4N8QA

Alternative substrates of mycobacterium tuberculosis anthranilate phosphoribosyl transferase
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
347
structure length
346
Chain Sequence
b'VPSWPQILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPADTVPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARRSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANAAAVRAVLGGARGPVRDAVVLNAAGAIVAHAGLSSRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anthranilate phosphoribosyltransferase
publication title Alternative substrates reveal catalytic cycle and key binding events in the reaction catalysed by anthranilate phosphoribosyltransferase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 119
structure length 346
sequence length 347
chains with identical sequence B
ec nomenclature ec 2.4.2.18: Anthranilate phosphoribosyltransferase.
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00591 Glycos_transf_3 Glycosyl transferase family, a/b domain
A PF02885 Glycos_trans_3N Glycosyl transferase family, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.970.10 Mainly Alpha Up-down Bundle Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3 Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 4n8qA01
3.40.1030.10 Alpha Beta 3-Layer(aba) Sandwich Pyrimidine Nucleoside Phosphorylase; Chain A, domain 2 Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain 4n8qA02
3QS8A 3R88A 1KGZA 4ZTVA 2WK6A 4N93A 1VQUA 1ZXYA 4OWSA 4X59A 1UOUA 5BNEA 4X58A 4GIUA 1O17A 4X5EA 4ZOKA 4YI7A 1KHDA 4OWVA 4ZOJA 4GA5A 2BPQA 4X5CA 1BRWA 4YEKA 5BO2A 4MUOA 4OWOA 3QR9A 2WK5A 3QQSA 2J0FA 1ZVWA 1OTPA 2ELCA 4GA6A 4N5VA 2DSJA 3UU1A 3GBRA 3R6CA 4ZOFA 5C1RA 5C7SA 4EADA 4GA4A 4LHMA 4IJ1A 4X46A 4N8QA 5EP8A 1ZYKA 4EAFA 4OWNA 5C2LA 4M0RA 3H5QA 4GTNA 2GVQA 4OWQA 1AZYA 4X5BA 4YYYA 4OWMA 1V8GA 1GXBA 3QSAA 4X5AA 4X5DA 5BYTA 2TPTA 4HKMA 5BO3A 4OWUA 4XR5A 3TWPA 5EY3A 4GKMA
chains in the Genus database with same CATH superfamily
3QS8A 3R88A 1KGZA 4ZTVA 2WK6A 4N93A 1VQUA 1ZXYA 4OWSA 4F3FC 4X59A 1UOUA 5BNEA 4X58A 4GIUA 1O17A 4X5EA 4ZOKA 4YI7A 1KHDA 4OWVA 4GA5A 4ZOJA 2BPQA 4X5CA 1BRWA 4YEKA 5BO2A 4MUOA 4OWOA 3QR9A 2WK5A 3QQSA 1RF8B 2J0FA 1ZVWA 1OTPA 2ELCA 4GA6A 4N5VA 2DSJA 3UU1A 3GBRA 3R6CA 4ZOFA 5C1RA 5C7SA 4EADA 4GA4A 4LHMA 4IJ1A 4X46A 4N8QA 5EP8A 1ZYKA 4EAFA 4OWNA 1RRZA 5C2LA 4M0RA 3H5QA 4GTNA 2GVQA 4OWQA 1AZYA 4X5BA 4YYYA 4OWMA 1V8GA 1GXBA 3QSAA 4X5AA 4X5DA 5BYTA 2TPTA 4HKMA 5BO3A 4OWUA 4XR5A 3TWPA 5EY3A 4GKMA
chains in the Genus database with same CATH topology
3QS8A 3R88A 1KGZA 4ZTVA 2WK6A 4N93A 1VQUA 1ZXYA 4OWSA 4X59A 1UOUA 5BNEA 4X58A 4GIUA 1O17A 4X5EA 4ZOKA 4YI7A 1KHDA 4OWVA 4ZOJA 4GA5A 2BPQA 4X5CA 1BRWA 4YEKA 5BO2A 4MUOA 4OWOA 3QR9A 2WK5A 3QQSA 2J0FA 1ZVWA 1OTPA 2ELCA 4GA6A 4N5VA 2DSJA 3UU1A 3GBRA 3R6CA 4ZOFA 5C1RA 5C7SA 4EADA 4GA4A 4LHMA 4IJ1A 4X46A 4N8QA 5EP8A 1ZYKA 4EAFA 4OWNA 5C2LA 4M0RA 3H5QA 4GTNA 2GVQA 4OWQA 1AZYA 4X5BA 4YYYA 4OWMA 1V8GA 1GXBA 3QSAA 4X5AA 4X5DA 5BYTA 2TPTA 4HKMA 5BO3A 4OWUA 4XR5A 3TWPA 5EY3A 4GKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QS8 A;  3R88 A;  1KGZ A;  4ZTV A;  2WK6 A;  4N93 A;  1VQU A;  1ZXY A;  4OWS A;  4X59 A;  1UOU A;  5BNE A;  4X58 A;  4GIU A;  1O17 A;  4X5E A;  4ZOK A;  4YI7 A;  1KHD A;  4OWV A;  4ZOJ A;  4GA5 A;  2BPQ A;  4X5C A;  1BRW A;  4YEK A;  5BO2 A;  4MUO A;  4OWO A;  3QR9 A;  2WK5 A;  3QQS A;  2J0F A;  1ZVW A;  1OTP A;  2ELC A;  4GA6 A;  4N5V A;  2DSJ A;  3UU1 A;  3GBR A;  3R6C A;  4ZOF A;  5C1R A;  5C7S A;  4EAD A;  4GA4 A;  4LHM A;  4IJ1 A;  4X46 A;  4N8Q A;  5EP8 A;  1ZYK A;  4EAF A;  4OWN A;  5C2L A;  4M0R A;  3H5Q A;  4GTN A;  2GVQ A;  4OWQ A;  1AZY A;  4X5B A;  4YYY A;  4OWM A;  1V8G A;  1GXB A;  3QSA A;  4X5A A;  4X5D A;  5BYT A;  2TPT A;  4HKM A;  5BO3 A;  4OWU A;  4XR5 A;  3TWP A;  5EY3 A;  4GKM A; 
#chains in the Genus database with same CATH topology
 3QS8 A;  3R88 A;  1KGZ A;  4ZTV A;  2WK6 A;  4N93 A;  1VQU A;  1ZXY A;  4OWS A;  4F3F C;  4X59 A;  1UOU A;  5BNE A;  4X58 A;  4GIU A;  1O17 A;  4X5E A;  4ZOK A;  4YI7 A;  1KHD A;  4OWV A;  4GA5 A;  4ZOJ A;  2BPQ A;  4X5C A;  1BRW A;  4YEK A;  5BO2 A;  4MUO A;  4OWO A;  3QR9 A;  2WK5 A;  3QQS A;  1RF8 B;  2J0F A;  1ZVW A;  1OTP A;  2ELC A;  4GA6 A;  4N5V A;  2DSJ A;  3UU1 A;  3GBR A;  3R6C A;  4ZOF A;  5C1R A;  5C7S A;  4EAD A;  4GA4 A;  4LHM A;  4IJ1 A;  4X46 A;  4N8Q A;  5EP8 A;  1ZYK A;  4EAF A;  4OWN A;  1RRZ A;  5C2L A;  4M0R A;  3H5Q A;  4GTN A;  2GVQ A;  4OWQ A;  1AZY A;  4X5B A;  4YYY A;  4OWM A;  1V8G A;  1GXB A;  3QSA A;  4X5A A;  4X5D A;  5BYT A;  2TPT A;  4HKM A;  5BO3 A;  4OWU A;  4XR5 A;  3TWP A;  5EY3 A;  4GKM A; 
#chains in the Genus database with same CATH homology
 3QS8 A;  3R88 A;  1KGZ A;  4ZTV A;  2WK6 A;  4N93 A;  1VQU A;  1ZXY A;  4OWS A;  4X59 A;  1UOU A;  5BNE A;  4X58 A;  4GIU A;  1O17 A;  4X5E A;  4ZOK A;  4YI7 A;  1KHD A;  4OWV A;  4ZOJ A;  4GA5 A;  2BPQ A;  4X5C A;  1BRW A;  4YEK A;  5BO2 A;  4MUO A;  4OWO A;  3QR9 A;  2WK5 A;  3QQS A;  2J0F A;  1ZVW A;  1OTP A;  2ELC A;  4GA6 A;  4N5V A;  2DSJ A;  3UU1 A;  3GBR A;  3R6C A;  4ZOF A;  5C1R A;  5C7S A;  4EAD A;  4GA4 A;  4LHM A;  4IJ1 A;  4X46 A;  4N8Q A;  5EP8 A;  1ZYK A;  4EAF A;  4OWN A;  5C2L A;  4M0R A;  3H5Q A;  4GTN A;  2GVQ A;  4OWQ A;  1AZY A;  4X5B A;  4YYY A;  4OWM A;  1V8G A;  1GXB A;  3QSA A;  4X5A A;  4X5D A;  5BYT A;  2TPT A;  4HKM A;  5BO3 A;  4OWU A;  4XR5 A;  3TWP A;  5EY3 A;  4GKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...