A 4CLSA 2RVJA 1WELA 3S7RA 3ENWA 4H4OB 1R31A 2YKQA 1NJIT 2Z2MA 2YNHA 4IG0A
chains in the Genus database with same CATH topology
1U48A 1WF0A 4JV2A 2ZH3A 4QYRA 2O67A 3K5LA 3CULA 1IBKF 3EX7B 3D54A 1VQ5S 3HP6A 4H54A 4Q0BB 2B51A 5LXYA 1JMTA 2B4UA 1GXUA 1VRUA 2PA3A 3PW2A 4FF1A 1QAXA 4B02A 3I82A 1FJEB 1A9NB 1BD6A 1KQGB 4O44A 2ALZA 2F3JA 2MB0B 2AJQA 4LUBA 1Q53A 5J2QA 3KOAA 2ZC3A 4W90B 2A18A 5KT4A 2GCFA 2R7QA 4X62F 1M1KT 3PRDA 3E01B 2MYFA 4OHXA 5E3PA 2HFOA 2KZZA 3WZ0A 4AXJA 1VK3A 1B0PA 2XS7A 3BF4A 2ZH8A 2AU0A 1XC9A 3OVBA 2FVCA 3VAIA 1P27B 5KFMA 4BDPA 1P9QC 4NXMF 1HW9A 2H5EA 1OPZA 5GADI 4BHQA 2ZBIA 3MURP 3M30B 2ZH7A 1RTJA 4J9NA 2UVVA 4YOEA 4JI2F 4RU9A 1QVFR 1KSPA 4M94A 4RUHA 1YTYA 2B6AA 3FNNA 2GA7A 1S10A 1DARA 3TR5A 4B9VA 3CMAS 1IQTA 4KHPF 1BWEA 4J9RA 3ZZ0A 4IG0B 4AE5A 4K0KF 4OLOA 3CD5A 2ZH9A 2BABA 4ECVA 1R0AA 4DR4F 2IA6A 2OAUA 3IBWA 2AF6A 4TY9A 5C5JA 3CDBA 3VTIA 1HI8A 1MROA 5A2QY 1XEZA 2MZQA 3FEXB 2I2YA 1VRUB 2IM2A 1KD1T 4R25A 3U1LA 3PIPQ 2ZH5A 2PIIA 4YFUA 4O44B 2IC3A 2DNPA 2IJNA 2WHOA 2KTQA 3W2WB 1Y5LB 3TUJC 4DN0A 4C2MA 5J2QB 5F3ZA 4ZP9A 4N8NA 5M2UA 3GIKA 3U7JA 2K3IA 2EWHA 2W9CA 3PW0A 3THVA 1DQAA 4DQRA 1JLBA 4I2PA 4CQ1A 2V8GA 1NHUA 2E5IA 3RAMA 4J37A 4F2SA 5KT5A 3OW2R 1R8AA 3JSMA 4XAKA 3R5AA 1ZAWA 3DRSB 1FKPA 4I6WA 5GADU 4JI5F 3US5A 4F3OA 4HTIA 2B6AB 1HPZA 1YGYA 2AX0A 4NCGB 1M5SA 4X4PA 3IN5A 2E7XA 3HX9A 5CHCB 4IR9A 1S6QB 1QAIA 5EWFA 5KFYA 3F41A 4ECQA 2GFFA 2HAIA 3AH6A 2DRAA 1YWXA 2OD6A 4WYWA 4RNNA 1R0AB 2L08A 1YI2S 4WFBQ 5H9FJ 1R7IA 5E3CA 1RT5A 3ZZZA 3HVWA 4KKOA 3NAIA 1MROB 1CLFA 2V5HG 2RDIA 5K8OA 4NLRA 4JOUA 4FBUA 2IRYA 3OFHA 4EFAC 1YRUA 2IC3B 4C98A 1TFYA 3CMES 2D3UA 5D77A 4ED2A 2HVIA 2W4CA 3OTCA 2VB6A 3S1TA 4XIUA 1OQ3A 2E1MC 2CPYA 4I2PB 2I9SA 2YWEA 2PN6A 3PZPA 2JX2A 1TKDA 1UJ5A 1VIOA 2MJNA 4B9NA 4PQAA 4WYLA 3QIPB 1IKVA 7FD1A 2KXNB 3JSMB 2UVWA 4V19X 1DHMA 3TQ1A 3IG1A 1WEYA 1XR5A 2CPIA 3GYXB 1N6QA 3I31A 4K50A 1A7GE 1FKPB 3KK2A 4C3KA 4DFMA 2VA3A 4YDDB 4ZK7M 2RJZA 3K8VA 2AD9A 1HPZB 4M1KA 3MCSA 2VC0A 4H4KA 1J5EF 1LW0A 3J80Y 2LQJA 4B3MF 1XK8A 4OZJA 3R1LA 3KTQA 4QU7A 3CCMS 2XMTA 4TXSA 1X4DA 2KG0A 1RKIA 3KKFA 4IH5A 3GFZA 4ZPWR 1RT5B 5EHHA 1AUDA 3DLEA 1RAJA 3LUYA 2QMXA 4Z37A 2ZKTA 2YX4A 4IDKA 4J9MA 1HMVA 3GYNA 5DG8A 5F8NA 5L38A 4URSA 2DIVA 2YH1A 5HMYA 2LXIA 2QO3A 4U67Q 1M5KC 1MMDA 3KG1A 1S4FA 4MJKA 4J9OA 1XWLA 3BSNA 3DDNA 1Q86T 3DRRB 3I96A 5LSLA 3GILA 1TAUA 3RW7A 4Q45A 4I69A 5CCMA 1R6YA 4OJ3A 3L95X 5ADZA 2UUAF 1LK5A 5B0BA 2JSXA 5J2MA 3OUYA 1YJWS 4KHRA 3HHLA 1X5TA 3BO3A 2KT3A 2F8EX 2CZ4A 2GMJA 4LSNA 5CYMB 3TUZC 2L9WA 4KJIA 2CJKA 3IG1B 3K58A 5THWA 2IVYA 3KK2B 4RU2A 1B0TA 2VASA 3IO1A 2I5JA 3IR5B 5B7WA 3I0RB 2F9JA 3OL7A 1H0HB 1G3OA 2BYCA 3IGVA 3HLUA 3CD6S 4L72B 2HHQA 2GNKA 4NA1A 3OFFA 5CYQB 3BGFA 3ZZYA 1IJFB 5KG3A 3CIZA 4HLBA 5KG4A 3G4SS 4WFZA 1VQMS 2KN4A 4DR7F 2G4BA 4O4GB 4OL8A 3BO4A 4LFAF 1DFDA 1FRHA 3LWMA 1Y3KA 2HVHA 3G8SA 3I4PA 4IDKB 1HMVB 1FRLA 1YG0A 1QJHA 3OLBA 3KLEA 1R8HA 1ZM4A 2DIUA 3N01A 4KRWA 2ZOMA 2KM8C 2ACYA 2K2PA 1R27B 3K5PA 4EO8A 4B3RF 3G6YA 4DL3A 4RX6A 2HHUA 1R8PA 3G6XA 1ELOA 5F41A 1HNVB 4YR0A 3RRKA 4X4UA 2CQ2A 3G86A 3QJPA 1X5PA 3CVKA 2Z8QA 4MH8A 4ZPBA 3J7Z5 1VQYA 3TO8A 1BQMA 3OTEA 1RT4A 3MTKA 3QGHA 5F8GA 5J2MB 3OUYB 3H5XA 1N56A 3HHLB 2FGOA 3H5YA 4C8ZA 1FRMA 1H2UX 3O5TB 4LSNB 1DAXA 1X9SA 1BQNB 4I67A 3QLHB 4Y6IA 5LT5A 5CH7B 1TK0A 1ZPWX 1KQKA 2I5JB 3SXLA 4OZLA 3VCDA 2R8IA 2VKRA 4LQ9A 3FDSA 2NPIA 4PXCA 4TNOA 5L1KA 1QY7A 3RYLA 2ZZMA 2AV5A 4DV0F 3PRBA 1WF2A 4KSEB 3VAHA 3H4DA 4CO0A 1IUJA 1C1CA 2ZH4A 2NZ4A 4NLQA 2ZJPQ 1F60B 4NCAA 4ALZA 1S1UA 1KVJA 2ZHOA 2D3OR 1KTQA 2EFGA 3CC4S 5KT2A 4I68A 1LXJA 2KFZA 3KMQA 3KLEB 3PM9A 2D3ZA 3RB4A 4C0BA 3RR7A 2GQCA 4I1TA 4MAKA 4WK3A 5HMZA 1S0MA 5K5MA 1TK5A 2UUBF 2B0GA 2MQLA 3DRPA 2G9OA 4QWAA 1UETA 2RD5C 4ECTA 5AE2A 4C9DA 5DO2A 3KHLA 5JVGQ 3SI8A 3QJLA 3PIOQ 3MEGA 1HHSA 1BQMB 4QIEA 4DG1B 1RT4B 1TFWA 3IR7B 5HI7A 3O1LA 1KOHA 4KT0C 3SCJE 1VQ4S 2M8DB 2E5HA 3K57A 4HL9A 3CGIA 3T6BA 2KRRA 3M9MB 3DXBA 4DV1F 1VQ7S 1TVRA 5KFIA 3ULHA 4LSLB 2XLJA 1YIJS 4UY85 5E41A 1S1VA 5J2NA 3KNGA 3RBEA 4D3HA 4WF9Q 3RZAA 5CQGA 3EPIA 2KHCA 1LWFB 1HBNA 2RE1A 5E7OB 4CH0S 3M6VA 1ZBTA 1C1CB 2L41A 5KFTA 4YB5A 4PG8A 1U6BA 5KFZA 3CCQS 4JI4F 4ZVGA 3U1MA 1S1UB 3AB4B 3PW7A 1FNMA 5KG7A 2R7RA 1LQ9A 2JHEA 3SCIE 5L39A 4ZA1A 1YJ9S 1U1LA 3MMCA 3VAGA 1K1SA 4F4ZA 2WCXA 1RI7A 4E98A 3ISNC 5M2RA 4IOAQ 4RUCA 3GFHA 2POKA 4DQQA 1B7FA 5I3UB 3FZ2A 2RB7A 3M2UA 2EFQA 4DL6A 2FLNA 3DRPB 3N28A 4AL5A 3CDWA 2IBOA 3DHXA 3FMWA 3VF0B 3PO4A 3GZ7A 1UFWA 4IO9Q 1CG2A 3M4XA 4OX9F 3S6EA 4DS5A 4DR6F 3TA2A 4WZQA 3MEGB 3NS5A 4RNMA 2CJ9A 2GO8A 5I3QA 4Q43A 4ED0A 3C6UA 1YBAA 3CJKA 3DHWC 4IQMA 1CSJA 1TVRB 2DK2A 2ZITA 3AA9A 3M32A 2L9DA 4CT9A 3GV8B 2ASDA 4QIGA 1S1VB 4NXNF 2Q66A 5HN0A 3DCAA 4RW4A 1DQ9A 1KR4A 1SB6A 2ZKUA 3QWUA 4X4NA 1F5BA 1TZ0A 3CTRA 2HWTA 2FUG9 4ZVEA 4A8WA 2QIFA 4FF4A 5GAHI 1JLCB 2DHAA 1JIHA 5KFBA 2AGOA 2J0QD 4K59A 5F0UA 2XY5A 1FHTA 2M88A 1D9DA 2WB4A 2PI5A 2HHXA 1WWHA 2EPIA 2ZH6A 5L1IA 2BQUA 3NKYA 3P49B 2PC6A 5DQIA 3UCGA 1NKBA 1APSA 4ED6A 3D1HA 3MWBA 2E66A 3M2UB 2KVIA 2MZRA 3SYZA 1T05B 2ZNYA 4FVCA 1Q8BA 2RRAA 2CQIA 3PR5B 3NL0A 3RB6A 4RBUA 1RTDB 2C2EA 4AUKA 3HO1A 3HPOA 3G71S 3Q2TC 2ZD1A 3E3XA 4BC9A 3TA1A 1Y00A 5A6PA 1UMJA 3BN4A 4R8UA 4QYZJ 3MFIA 3C6UB 2HLTA 2F40A 2CQCA 3CJKB 3G8TA 2EK6A 2C42A 2JC1A 3NG8A 4ECWA 1MSWD 4BCAA 1XN9A 1LV5A 4NLVA 5GMKa 4K4ZA 2RQCA 4QIVA 4X2BA 4I2QA 5KFDA 4FF2A 3I9V9 1HBUA 2MKHA 1IJEB 4RW9A 4PXBA 2HHPA 3SSSA 4YMEA 2W9AA 2EW9A 2ZDOA 1QAJA 1GX5A 4X64F 4Q2LA 4YDXA 2WBRA 4K4XA 2UXDF 2KI2A 3CJ4A 5J1PA 1KEKA 5GAHU 5DDRC 4NOHA 4AXIA 2BQ3A 1U1RA 4A46A 1FT8A 3AQPA 3OTOF 2VUGA 3DMJA 4WTYA 5MAOA 3FGVA 3TOQA 4GC7A 4OHZA 3RTVA 3KLVA 1M5OC 2BRKA 1DTQA 2AW0A 4H4MB 2HGMA 4OHYA 2X1GA 1SXLA 3MPWA 2B9XA 2ZDPA 1S79A 1TV6A 3MFHA 2XLKA 4I7FB 4MIAA 5CXTA 3KNAA 5KFUA 1N34F 4HKQA 4ES2A 2MKIA 2RKIA 1S0NA 5KTQA 5A0YA 6FDRA 2E5JA 2B56A 2RRBA 1NO8A 3KHHA 3BEGB 4PWUA 4IG3A 5B0GA 2PEHA 3MEEA 3LP2A 4I2QB 4XDCA 1Q1KA 1HBUB 3FEZA 1Z2LA 3ITHA 4RW9B 3SFGA 1SKSA 1JLEA 3HKZD 4P7TA 1C2PA 2VG6A 5EX0A 2XULA 2NQPA 3B4MA 2XS5A 3DGPA 2XBPA 3TP2A 2IYGA 1RT1A 2XI3A 1T02A 2HRYA 2R2TA 1JJ4A 2NUHA 4JYAF 4TY8A 4TYBA 5CZVA 4RW6B 3QPIA 1FXRA 3W2VA 2ILYA 5LXRA 2E9RX 1REVA 2J0SD 1WG1A 3DMJB 2KJWA 1N5YB 1NJZA 2X1AA 1N0VC 1DTQB 1FEHA 3T3FA 4A8XA 5EGYA 4IRDA 2DNLA 4Y3CA 2D41A 3MM9B 1AW0A 1S48A 3UW1A 2MY8A 3W7BA 1QTMA 1SIZA 2A10A 4LQ3A 3H5UA 1UVJA 5AJ3F 3A1YG 3DM2A 2C3YA 3PEHA 2ZJQQ 2XLIA 2I8EA 1WHWA 2FJWA 3SCLE 4OI1A 3HJFA 4NLOA 3I0SA 5A0YB 1VQSA 2J7KA 2D7SA 3KFWX 3MDFA 5D3GA 4MTPA 4IG3B 4OV1A 4NYZA 3PX4A 5A8KA 3MEEB 5CCLA 3DRYA 3LP2B 2VPWB 3NMRA 3ITHB 3HHEA 3L09A 3PW5A 5T41A 1A6LA 1JLEB 2FJVA 2YWFA 5KFEA 4A4JA 4N56A 2VG6B 3OQ2A 3VALA 2R2RA 3DYAA 2HWHA 3TAMA 2YWKA 1U26A 3H8YA 4NRTA 1UWBB 4CNZA 3MGJA 4P6QA 3IWLA 2LA6A 5EN1A 3TNVA 3ZZOA 5FD1A 2DNGA 4IOCQ 5F3TA 3ZZUA 2M9KA 4TY8B 1WHYA 2HNDA 2CQ0A 2V8DA 3FRZA 3LGNA 1VBXA 1D9FA 3O3LA 4N76A 2CPJA 1UJ4A 3K8WA 2B5JA 1REVB 4N47A 2MKCA 4NA3A 3V6KA 1IN0A 3AQOA 1T3OA 1SV5A 3DOKA 4BS2A 4KGKA 5BYQA 2NSCA 2XNQA 4EWTA 4U9RA 1U1OA 2GIQA 4CH1A 1SUQB 3POTA 4XDDA 4DEZA 2V4JB 4FBTA 2G0CA 3THPA 2FGCA 4KTQA 1SL1A 3FSXA 4G1QA 3PW4A 1ZTTA 3MEKA 1Q8IA 2OTLS 3I0SB 4JI6F 2CG4A 5I42A 5D3GB 4A8KA 2HS0A 5A8KB 3JSRA 3J7YI 4ID5A 4EUVA 2B4PA 3H2VE 2VBYA 4PR6A 2XS2A 3KHGA 1XTZA 4USIA 3VZHA 3BJYA 3WC2A 2ERRA 3IRXA 3R5CA 1N88A 1S1TB 2GGPA 3VQTA 1U4BA 3ISND 3H98A 1AROP 2JLEA 3DYAB 1K1QA 1VS3A 3HT3A 3M8SA 4ELUA 2QLWA 3MOJB 2E1RA 1TL1A 1GT8A 4ATNA 4K4UA 3UQSA 2DHXA 4TU7A 2RS2A 2HNDB 4WU2A 4CT8A 3P3DA 2IRUA 3H20A 3C46A 1SV5B 2YY3A 2LEPA 1LFWA 3DOKB 2X1BA 3MZIA 4DFKA 1IBMF 3PY8A 4ILMA 1QLNA 3QZ7A 2LCWA 3EGNA 3POTB 2FJDB 1ZYQA 4DN9A 3NNAA 2CPFA 3PVXA 2DR9A 5HLFA 4HEA9 1JLAB 3LW5C 1SBRA 4QW8A 4G1QB 1MU2A 2BDPA 4WFAQ 3QMQA 5KFLA 4CO1A 4A8QA 3CD7A 3GR0A 2LYVA 1NB7A 4LMZA 5IT9Y 3VR1A 3OTBA 1M90T 1NHVA 1ZTWA 2ZOFA 4RKUC 4MFBA 5DRKA 3ZZPA 4IUFA 1RYRA 4UUWA 2JFKA 1N5VA 5I42B 1N32F 4O3PA 3M9NB 3W2WA 3OXGA 3C8YA 1F0XA 4ID5B 3RAXA 1TK8A 2R8JA 2J5AA 2Q6BA 4F4WA 3SV3A 4JI7F 3VAJA 5D8HB 2W25A 3J7YU 3IRXB 1ZZNA 2HNYB 3GMGA 4Q8FA 2GGPB 4IFYA 2CQDA 3CDEA 2DVIA 2HHTA 2KO1A 3NCQA 2MHEA 3MUVP 3RAQA 4MYUA 5JXSA 3BSCA 1GXTA 4A8FA 1J5OB 2XNRA 3AB2B 3ZC4A 3V81A 4C3LA 1TL1B 2ZH1A 2KYXA 2WONB 1NH8A 1VK8A 3BGLA 3DRSA 4CIOA 2AGQA 5K8NA 5I3PA 2C3PA 2RNEA 3CIMA 4NCGA 4PG5A 3E2EA 1XMQF 1S6QA 2LEAA 4G1PA 4ED8A 4U7CA 4DV7F 1JNZB 2VPXB 1D3WA 1HQEA 3EGWB 1S72S 2JVRA 5AE3A 2V9WA 5HLFB 4QBUA 1MU2B 2KM8B 2IJFA 2R9LA 5FDLA 4A8MP 1W2BR 4RBVA 3K5MA 4MFBB 3CJ3A 5D4NA 1JXLA 1QE1A 1YJNS 1DJ0A 3BM7A 4XO0A 3CWJA 4NYPA 5KFKA 4K2XA 2W4DA 1FNXH 1UA0A 4ZP6A 4GO5X 4NA2A 2JJ4D 1X0PA 1N4LA 4PXEA 2HYIB 2XWYA 5BR8F 2MQNA 1Q7LB 2M8HA 4IFYB 3Q24A 3IFEA 4OZNA 1SJRA 1DQ8A 4PPDA 3V81B 3CCZA 1FDDA 3MECB 1X4AA 2XMKA 1GAOA