4N8YA

Crystal structure of a trap periplasmic solute binding protein from bradyrhizobium sp. btai1 b (bbta_0128), target efi-510056 (bbta_0128), complex with alpha/beta-d-galacturonate
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
300
structure length
300
Chain Sequence
RDFRSADVHPADYPTVEAVKFMGKQLAAASGGKLGVKVFPNGALGSEKDTIEQLKIGALDMMRINSSPLNNFVPETVALCLPFVFRDTQHMRNVLDGPIGDEILAAMEPAGLVGLAYYDSGARSIYTVKAPVKSLADLKGLKIRVQQSDLWVGMIQSLGANPTPMPYGEVYTALKTGLVDAAENNWPSYESSRHFEAAKFYNITEHSLAPEVLVMSKKVWDTLSKEDQALVRKAAKDSVPVMRKLWDEREQASRKAVEAAGVQVVTVANKQEFVDAMKPVYQKFAGDEKLSSLVKRIQDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Bradyrhizobium sp.
molecule tags Transport protein
molecule keywords Putative TRAP-type C4-dicarboxylate transport system, bindin
total genus 114
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4n8yA00
2XWVA 4MHFA 4O8MA 4YZZA 5IM2A 4PFBA 4XEQA 2XWOA 4X04A 4PGNA 4N17A 3U65A 4PFIA 3FXBA 2ZZWA 4PGPA 4PF8A 4P56A 5IZZA 4N4UA 4X8RA 5I5PA 4PBQA 5I7IA 4DI4B 2VPOA 2WYKA 4OVRA 4NF0A 4PBHA 2PFZA 4XFEA 4OA4A 4OVTA 5IGAA 2XA5A 4YICA 4P3LA 4MX6A 2XWIA 2CEXA 4N8YA 4PAFA 4PDDA 4P1LA 4XF5A 4O7MA 4NGUA 4PAKA 4PF6A 2VPNA 2CEYA 4MAGA 4PAIA 2HZKA 2XWKA 4MIJA 4NG7A 4PETA 4N15A 4MEVA 2XXKA 4OVSA 4PE3A 2V4CA 5LTCA 4O94A 4N91A 4MNCA 4PC9A 5CM6A 4LN5A 2ZZXA 4MCOA 4OVPA 4OVQA 4P8BA 2HPGA 4PFRA 2ZZVA 4MNIA 2WX9A 4P1EA 4N6DA 4MMPA 4DI3D 4PCDA 3GYYA 4P9KA 4P47A 4MNPA 3B50A 4NX1A 4UABA 4NHBA 4PDHA 4NQ8A 4NAPA 2PFYA 2WYPA 4NN3A 4OANA 4N6KA 4N8GA 2HZLA
chains in the Genus database with same CATH superfamily
2D5WA 5ET8A 2HQ0A 1Z7ME 4DLDA 1S9TA 3QUFA 1B1XA 2XXVA 4HE2A 1GR2A 2A5TA 4X1BA 2NWJA 4PFIA 3T1BA 1VSOA 3FJ7A 4PF8A 5I5PA 4F3BA 3ILUB 2JJKA 1EYKA 2HEUA 4FBPA 1MQDA 3E13X 2Q2CA 5ET6A 5EYGA 2UYFA 4KR5A 2XWIA 3SEUA 1B1HA 1FPLA 4ZS9A 4H5GA 3G3GA 3Q29A 1B7HA 3O66A 2VD3A 2DWHA 2Z23A 3W9WA 3U8QA 4DXUA 1NH7A 3CFLA 5ICTA 1GGGA 2V4CA 5ET7A 3GBBA 1DMBA 2Y5KA 3TTKA 2LAOA 3GZGA 5IZ3B 1FSAA 1F9BA 4YB7A 3DP6A 4JSDA 4GWUA 3L6HA 3H3GA 2DE3A 3SKPA 5HBCA 4KHZE 4JWYA 4PDHA 4NE4A 1ZJLA 1POTA 2PBWA 3K1PA 4HE1A 2F5XA 1ANFA 3U93A 2OWTA 4H5FA 3TFLA 1IMAA 4GIZA 2D21A 4H65A 4PQJA 3RPLA 4PGPA 3B6TA 3FASA 2QS3A 2UXAA 3V83A 5IZ1A 5EHMA 5CMMA 4O3CA 3PGFA 2XXTA 4RPNA 4OFJA 2XA5A 3KBZA 4QSEA 1KA1A 2DE2A 1D9VA 2DS9A 4XTCQ 3KC1A 3MZBA 3O6HA 1QUIA 3M8UA 1OQGA 5FTIA 4ZEKA 3RPWA 4F2OA 5EQ7A 2H99A 4QHQA 3PPPA 2RCBA 3BFUA 1SBPA 2BJJX 1LB8A 3UORA 2DE4A 3FBPA 4Q0CA 4OZ9A 2R71A 4PC9A 3T22A 2NXOA 4MCOA 4N81A 2HPGA 4PFWA 3QAXA 5K2YA 3E78A 4P47A 3ODBA 3H6TA 4NQ8A 1QULA 3KFMA 3EPEA 3T9VA 4IY6A 4X48A 1A99A 3TEPA 1FCKA 1DSNA 4XEQA 2XWOA 3E79A 2CZLA 4NF5A 3VE1B 2F7BA 3PMXA 3CSBA 3FXBA 4FAJA 1IMFA 4NF4A 2ONSA 2R9JA 4I40A 2VPOA 4Z0IA 5DYHA 5H8NB 2V25A 1XI6A 2ZMBA 3IOWA 4BDOA 1JETA 3K6VA 4XKQA 4N8YA 3IB0A 1Z7NE 1QKBA 3C33A 4NGUA 2XX7A 1I6BA 1FPDA 5I2NA 1FQBA 4PAIA 3SDFA 1LAGE 3FVNA 3T9XB 1EYIA 1B5JA 5K2XA 4POWA 4GWXA 3CSGA 4G8MA 1B0HA 3G7WA 3FVOA 4XKPA 5KZTA 4GXSB 4F3PA 1MG1A 2ZNUA 3PPOA 2XHDA 3P7IA 1FPKA 4OVQA 2VGQA 1MPDA 2UYEA 4HCWA 4WKMA 2F78A 4O3BA 1Q1KA 2O51A 3BKIB 3QIMA 4IO5A 1P99A 1P1OA 2PMSA 2PYYA 1FQCA 3IX1A 1K9ZA 1B40A 2HXWA 4KYSA 1FTJA 2Q88A 4N8GA 2FHYA 2HZLA 5DT6A 3E4RA 2OK2A 1M5EA 1Y4CA 4TLLB 3CFXA 1RKMA 3W9VA 4PGNA 4WXJA 5TU0A 1Y20A 1FPBA 3IL1B 1AMFA 4QF9A 3OMBA 4H46A 1FTOA 3TUSA 2RKMA 1D4NA 2XXUA 4DIGA 4NEDA 1IXGA 2Y7KA 5JTYA 3K6UA 3G3KA 3RGYA 1US4A 5HPQA 3RTFB 3BIGA 3BIHA 2Q89A 2CEYA 2Y7RA 4JSOA 3FV2A 4EQ7A 3USDA 4R6YA 1B4ZA 3CHGA 5IAIA 4G68A 3ZS6A 2XXPA 3FD3A 3HCQA 1EH3A 4PE3A 5L9SA 1NUYA 3PUYE 4ZEFA 3TCFA 3W15C 4MNCA 3QMFA 2VOZA 3H06B 1IXHA 2D3IA 4JWOA 3IB1A 4P8BA 4MMPA 3IK6B 3O6GA 4U21A 5TP9A 4P11A 3RPLB 2QSXA 3MZ1A 4LQ2A 2OWZA 3IOTA 2P1SA 4OANA 4ECFA 2CZIA 1DPEA 3C31A 1NV5A 1XC1A 3E9XA 5IZ3A 2I3VA 5L8DA 5LDZA 1SW1A 1JVYA 3OO6A 2DP8A 2XX8A 1Y1ZA 2ZYNA 2UVIA 1LFGA 4C1TA 1N3WA 3LBSA 5H8SA 4ZE9A 3PMWA 4ZEBA 3PPNA 3MSTA 1B51A 4XFEA 2PX1A 4KYEA 4IO2A 2IA4A 5FBPA 1XS5A 3Q25A 4ELRA 1FRPA 2V3QA 1NUXA 1IMDA 1MH4A 2RINA 2Y7WA 3DELB 3IFAA 4MAGA 4H1XA 3RYDA 1NV6A 1MQIA 4MIJA 1FJ9A 3ONMA 4GFRA 1T0KA 4Q5TA 2XXYA 4WEPA 3TAJA 4POXA 3B7DA 4AQ4A 2DXYA 1SYHA 4AS4A 4FE8A 3K00A 1DBZA 5L9OA 4MBPA 1N3XA 4GBWA 1BIYA 1MDP1 1NNKA 4WEDA 5F7VA 4YMBA 3FJMA 3SEXA 2QS4A 2O84X 1FBGA 1BK4A 3MPLA 4PFTA 2GFEA 1O64A 3FATA 1Q9DA 1PB8A 3BBRA 3PUZE 4QBAA 1RYOA 1AWBA 2DWAA 2OLBA 3FV1A 2F3BA 4ELQA 3K0VA 2XXXA 1NV4A 2QVVA 3UGWA 2WYKA 1IXIA 1SVXB 1SW4A 3SETA 4ONYA 2PCRA 3TZAA 4OA4A 3LSWA 2FBPA 5IGAA 1MXUA 3EKIA 4E0XA 4P1LA 1LAXA 3N6UA 2GQ1A 1SPIA 1AL3A 1O63A 4O3AA 2ONKE 4IGRA 5ESYA 3I3VA 3D4GA 1FQFA 1MH3A 4OVSA 1Y3PA 1MY2A 1XVXA 1Y3NA 3N26A 4FATA 1USYH 5EQAA 2XX9A 2DWIA 4RK2A 2VT5A 4YMAA 4KD5A 4DI3D 2GH9A 5DW8A 3A3UA 2CMOA 3GBAA 4F19A 3IOVA 5H8HB 1N7WA 1LBVA 1B52A 5T3JA 3TCGA 4HW8A 3MVYA 1MM7A 3OEKA 5H8QB 3TDJA 1DTGA 4IO3A 1O7TA 5DEXA 2RC7A 3MYUA 4OENA 3UN6A 4OFLA 4DE8A 4NF8B 3IR1A 4G8HA 1GV8A 1S7YA 3PD9A 3VDFA 4IR8A 4XKRA 3TELA 5IZZA 1B3GA 1UIUA 1LFIA 3O2AA 4NF0A 1IMCA 3T9HB 5H8QA 3LR1A 3B6WA 2P2AA 3CRBA 5FHNA 2NOOA 3EQ1A 2HHMA 5CRYA 3FJGA 3KN8A 3JV9A 5EQ9A 3LUZA 3K1MA 4ZDMA 3O28A 1VR5A 2DDKA 4KYDA 3E3KA 3RQTA 1RDZA 2X7QA 4LATA 3SEYA 3S9EA 2F7CA 3HV1A 4R9FA 1YPNA 3KEIA 2FIXA 1USYE 4PETA 1D9QA 1OVTA 2CZHA 5HM4B 4EUOA 5KDTB 1LBZA 5L9MA 3FIRA 4N91A 4GWYA 1N84A 1IIWA 4DXBA 5AA2D 1POY1 4KCCA 3KC0A 2OCUA 1PB7A 4LP2B 4M1VA 1P1QA 3VLWA 4TOZA 2V3UA 3SERA 4MNIA 3MC2A 5KCJB 3DM0A 4MJOA 4R6KA 1Y4TA 2FIEA 3HO7A 4X1DA 2VD2A 3TMGA 1PC3A 4BDLA 1A54A 4DCXA 5BUUA 4KPTA 1FPIA 2H98A 4NMYA 4EF1A 1EU8A 1KWHA 3TQLA 3S9LC 1OVBA 4GX3A 4G2ZA 1NMUA 3KJ7A 2OJTA 4YKKA 4E0WA 4OXVA 4DZ1A 2THIA 4Z7EA 1AOVA 1LBYA 2WBBA 1S50A 5IKBA 1MY1A 3DLNA 1B4HA 2G29A 4F18A 4OERA 4ELOA 4DDDA 1OMPA 3KSJA 1Q35A 5EHSA 2I0BA 3R26A 3MVWA 2V84A 1FQEA 3ZKKA 3PUVE 1SW2A 4AB6A 3MAMA 4OMBA 3MVXA 2GHBA 3FVKA 1AH5A 3PUWE 1YAEA 1SW5A 4JVDA 2P3NA 4TLMB 1FPFA 2B65A 4LVQA 3K4UA 5ELVA 3RUMA 3IJXB 2CEXA 1DOTA 4MLVA 4THIA 5DEXB 4IB2A 3EHSA 1A8EA 4R72A 2HAUA 2VPNA 4EQ9A 1RDYA 4FORA 1IITA 4F2QA 3VLUA 3VVEA 4HS7A 4EXLA 4H6DA 3HPIA 2R8TA 2O69A 5I58A 5F1QA 1EZ9A 3KBRA 3QYTA 4F1VA 5H8FB 1PDAA 1ZU0A 3K1NA 4AB5A 3PTYA 1ZTYA 1DK4A 2Y7PA 2DVCA 1H43A 4EDPA 3OO8A 1CB6A 3VFJA 3KN3A 2O7IA 1FBCA 5J1DA 3H7MA 3MP8A 3THIA 5I58B 1NL5A 2OZZA 4H45A 4R74A 3B50A 4G68B 2XXWA 4PFUA 1QUJA 4NAPA 3IORA 2OBGA 1J1NA 2QVUA 3LV0A 3ISPA 1DTZA 3AXFA 3VLVA 3MP1A 1IZ1A 1GVCA 3TYHA 3G3HA 1B9JA 1OLCA 4EQBA 3DP8A 4PFBA 5M2VA 3K02A 3S2VA 3PUXE 5TP9B 4I3EA 2Z22A 2DYXA 3D4CA 1OLAA 3PV0E 4FIMA 1NV0A 3PU5A 4U23A 4U1ZA 1P1WA 4IO4A 1PB9A 4L17A 1LB9A 3C34A 4UACA 3WAEA 4N07A 3PD8A 4I9DA 2WEFA 2ZYKA 1B7UA 3VXCA 2XXIA 3S9MC 4LZ8A 3GLBA 4GXAA 1UTBB 3C35A 4JBZA 3G3IA 2Q8MA 4ELPA 1SI1A 2QPQA 1XVYA 1QVSA 4HXVA 4PE5B 1IXCA 2UVHA 1MQGA 2DXRA 4R2BA 1UTHA 4BDMA 2ABHA 3K6WA 3WAFA 4IO6A 1IEJA 3FZVA 1VFDA 3M3FA 4ISUA 3M3KA 1G0HA 5LTCA 5CMCA 3C32A 5CI5A 3LSFB 4LN5A 1UTBA 4GOTA 3L6GA 4MFIA 2ZYOA 3T9UA 5I56A 4NWDA 1EZPA 1LBCA 2DSFA 2XD3A 5FHOA 4RJZA 4MNPA 3SEVA 4X9TA 1NUZA 3QXMA 1R1NA 4G61A 1OQHA 1FPGA 1FBHA 4N6KA 4YAHX 2BJIA 1LEVA 2ZNSA 4YZZA 5IM2A 4GRKA 4QFKA 3IO4A 3TPAA 2E1SA 5ICQA 1A8FA 5EQ8A 1SD3A 1WVJA 4OESA 1I69A 1EYJA 1IMEA 4X8RA 1FBEA 3U92A 4PBQA 1VDWA 2Q9TA 2F97A 3TQWA 3VV5A 1B32A 3CG3A 1KZ8A 1LSTA 3CFZA 3LC8A 4NF6A 3A29A 2RCAA 3O97A 2QMXA 4EXKA 1MXVA 4MX6A 1CNQA 3NOHA 3Q27A 2FYIA 3N6TA 1MS7A 4FJPA 1FQAA 5BWJA 4PAKA 4GF8A 4PF6A 1B05A 3CR9A 5ITPA 1QKAA 4NF4B 2B4LA 3I5OA 1LLSA 3RTWB 1NNFA 4MEVA 3ZKLA 3PMVA 3QSLA 4ESWA 4LONB 1TXFA 4ZEIA 2I6EA 1R6ZA 1FW0A 3OENA 2O68A 1MXYA 4PFRA 4P1EA 4M4GA 1SI0A 3OSRA 5J16A 3MP6A 1MDQA 5I2NB 4R73A 3UK4A 1UTHB 2QJEA 2ALUA 2VP1A 4IO7A 1DPPA 2A5SA 1MXWA 2XXHA 4AS5A 1YZ0A 1NV2A 1MQHA 3HHGA 2F3DA 1FBPA 1N76A 5I2KA 1URGA 3KGCA 3RY3A 4H0WA 2Y7IA 4F39A 3U72A 3FVGA 3A3CA 4PTKA 4KXPA 2ZXTA 3JYRA 2V3TA 3CG1A 2YPNA 1MQJA 4ZE8A 5I7IA 2R6GE 2ZYMA 1JNFA 3QK6A 3KZGA 1TFDA 1PEBA 4KCDA 4BLAA 4KFQA 4H8JA 3LUYA 2PT1A 4HCYA 4ZECA 5AA4B 4JXIA 2W7YA 3U1OA 4BDQA 4G77A 1NNPA 4GX4A 4LA9A 1NFTA 1QW0A 2L5VA 3KG2A 3QUJA 5I57B 4RK9A 3JZJA 2X26A 5CMKA 1B3LA 5EYHA 2P3VA 4NF6B 1MPBA 3TTLA 2I48A 5I84A 1A55A 1B3FA 4YKIA 4F3GA 5CBRA 3K01A 5AA2A 3FXQA 1FTKA 4R2FA 1B5HA 5A5XB 1Y9UA 3RT8A 4YB6A 3SZPA 2X7PA 4FECA 4HE0A 1BLFA 3S9NC 3ZSFA 1A40A 1NV1A 1ZIUA 4QFOA 3V5AA 1NH8A 4JDFA 1K9YA 3EF7A 4XIGQ 1SYIA 1P1NA 4GWOA 1H3DA 2Z8DA 1HSLA 2OX3A 3OD7A 4MHFA 4OWDA 4RYAA 4F3SA 2GRVA 5LOMA 5B7DA 5ISUA 4X04A 2PT2A 4H67A 1H44A 3U65A 4F1UA 4KI0E 2ZZWA 4YB5A 4BDNA 5I59B 4P56A 3C4MA 1ZKBA 4JB7A 1B6HA 1UIVA 2VHAA 1NI9A 4I8CA 4YICA 4P3LA 3S4UA 3I6VA 1INPA 1FQDA 2IEEA 1WDNA 2YLNA 1JW4A 4PDDA 1B0LA 1B3EA 5B70A 2V93A 2QVRA 4GD5A 3MZ9A 4YKJA 4RPOA 5I56B 4GWWA 4HTGA 1M5DA 4N15A 1PBQA 4G8NA 5FHMA 3K2DA 5AA1A 4JWXA 4BDRA 5AA4A 4RA1A 1II5A 5DVJA 2O7UA 1FTLA 3O6IA 4F22A 2YJPA 4N13A 3KOSA 5I57A 1M5CA 2ZZVA 3UIFA 2WX9A 1NKXA 1QGXA 2HCAA 3TTNA 4MH5A 3KOTA 3TODA 3T93B 1B5IA 1FBDA 2H25A 5H8FA 4OVJA 2AYSA 2H9BA 1MXZA 2PFYA 1FPJA 4NN3A 4F29A 2XD2A 4DCYA 4K3FA 4U22A 1GTKA 4GQOA 2P0SA 3C36A 2XXRA 1QJMA 4ZEDA 1B58A 1LGBC 1N7XA 2PVUA 3EN3A 5DTBA 4KQPA 1LBWA 4QXDA 3TTMA 4G4PA 3OELA 5DVFA 1N0TA 4RXLA 2MKZA 4OVRA 3TTRA 2AIXA 1IQ7A 2PFZA 3RT6B 3MPKA 1JW1A 4OVTA 5CC2A 1DCUA 3KN7A 4IY5A 2OWSA 2DOJA 4FEDA 4FEBA 3N5LA 2Z8EA 1FTAA 3H4ZA 3UA8A 1G0IA 5H8HA 3CI8A 2HFBA 2H4IA 4JVIA 2O6AA 3ROJA 2I4CA 1NV7A 3N94A 2HZKA 3G3FA 4GLIA 4H8IA 5DVIA 1MY4A 1URDA 4OHNA 3MQ9A 3T96B 4Q30B 2XXKA 4RY1A 4NF5B 1MY3A 4MF3A 3HN0A 5CM6A 4U1OA 3VXBA 3A09A 4G68C 5JEIA 2M8CA 2NUVA 4PCDA 1VFEA 1NV3A 2I4BA 4NX1A 1H76A 3H6VA 3R7XA 4UABA 3IFCA 1HSEA 3T0JA 1Y1MA 1BKAA 1NNTA 4F1YA 2I3WA 1LCTA 4O8MA 5I59A 2NVUB 1YXIA 3G3JA 2KLFA 4N17A 5TPAA 3LSXA 1ELJA 1ZMGA 3Q28A 5KDTA 3V8XB 2B3BA 3VVFA 5A5LA 5A5XA 4QSDA 4N4UA 1MXXA 3SEWA 1D9YA 1B46A 1RDXA 4OETA 4O7IA 4EF2A 1B7ZA 2F6GA 2WBDA 2RC8A 4QSCA 2DVZA 3MVZA 1JQFA 3O29A 3HFUA 1FTMA 4LZ7A 4GBVA 3HSTA 3MUQA 5TPAB 2FNCA 2QMWA 5AE4A 4OEUA 1MPCA 4NG7A 2UVGA 3B8BA 4GX6A 5CBSA 2FVZA 1JEUA 2XXQA 2Z8FA 4TQUQ 3FUZA 1MY0A 3C9HA 3H03A 2Y84A 4ESXA 1SDXA 4NTLA 4UA8A 3VVDA 2ZZXA 4OFOA 4OVPA 3H6UA 2AL5A 3MWBA 3MW0A 1AIVA 1QUKA 1N04A 4LQ5A 1M5FA 3IOUA 3KSXA 4N6PA 2KQZA 4XKNA 4N6DA 3B6QA 4NWCA 3FGSA 1YCJA 4U4SA 1RYXA 4C1UA 3GYYA 4P9KA 3FXRA 2Q74A 3OEMA 2F34A 4DXCA 2WYPA 1LAFE 1XT8A 3V89B 1LCFA 4LZ5A 1TFAA 4LUBA 1PBPA 2O1LA 2XWVA 2REJA 4U4XA 1LFHA 3U94A 4I3YA 1JEVA 4QFNA 5ET5A 2AL4A 4GL0A 2F36A 5I3SA 5EYFA 4P0IA 3PPQA 3FXUA 4OYVA 4GVOA 4I1DA 1BTJA 4IGTA 2I49A 4PAFA 2DWJA 4U2RA 4XF5A 2QS2A 4ZZEA 2ONRA 2B4MA 1H45A 3O9PA 4MLQA 3OO7A 1I6QA 2B3FA 2I0CA 3F11A 2HAVA 2ZNTA 4JVCA 4R75A 1FPEA 1YYZA 1CE2A 4PFYA 2HXRA 4O94A 3D1RA 5JK4A 2KR0A 3OOAA 3HHFA 4F31B 2F8DA 1JP4A 4P0GA 3ECRA 4ZZAA 4OQOA 2Q8JA 3UP9A 4QFPA 2A5TB 1A7LA 1SQYA 3MJNA 2FA7A 1WODA 2ESNA 2F35A 1R9LA 1IMBA 3Q26A 1US5A 1ZBMA 1IUDA 5ITOA 1LBBA 2ANJA 5AA2B 3DP4A 4QFLA 1KA0A 3IJOB 2H5YA 5F24A 4QRZA 2F7AA 1VE4A 3PPRA 4R6HA 4PP0A 4NF8A 3MBPA 1ATGA 1JW5A 3RLFE 3IAZA 1P1UA 3R6UA 3KJTA 1OIBA 1R9QA 2O1MA 3OSQA 4C0RA 4R9GA 3T66A 1YTVA 2E0SA 3SESA 1FJ6A 4RNSA 3CVGA 2QFLA 4DI4B 4PBHA 3BFTA 2RC9A 3TCHA 1HSJA 2I58A 3LSLA 2CZKA 3OXNA 2UVJA 3CIJA 1Y3QA 1JVXA 3H6WA 2QL3A 3K6XA 4O7MA 3EHUA 3RNNA 4GWZA 3M3LA 2F6PA 1LAHE 5FTHA 2G93A 4OTEA 5CMBA 1LBXA 1UQWA 2XWKA 1URSA 1XOCA 1TT1A 1MRPA 4YU0A 4I62A 1L5TA 2QRYA 4OEVA 3OO9A 3IB2A 5KCJA 3TKDA 2DQVA 2WKYA 1XHYA 1B2HA 1ZLQA 4ND9A 2REGA 2RF1A 1FBFA 1B3HA 1M5BA 5H8NA 1NUWA 1D3KA 2QS1A 1EZOA 4YKPA 4GWSA 4Q8RA 3GXAA 1I6AA 1TWYA 2GHAA 1MM6A 3ILTB 4NHBA 4GL8A 5I2KB 2Y5LA 1BP5A 3IO6A 3RN8A 3EHTA 2Q2AA 4XXUA 5AA3A 5JTYB
chains in the Genus database with same CATH topology
1LEVA 1NV5A 1Q9DA 2XWVA 4MHFA 5ET8A 5IZ3A 5LDZA 2F5XA 4O8MA 4YZZA 4QBAA 5IM2A 4PFBA 4XEQA 2XWOA 3E79A 4HE2A 4X04A 1LBYA 2WBBA 3MYUA 4PTKA 1YXIA 1AWBA 4I3YA 4PGNA 4N17A 3U65A 3W9VA 4F1UA 4KXPA 5ET5A 5IZZA 4PFIA 4I3EA 1IMAA 4F18A 4GX3A 2F3BA 3T1BA 5EQ8A 3FXBA 2ZZWA 4PGPA 3RPLA 5A5LA 1IMFA 4IR8A 1FPBA 1FJ6A 4PF8A 4P56A 5I3SA 1LBWA 4QXDA 1NV4A 1EYJA 1IMEA 1NV0A 2QVVA 1FBEA 4H46A 4N4UA 1VDWA 2JJKA 2Q9TA 4PBQA 5I7IA 1EYKA 4X8RA 5IZ1A 2QFLA 4I40A 2MKZA 1RDXA 2VPOA 2WYKA 4FBPA 4OVRA 1NI9A 1KZ8A 3MSTA 4NF0A 4O7IA 4PBHA 1IMCA 2PCRA 2PFZA 4JVDA 4XFEA 4OA4A 2P3NA 1XI6A 3A29A 2WBDA 4OVTA 1FPFA 2FBPA 1DCUA 5ET6A 2WEFA 5IGAA 2CZKA 2DVZA 2XA5A 4YICA 4P3LA 5EYGA 5FBPA 3EKIA 4HCYA 4MX6A 3KBZA 1FRPA 1INPA 1CNQA 2CEXA 2XWIA 4N8YA 1FPLA 2V3QA 3HFUA 3NOHA 1KA1A 1FTAA 1NUXA 4PDDA 2DE2A 4P1LA 1G0IA 2HHMA 4GX4A 4XF5A 4O7MA 4NGUA 4GBVA 3BIGA 4PAKA 2Q8MA 2L5VA 3BIHA 1IMDA 2GQ1A 5EQ9A 4GWZA 3LUZA 1SPIA 2VPNA 4JVIA 4PF6A 2QVRA 2CEYA 1FPDA 3ROJA 5I5PA 2QPQA 2DDKA 3IFAA 3W9WA 1RDYA 2B4MA 1RDZA 1LBXA 1NV7A 3KC1A 4HXVA 4MAGA 4PAIA 2HZKA 3RYDA 2XWKA 1NV6A 4MIJA 1EYIA 5EYHA 2FIXA 2R8TA 3CHGA 2P3VA 4NG7A 5ESYA 4PETA 1D9QA 2B4LA 4GWWA 5EQ7A 1FJ9A 2CZHA 4N15A 4GWXA 4MEVA 3B8BA 4JVCA 4GX6A 1FPEA 1YYZA 2FVZA 2XXKA 4DI4B 1G0HA 4OVSA 4F1VA 4PE3A 2V4CA 5LTCA 1LBZA 1NUYA 5ET7A 2HXRA 4O94A 4N91A 3D1RA 5JK4A 2Y5KA 2DE4A 3FBPA 4GWYA 4PAFA 3PTYA 4MNCA 4PC9A 4AS4A 5CM6A 4LN5A 2KR0A 1DK4A 1FPKA 3QMFA 5IZ3B 2ZZXA 4MCOA 4OVPA 3SZPA 4OVQA 3KC0A 1DBZA 4M1VA 4N81A 4P8BA 1FSAA 2HPGA 4GBWA 2ZZVA 4PFRA 5EQAA 4MNIA 2WX9A 4HE0A 1QGXA 4HCWA 4GWUA 1JP4A 4P1EA 2KQZA 1FBCA 1FBFA 2VT5A 4MJOA 4N6DA 5J16A 1NUWA 5J1DA 4MMPA 4DI3D 2DE3A 4GWSA 5DW8A 3E78A 2FIEA 4PCDA 3GYYA 4H45A 4P9KA 1NV1A 4P47A 3RPLB 1FBDA 4MNPA 1NV3A 4F19A 3B50A 4NX1A 1K9ZA 1LBVA 1YZ0A 4UABA 3IFCA 4AS5A 1NV2A 4NHBA 4PDHA 2Q74A 4X9TA 5T3JA 1FPIA 1K9YA 1NUZA 4NQ8A 1IMBA 2OWZA 4NAPA 2Y5LA 1FBGA 2PFYA 3T0JA 1BK4A 2F3DA 2WYPA 2QVUA 1FPJA 3LV0A 4G61A 4NN3A 1FPGA 1FBHA 3ISPA 4N6KA 4N8GA 1FBPA 4OANA 1KA0A 2CZIA 2BJIA 2FHYA 2OX3A 5F24A 2HZLA 4HE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XWV A;  4MHF A;  4O8M A;  4YZZ A;  5IM2 A;  4PFB A;  4XEQ A;  2XWO A;  4X04 A;  4PGN A;  4N17 A;  3U65 A;  4PFI A;  3FXB A;  2ZZW A;  4PGP A;  4PF8 A;  4P56 A;  5IZZ A;  4N4U A;  4X8R A;  5I5P A;  4PBQ A;  5I7I A;  4DI4 B;  2VPO A;  2WYK A;  4OVR A;  4NF0 A;  4PBH A;  2PFZ A;  4XFE A;  4OA4 A;  4OVT A;  5IGA A;  2XA5 A;  4YIC A;  4P3L A;  4MX6 A;  2XWI A;  2CEX A;  4N8Y A;  4PAF A;  4PDD A;  4P1L A;  4XF5 A;  4O7M A;  4NGU A;  4PAK A;  4PF6 A;  2VPN A;  2CEY A;  4MAG A;  4PAI A;  2HZK A;  2XWK A;  4MIJ A;  4NG7 A;  4PET A;  4N15 A;  4MEV A;  2XXK A;  4OVS A;  4PE3 A;  2V4C A;  5LTC A;  4O94 A;  4N91 A;  4MNC A;  4PC9 A;  5CM6 A;  4LN5 A;  2ZZX A;  4MCO A;  4OVP A;  4OVQ A;  4P8B A;  2HPG A;  4PFR A;  2ZZV A;  4MNI A;  2WX9 A;  4P1E A;  4N6D A;  4MMP A;  4DI3 D;  4PCD A;  3GYY A;  4P9K A;  4P47 A;  4MNP A;  3B50 A;  4NX1 A;  4UAB A;  4NHB A;  4PDH A;  4NQ8 A;  4NAP A;  2PFY A;  2WYP A;  4NN3 A;  4OAN A;  4N6K A;  4N8G A;  2HZL A; 
#chains in the Genus database with same CATH topology
 2D5W A;  5ET8 A;  2HQ0 A;  1Z7M E;  4DLD A;  1S9T A;  3QUF A;  1B1X A;  2XXV A;  4HE2 A;  1GR2 A;  2A5T A;  4X1B A;  2NWJ A;  4PFI A;  3T1B A;  1VSO A;  3FJ7 A;  4PF8 A;  5I5P A;  4F3B A;  3ILU B;  2JJK A;  1EYK A;  2HEU A;  4FBP A;  1MQD A;  3E13 X;  2Q2C A;  5ET6 A;  5EYG A;  2UYF A;  4KR5 A;  2XWI A;  3SEU A;  1B1H A;  1FPL A;  4ZS9 A;  4H5G A;  3G3G A;  3Q29 A;  1B7H A;  3O66 A;  2VD3 A;  2DWH A;  2Z23 A;  3W9W A;  3U8Q A;  4DXU A;  1NH7 A;  3CFL A;  5ICT A;  1GGG A;  2V4C A;  5ET7 A;  3GBB A;  1DMB A;  2Y5K A;  3TTK A;  2LAO A;  3GZG A;  5IZ3 B;  1FSA A;  1F9B A;  4YB7 A;  3DP6 A;  4JSD A;  4GWU A;  3L6H A;  3H3G A;  2DE3 A;  3SKP A;  5HBC A;  4KHZ E;  4JWY A;  4PDH A;  4NE4 A;  1ZJL A;  1POT A;  2PBW A;  3K1P A;  4HE1 A;  2F5X A;  1ANF A;  3U93 A;  2OWT A;  4H5F A;  3TFL A;  1IMA A;  4GIZ A;  2D21 A;  4H65 A;  4PQJ A;  3RPL A;  4PGP A;  3B6T A;  3FAS A;  2QS3 A;  2UXA A;  3V83 A;  5IZ1 A;  5EHM A;  5CMM A;  4O3C A;  3PGF A;  2XXT A;  4RPN A;  4OFJ A;  2XA5 A;  3KBZ A;  4QSE A;  1KA1 A;  2DE2 A;  1D9V A;  2DS9 A;  4XTC Q;  3KC1 A;  3MZB A;  3O6H A;  1QUI A;  3M8U A;  1OQG A;  5FTI A;  4ZEK A;  3RPW A;  4F2O A;  5EQ7 A;  2H99 A;  4QHQ A;  3PPP A;  2RCB A;  3BFU A;  1SBP A;  2BJJ X;  1LB8 A;  3UOR A;  2DE4 A;  3FBP A;  4Q0C A;  4OZ9 A;  2R71 A;  4PC9 A;  3T22 A;  2NXO A;  4MCO A;  4N81 A;  2HPG A;  4PFW A;  3QAX A;  5K2Y A;  3E78 A;  4P47 A;  3ODB A;  3H6T A;  4NQ8 A;  1QUL A;  3KFM A;  3EPE A;  3T9V A;  4IY6 A;  4X48 A;  1A99 A;  3TEP A;  1FCK A;  1DSN A;  4XEQ A;  2XWO A;  3E79 A;  2CZL A;  4NF5 A;  3VE1 B;  2F7B A;  3PMX A;  3CSB A;  3FXB A;  4FAJ A;  1IMF A;  4NF4 A;  2ONS A;  2R9J A;  4I40 A;  2VPO A;  4Z0I A;  5DYH A;  5H8N B;  2V25 A;  1XI6 A;  2ZMB A;  3IOW A;  4BDO A;  1JET A;  3K6V A;  4XKQ A;  4N8Y A;  3IB0 A;  1Z7N E;  1QKB A;  3C33 A;  4NGU A;  2XX7 A;  1I6B A;  1FPD A;  5I2N A;  1FQB A;  4PAI A;  3SDF A;  1LAG E;  3FVN A;  3T9X B;  1EYI A;  1B5J A;  5K2X A;  4POW A;  4GWX A;  3CSG A;  4G8M A;  1B0H A;  3G7W A;  3FVO A;  4XKP A;  5KZT A;  4GXS B;  4F3P A;  1MG1 A;  2ZNU A;  3PPO A;  2XHD A;  3P7I A;  1FPK A;  4OVQ A;  2VGQ A;  1MPD A;  2UYE A;  4HCW A;  4WKM A;  2F78 A;  4O3B A;  1Q1K A;  2O51 A;  3BKI B;  3QIM A;  4IO5 A;  1P99 A;  1P1O A;  2PMS A;  2PYY A;  1FQC A;  3IX1 A;  1K9Z A;  1B40 A;  2HXW A;  4KYS A;  1FTJ A;  2Q88 A;  4N8G A;  2FHY A;  2HZL A;  5DT6 A;  3E4R A;  2OK2 A;  1M5E A;  1Y4C A;  4TLL B;  3CFX A;  1RKM A;  3W9V A;  4PGN A;  4WXJ A;  5TU0 A;  1Y20 A;  1FPB A;  3IL1 B;  1AMF A;  4QF9 A;  3OMB A;  4H46 A;  1FTO A;  3TUS A;  2RKM A;  1D4N A;  2XXU A;  4DIG A;  4NED A;  1IXG A;  2Y7K A;  5JTY A;  3K6U A;  3G3K A;  3RGY A;  1US4 A;  5HPQ A;  3RTF B;  3BIG A;  3BIH A;  2Q89 A;  2CEY A;  2Y7R A;  4JSO A;  3FV2 A;  4EQ7 A;  3USD A;  4R6Y A;  1B4Z A;  3CHG A;  5IAI A;  4G68 A;  3ZS6 A;  2XXP A;  3FD3 A;  3HCQ A;  1EH3 A;  4PE3 A;  5L9S A;  1NUY A;  3PUY E;  4ZEF A;  3TCF A;  3W15 C;  4MNC A;  3QMF A;  2VOZ A;  3H06 B;  1IXH A;  2D3I A;  4JWO A;  3IB1 A;  4P8B A;  4MMP A;  3IK6 B;  3O6G A;  4U21 A;  5TP9 A;  4P11 A;  3RPL B;  2QSX A;  3MZ1 A;  4LQ2 A;  2OWZ A;  3IOT A;  2P1S A;  4OAN A;  4ECF A;  2CZI A;  1DPE A;  3C31 A;  1NV5 A;  1XC1 A;  3E9X A;  5IZ3 A;  2I3V A;  5L8D A;  5LDZ A;  1SW1 A;  1JVY A;  3OO6 A;  2DP8 A;  2XX8 A;  1Y1Z A;  2ZYN A;  2UVI A;  1LFG A;  4C1T A;  1N3W A;  3LBS A;  5H8S A;  4ZE9 A;  3PMW A;  4ZEB A;  3PPN A;  3MST A;  1B51 A;  4XFE A;  2PX1 A;  4KYE A;  4IO2 A;  2IA4 A;  5FBP A;  1XS5 A;  3Q25 A;  4ELR A;  1FRP A;  2V3Q A;  1NUX A;  1IMD A;  1MH4 A;  2RIN A;  2Y7W A;  3DEL B;  3IFA A;  4MAG A;  4H1X A;  3RYD A;  1NV6 A;  1MQI A;  4MIJ A;  1FJ9 A;  3ONM A;  4GFR A;  1T0K A;  4Q5T A;  2XXY A;  4WEP A;  3TAJ A;  4POX A;  3B7D A;  4AQ4 A;  2DXY A;  1SYH A;  4AS4 A;  4FE8 A;  3K00 A;  1DBZ A;  5L9O A;  4MBP A;  1N3X A;  4GBW A;  1BIY A;  1MDP 1;  1NNK A;  4WED A;  5F7V A;  4YMB A;  3FJM A;  3SEX A;  2QS4 A;  2O84 X;  1FBG A;  1BK4 A;  3MPL A;  4PFT A;  2GFE A;  1O64 A;  3FAT A;  1Q9D A;  1PB8 A;  3BBR A;  3PUZ E;  4QBA A;  1RYO A;  1AWB A;  2DWA A;  2OLB A;  3FV1 A;  2F3B A;  4ELQ A;  3K0V A;  2XXX A;  1NV4 A;  2QVV A;  3UGW A;  2WYK A;  1IXI A;  1SVX B;  1SW4 A;  3SET A;  4ONY A;  2PCR A;  3TZA A;  4OA4 A;  3LSW A;  2FBP A;  5IGA A;  1MXU A;  3EKI A;  4E0X A;  4P1L A;  1LAX A;  3N6U A;  2GQ1 A;  1SPI A;  1AL3 A;  1O63 A;  4O3A A;  2ONK E;  4IGR A;  5ESY A;  3I3V A;  3D4G A;  1FQF A;  1MH3 A;  4OVS A;  1Y3P A;  1MY2 A;  1XVX A;  1Y3N A;  3N26 A;  4FAT A;  1USY H;  5EQA A;  2XX9 A;  2DWI A;  4RK2 A;  2VT5 A;  4YMA A;  4KD5 A;  4DI3 D;  2GH9 A;  5DW8 A;  3A3U A;  2CMO A;  3GBA A;  4F19 A;  3IOV A;  5H8H B;  1N7W A;  1LBV A;  1B52 A;  5T3J A;  3TCG A;  4HW8 A;  3MVY A;  1MM7 A;  3OEK A;  5H8Q B;  3TDJ A;  1DTG A;  4IO3 A;  1O7T A;  5DEX A;  2RC7 A;  3MYU A;  4OEN A;  3UN6 A;  4OFL A;  4DE8 A;  4NF8 B;  3IR1 A;  4G8H A;  1GV8 A;  1S7Y A;  3PD9 A;  3VDF A;  4IR8 A;  4XKR A;  3TEL A;  5IZZ A;  1B3G A;  1UIU A;  1LFI A;  3O2A A;  4NF0 A;  1IMC A;  3T9H B;  5H8Q A;  3LR1 A;  3B6W A;  2P2A A;  3CRB A;  5FHN A;  2NOO A;  3EQ1 A;  2HHM A;  5CRY A;  3FJG A;  3KN8 A;  3JV9 A;  5EQ9 A;  3LUZ A;  3K1M A;  4ZDM A;  3O28 A;  1VR5 A;  2DDK A;  4KYD A;  3E3K A;  3RQT A;  1RDZ A;  2X7Q A;  4LAT A;  3SEY A;  3S9E A;  2F7C A;  3HV1 A;  4R9F A;  1YPN A;  3KEI A;  2FIX A;  1USY E;  4PET A;  1D9Q A;  1OVT A;  2CZH A;  5HM4 B;  4EUO A;  5KDT B;  1LBZ A;  5L9M A;  3FIR A;  4N91 A;  4GWY A;  1N84 A;  1IIW A;  4DXB A;  5AA2 D;  1POY 1;  4KCC A;  3KC0 A;  2OCU A;  1PB7 A;  4LP2 B;  4M1V A;  1P1Q A;  3VLW A;  4TOZ A;  2V3U A;  3SER A;  4MNI A;  3MC2 A;  5KCJ B;  3DM0 A;  4MJO A;  4R6K A;  1Y4T A;  2FIE A;  3HO7 A;  4X1D A;  2VD2 A;  3TMG A;  1PC3 A;  4BDL A;  1A54 A;  4DCX A;  5BUU A;  4KPT A;  1FPI A;  2H98 A;  4NMY A;  4EF1 A;  1EU8 A;  1KWH A;  3TQL A;  3S9L C;  1OVB A;  4GX3 A;  4G2Z A;  1NMU A;  3KJ7 A;  2OJT A;  4YKK A;  4E0W A;  4OXV A;  4DZ1 A;  2THI A;  4Z7E A;  1AOV A;  1LBY A;  2WBB A;  1S50 A;  5IKB A;  1MY1 A;  3DLN A;  1B4H A;  2G29 A;  4F18 A;  4OER A;  4ELO A;  4DDD A;  1OMP A;  3KSJ A;  1Q35 A;  5EHS A;  2I0B A;  3R26 A;  3MVW A;  2V84 A;  1FQE A;  3ZKK A;  3PUV E;  1SW2 A;  4AB6 A;  3MAM A;  4OMB A;  3MVX A;  2GHB A;  3FVK A;  1AH5 A;  3PUW E;  1YAE A;  1SW5 A;  4JVD A;  2P3N A;  4TLM B;  1FPF A;  2B65 A;  4LVQ A;  3K4U A;  5ELV A;  3RUM A;  3IJX B;  2CEX A;  1DOT A;  4MLV A;  4THI A;  5DEX B;  4IB2 A;  3EHS A;  1A8E A;  4R72 A;  2HAU A;  2VPN A;  4EQ9 A;  1RDY A;  4FOR A;  1IIT A;  4F2Q A;  3VLU A;  3VVE A;  4HS7 A;  4EXL A;  4H6D A;  3HPI A;  2R8T A;  2O69 A;  5I58 A;  5F1Q A;  1EZ9 A;  3KBR A;  3QYT A;  4F1V A;  5H8F B;  1PDA A;  1ZU0 A;  3K1N A;  4AB5 A;  3PTY A;  1ZTY A;  1DK4 A;  2Y7P A;  2DVC A;  1H43 A;  4EDP A;  3OO8 A;  1CB6 A;  3VFJ A;  3KN3 A;  2O7I A;  1FBC A;  5J1D A;  3H7M A;  3MP8 A;  3THI A;  5I58 B;  1NL5 A;  2OZZ A;  4H45 A;  4R74 A;  3B50 A;  4G68 B;  2XXW A;  4PFU A;  1QUJ A;  4NAP A;  3IOR A;  2OBG A;  1J1N A;  2QVU A;  3LV0 A;  3ISP A;  1DTZ A;  3AXF A;  3VLV A;  3MP1 A;  1IZ1 A;  1GVC A;  3TYH A;  3G3H A;  1B9J A;  1OLC A;  4EQB A;  3DP8 A;  4PFB A;  5M2V A;  3K02 A;  3S2V A;  3PUX E;  5TP9 B;  4I3E A;  2Z22 A;  2DYX A;  3D4C A;  1OLA A;  3PV0 E;  4FIM A;  1NV0 A;  3PU5 A;  4U23 A;  4U1Z A;  1P1W A;  4IO4 A;  1PB9 A;  4L17 A;  1LB9 A;  3C34 A;  4UAC A;  3WAE A;  4N07 A;  3PD8 A;  4I9D A;  2WEF A;  2ZYK A;  1B7U A;  3VXC A;  2XXI A;  3S9M C;  4LZ8 A;  3GLB A;  4GXA A;  1UTB B;  3C35 A;  4JBZ A;  3G3I A;  2Q8M A;  4ELP A;  1SI1 A;  2QPQ A;  1XVY A;  1QVS A;  4HXV A;  4PE5 B;  1IXC A;  2UVH A;  1MQG A;  2DXR A;  4R2B A;  1UTH A;  4BDM A;  2ABH A;  3K6W A;  3WAF A;  4IO6 A;  1IEJ A;  3FZV A;  1VFD A;  3M3F A;  4ISU A;  3M3K A;  1G0H A;  5LTC A;  5CMC A;  3C32 A;  5CI5 A;  3LSF B;  4LN5 A;  1UTB A;  4GOT A;  3L6G A;  4MFI A;  2ZYO A;  3T9U A;  5I56 A;  4NWD A;  1EZP A;  1LBC A;  2DSF A;  2XD3 A;  5FHO A;  4RJZ A;  4MNP A;  3SEV A;  4X9T A;  1NUZ A;  3QXM A;  1R1N A;  4G61 A;  1OQH A;  1FPG A;  1FBH A;  4N6K A;  4YAH X;  2BJI A;  1LEV A;  2ZNS A;  4YZZ A;  5IM2 A;  4GRK A;  4QFK A;  3IO4 A;  3TPA A;  2E1S A;  5ICQ A;  1A8F A;  5EQ8 A;  1SD3 A;  1WVJ A;  4OES A;  1I69 A;  1EYJ A;  1IME A;  4X8R A;  1FBE A;  3U92 A;  4PBQ A;  1VDW A;  2Q9T A;  2F97 A;  3TQW A;  3VV5 A;  1B32 A;  3CG3 A;  1KZ8 A;  1LST A;  3CFZ A;  3LC8 A;  4NF6 A;  3A29 A;  2RCA A;  3O97 A;  2QMX A;  4EXK A;  1MXV A;  4MX6 A;  1CNQ A;  3NOH A;  3Q27 A;  2FYI A;  3N6T A;  1MS7 A;  4FJP A;  1FQA A;  5BWJ A;  4PAK A;  4GF8 A;  4PF6 A;  1B05 A;  3CR9 A;  5ITP A;  1QKA A;  4NF4 B;  2B4L A;  3I5O A;  1LLS A;  3RTW B;  1NNF A;  4MEV A;  3ZKL A;  3PMV A;  3QSL A;  4ESW A;  4LON B;  1TXF A;  4ZEI A;  2I6E A;  1R6Z A;  1FW0 A;  3OEN A;  2O68 A;  1MXY A;  4PFR A;  4P1E A;  4M4G A;  1SI0 A;  3OSR A;  5J16 A;  3MP6 A;  1MDQ A;  5I2N B;  4R73 A;  3UK4 A;  1UTH B;  2QJE A;  2ALU A;  2VP1 A;  4IO7 A;  1DPP A;  2A5S A;  1MXW A;  2XXH A;  4AS5 A;  1YZ0 A;  1NV2 A;  1MQH A;  3HHG A;  2F3D A;  1FBP A;  1N76 A;  5I2K A;  1URG A;  3KGC A;  3RY3 A;  4H0W A;  2Y7I A;  4F39 A;  3U72 A;  3FVG A;  3A3C A;  4PTK A;  4KXP A;  2ZXT A;  3JYR A;  2V3T A;  3CG1 A;  2YPN A;  1MQJ A;  4ZE8 A;  5I7I A;  2R6G E;  2ZYM A;  1JNF A;  3QK6 A;  3KZG A;  1TFD A;  1PEB A;  4KCD A;  4BLA A;  4KFQ A;  4H8J A;  3LUY A;  2PT1 A;  4HCY A;  4ZEC A;  5AA4 B;  4JXI A;  2W7Y A;  3U1O A;  4BDQ A;  4G77 A;  1NNP A;  4GX4 A;  4LA9 A;  1NFT A;  1QW0 A;  2L5V A;  3KG2 A;  3QUJ A;  5I57 B;  4RK9 A;  3JZJ A;  2X26 A;  5CMK A;  1B3L A;  5EYH A;  2P3V A;  4NF6 B;  1MPB A;  3TTL A;  2I48 A;  5I84 A;  1A55 A;  1B3F A;  4YKI A;  4F3G A;  5CBR A;  3K01 A;  5AA2 A;  3FXQ A;  1FTK A;  4R2F A;  1B5H A;  5A5X B;  1Y9U A;  3RT8 A;  4YB6 A;  3SZP A;  2X7P A;  4FEC A;  4HE0 A;  1BLF A;  3S9N C;  3ZSF A;  1A40 A;  1NV1 A;  1ZIU A;  4QFO A;  3V5A A;  1NH8 A;  4JDF A;  1K9Y A;  3EF7 A;  4XIG Q;  1SYI A;  1P1N A;  4GWO A;  1H3D A;  2Z8D A;  1HSL A;  2OX3 A;  3OD7 A;  4MHF A;  4OWD A;  4RYA A;  4F3S A;  2GRV A;  5LOM A;  5B7D A;  5ISU A;  4X04 A;  2PT2 A;  4H67 A;  1H44 A;  3U65 A;  4F1U A;  4KI0 E;  2ZZW A;  4YB5 A;  4BDN A;  5I59 B;  4P56 A;  3C4M A;  1ZKB A;  4JB7 A;  1B6H A;  1UIV A;  2VHA A;  1NI9 A;  4I8C A;  4YIC A;  4P3L A;  3S4U A;  3I6V A;  1INP A;  1FQD A;  2IEE A;  1WDN A;  2YLN A;  1JW4 A;  4PDD A;  1B0L A;  1B3E A;  5B70 A;  2V93 A;  2QVR A;  4GD5 A;  3MZ9 A;  4YKJ A;  4RPO A;  5I56 B;  4GWW A;  4HTG A;  1M5D A;  4N15 A;  1PBQ A;  4G8N A;  5FHM A;  3K2D A;  5AA1 A;  4JWX A;  4BDR A;  5AA4 A;  4RA1 A;  1II5 A;  5DVJ A;  2O7U A;  1FTL A;  3O6I A;  4F22 A;  2YJP A;  4N13 A;  3KOS A;  5I57 A;  1M5C A;  2ZZV A;  3UIF A;  2WX9 A;  1NKX A;  1QGX A;  2HCA A;  3TTN A;  4MH5 A;  3KOT A;  3TOD A;  3T93 B;  1B5I A;  1FBD A;  2H25 A;  5H8F A;  4OVJ A;  2AYS A;  2H9B A;  1MXZ A;  2PFY A;  1FPJ A;  4NN3 A;  4F29 A;  2XD2 A;  4DCY A;  4K3F A;  4U22 A;  1GTK A;  4GQO A;  2P0S A;  3C36 A;  2XXR A;  1QJM A;  4ZED A;  1B58 A;  1LGB C;  1N7X A;  2PVU A;  3EN3 A;  5DTB A;  4KQP A;  1LBW A;  4QXD A;  3TTM A;  4G4P A;  3OEL A;  5DVF A;  1N0T A;  4RXL A;  2MKZ A;  4OVR A;  3TTR A;  2AIX A;  1IQ7 A;  2PFZ A;  3RT6 B;  3MPK A;  1JW1 A;  4OVT A;  5CC2 A;  1DCU A;  3KN7 A;  4IY5 A;  2OWS A;  2DOJ A;  4FED A;  4FEB A;  3N5L A;  2Z8E A;  1FTA A;  3H4Z A;  3UA8 A;  1G0I A;  5H8H A;  3CI8 A;  2HFB A;  2H4I A;  4JVI A;  2O6A A;  3ROJ A;  2I4C A;  1NV7 A;  3N94 A;  2HZK A;  3G3F A;  4GLI A;  4H8I A;  5DVI A;  1MY4 A;  1URD A;  4OHN A;  3MQ9 A;  3T96 B;  4Q30 B;  2XXK A;  4RY1 A;  4NF5 B;  1MY3 A;  4MF3 A;  3HN0 A;  5CM6 A;  4U1O A;  3VXB A;  3A09 A;  4G68 C;  5JEI A;  2M8C A;  2NUV A;  4PCD A;  1VFE A;  1NV3 A;  2I4B A;  4NX1 A;  1H76 A;  3H6V A;  3R7X A;  4UAB A;  3IFC A;  1HSE A;  3T0J A;  1Y1M A;  1BKA A;  1NNT A;  4F1Y A;  2I3W A;  1LCT A;  4O8M A;  5I59 A;  2NVU B;  1YXI A;  3G3J A;  2KLF A;  4N17 A;  5TPA A;  3LSX A;  1ELJ A;  1ZMG A;  3Q28 A;  5KDT A;  3V8X B;  2B3B A;  3VVF A;  5A5L A;  5A5X A;  4QSD A;  4N4U A;  1MXX A;  3SEW A;  1D9Y A;  1B46 A;  1RDX A;  4OET A;  4O7I A;  4EF2 A;  1B7Z A;  2F6G A;  2WBD A;  2RC8 A;  4QSC A;  2DVZ A;  3MVZ A;  1JQF A;  3O29 A;  3HFU A;  1FTM A;  4LZ7 A;  4GBV A;  3HST A;  3MUQ A;  5TPA B;  2FNC A;  2QMW A;  5AE4 A;  4OEU A;  1MPC A;  4NG7 A;  2UVG A;  3B8B A;  4GX6 A;  5CBS A;  2FVZ A;  1JEU A;  2XXQ A;  2Z8F A;  4TQU Q;  3FUZ A;  1MY0 A;  3C9H A;  3H03 A;  2Y84 A;  4ESX A;  1SDX A;  4NTL A;  4UA8 A;  3VVD A;  2ZZX A;  4OFO A;  4OVP A;  3H6U A;  2AL5 A;  3MWB A;  3MW0 A;  1AIV A;  1QUK A;  1N04 A;  4LQ5 A;  1M5F A;  3IOU A;  3KSX A;  4N6P A;  2KQZ A;  4XKN A;  4N6D A;  3B6Q A;  4NWC A;  3FGS A;  1YCJ A;  4U4S A;  1RYX A;  4C1U A;  3GYY A;  4P9K A;  3FXR A;  2Q74 A;  3OEM A;  2F34 A;  4DXC A;  2WYP A;  1LAF E;  1XT8 A;  3V89 B;  1LCF A;  4LZ5 A;  1TFA A;  4LUB A;  1PBP A;  2O1L A;  2XWV A;  2REJ A;  4U4X A;  1LFH A;  3U94 A;  4I3Y A;  1JEV A;  4QFN A;  5ET5 A;  2AL4 A;  4GL0 A;  2F36 A;  5I3S A;  5EYF A;  4P0I A;  3PPQ A;  3FXU A;  4OYV A;  4GVO A;  4I1D A;  1BTJ A;  4IGT A;  2I49 A;  4PAF A;  2DWJ A;  4U2R A;  4XF5 A;  2QS2 A;  4ZZE A;  2ONR A;  2B4M A;  1H45 A;  3O9P A;  4MLQ A;  3OO7 A;  1I6Q A;  2B3F A;  2I0C A;  3F11 A;  2HAV A;  2ZNT A;  4JVC A;  4R75 A;  1FPE A;  1YYZ A;  1CE2 A;  4PFY A;  2HXR A;  4O94 A;  3D1R A;  5JK4 A;  2KR0 A;  3OOA A;  3HHF A;  4F31 B;  2F8D A;  1JP4 A;  4P0G A;  3ECR A;  4ZZA A;  4OQO A;  2Q8J A;  3UP9 A;  4QFP A;  2A5T B;  1A7L A;  1SQY A;  3MJN A;  2FA7 A;  1WOD A;  2ESN A;  2F35 A;  1R9L A;  1IMB A;  3Q26 A;  1US5 A;  1ZBM A;  1IUD A;  5ITO A;  1LBB A;  2ANJ A;  5AA2 B;  3DP4 A;  4QFL A;  1KA0 A;  3IJO B;  2H5Y A;  5F24 A;  4QRZ A;  2F7A A;  1VE4 A;  3PPR A;  4R6H A;  4PP0 A;  4NF8 A;  3MBP A;  1ATG A;  1JW5 A;  3RLF E;  3IAZ A;  1P1U A;  3R6U A;  3KJT A;  1OIB A;  1R9Q A;  2O1M A;  3OSQ A;  4C0R A;  4R9G A;  3T66 A;  1YTV A;  2E0S A;  3SES A;  1FJ6 A;  4RNS A;  3CVG A;  2QFL A;  4DI4 B;  4PBH A;  3BFT A;  2RC9 A;  3TCH A;  1HSJ A;  2I58 A;  3LSL A;  2CZK A;  3OXN A;  2UVJ A;  3CIJ A;  1Y3Q A;  1JVX A;  3H6W A;  2QL3 A;  3K6X A;  4O7M A;  3EHU A;  3RNN A;  4GWZ A;  3M3L A;  2F6P A;  1LAH E;  5FTH A;  2G93 A;  4OTE A;  5CMB A;  1LBX A;  1UQW A;  2XWK A;  1URS A;  1XOC A;  1TT1 A;  1MRP A;  4YU0 A;  4I62 A;  1L5T A;  2QRY A;  4OEV A;  3OO9 A;  3IB2 A;  5KCJ A;  3TKD A;  2DQV A;  2WKY A;  1XHY A;  1B2H A;  1ZLQ A;  4ND9 A;  2REG A;  2RF1 A;  1FBF A;  1B3H A;  1M5B A;  5H8N A;  1NUW A;  1D3K A;  2QS1 A;  1EZO A;  4YKP A;  4GWS A;  4Q8R A;  3GXA A;  1I6A A;  1TWY A;  2GHA A;  1MM6 A;  3ILT B;  4NHB A;  4GL8 A;  5I2K B;  2Y5L A;  1BP5 A;  3IO6 A;  3RN8 A;  3EHT A;  2Q2A A;  4XXU A;  5AA3 A;  5JTY B; 
#chains in the Genus database with same CATH homology
 1LEV A;  1NV5 A;  1Q9D A;  2XWV A;  4MHF A;  5ET8 A;  5IZ3 A;  5LDZ A;  2F5X A;  4O8M A;  4YZZ A;  4QBA A;  5IM2 A;  4PFB A;  4XEQ A;  2XWO A;  3E79 A;  4HE2 A;  4X04 A;  1LBY A;  2WBB A;  3MYU A;  4PTK A;  1YXI A;  1AWB A;  4I3Y A;  4PGN A;  4N17 A;  3U65 A;  3W9V A;  4F1U A;  4KXP A;  5ET5 A;  5IZZ A;  4PFI A;  4I3E A;  1IMA A;  4F18 A;  4GX3 A;  2F3B A;  3T1B A;  5EQ8 A;  3FXB A;  2ZZW A;  4PGP A;  3RPL A;  5A5L A;  1IMF A;  4IR8 A;  1FPB A;  1FJ6 A;  4PF8 A;  4P56 A;  5I3S A;  1LBW A;  4QXD A;  1NV4 A;  1EYJ A;  1IME A;  1NV0 A;  2QVV A;  1FBE A;  4H46 A;  4N4U A;  1VDW A;  2JJK A;  2Q9T A;  4PBQ A;  5I7I A;  1EYK A;  4X8R A;  5IZ1 A;  2QFL A;  4I40 A;  2MKZ A;  1RDX A;  2VPO A;  2WYK A;  4FBP A;  4OVR A;  1NI9 A;  1KZ8 A;  3MST A;  4NF0 A;  4O7I A;  4PBH A;  1IMC A;  2PCR A;  2PFZ A;  4JVD A;  4XFE A;  4OA4 A;  2P3N A;  1XI6 A;  3A29 A;  2WBD A;  4OVT A;  1FPF A;  2FBP A;  1DCU A;  5ET6 A;  2WEF A;  5IGA A;  2CZK A;  2DVZ A;  2XA5 A;  4YIC A;  4P3L A;  5EYG A;  5FBP A;  3EKI A;  4HCY A;  4MX6 A;  3KBZ A;  1FRP A;  1INP A;  1CNQ A;  2CEX A;  2XWI A;  4N8Y A;  1FPL A;  2V3Q A;  3HFU A;  3NOH A;  1KA1 A;  1FTA A;  1NUX A;  4PDD A;  2DE2 A;  4P1L A;  1G0I A;  2HHM A;  4GX4 A;  4XF5 A;  4O7M A;  4NGU A;  4GBV A;  3BIG A;  4PAK A;  2Q8M A;  2L5V A;  3BIH A;  1IMD A;  2GQ1 A;  5EQ9 A;  4GWZ A;  3LUZ A;  1SPI A;  2VPN A;  4JVI A;  4PF6 A;  2QVR A;  2CEY A;  1FPD A;  3ROJ A;  5I5P A;  2QPQ A;  2DDK A;  3IFA A;  3W9W A;  1RDY A;  2B4M A;  1RDZ A;  1LBX A;  1NV7 A;  3KC1 A;  4HXV A;  4MAG A;  4PAI A;  2HZK A;  3RYD A;  2XWK A;  1NV6 A;  4MIJ A;  1EYI A;  5EYH A;  2FIX A;  2R8T A;  3CHG A;  2P3V A;  4NG7 A;  5ESY A;  4PET A;  1D9Q A;  2B4L A;  4GWW A;  5EQ7 A;  1FJ9 A;  2CZH A;  4N15 A;  4GWX A;  4MEV A;  3B8B A;  4JVC A;  4GX6 A;  1FPE A;  1YYZ A;  2FVZ A;  2XXK A;  4DI4 B;  1G0H A;  4OVS A;  4F1V A;  4PE3 A;  2V4C A;  5LTC A;  1LBZ A;  1NUY A;  5ET7 A;  2HXR A;  4O94 A;  4N91 A;  3D1R A;  5JK4 A;  2Y5K A;  2DE4 A;  3FBP A;  4GWY A;  4PAF A;  3PTY A;  4MNC A;  4PC9 A;  4AS4 A;  5CM6 A;  4LN5 A;  2KR0 A;  1DK4 A;  1FPK A;  3QMF A;  5IZ3 B;  2ZZX A;  4MCO A;  4OVP A;  3SZP A;  4OVQ A;  3KC0 A;  1DBZ A;  4M1V A;  4N81 A;  4P8B A;  1FSA A;  2HPG A;  4GBW A;  2ZZV A;  4PFR A;  5EQA A;  4MNI A;  2WX9 A;  4HE0 A;  1QGX A;  4HCW A;  4GWU A;  1JP4 A;  4P1E A;  2KQZ A;  1FBC A;  1FBF A;  2VT5 A;  4MJO A;  4N6D A;  5J16 A;  1NUW A;  5J1D A;  4MMP A;  4DI3 D;  2DE3 A;  4GWS A;  5DW8 A;  3E78 A;  2FIE A;  4PCD A;  3GYY A;  4H45 A;  4P9K A;  1NV1 A;  4P47 A;  3RPL B;  1FBD A;  4MNP A;  1NV3 A;  4F19 A;  3B50 A;  4NX1 A;  1K9Z A;  1LBV A;  1YZ0 A;  4UAB A;  3IFC A;  4AS5 A;  1NV2 A;  4NHB A;  4PDH A;  2Q74 A;  4X9T A;  5T3J A;  1FPI A;  1K9Y A;  1NUZ A;  4NQ8 A;  1IMB A;  2OWZ A;  4NAP A;  2Y5L A;  1FBG A;  2PFY A;  3T0J A;  1BK4 A;  2F3D A;  2WYP A;  2QVU A;  1FPJ A;  3LV0 A;  4G61 A;  4NN3 A;  1FPG A;  1FBH A;  3ISP A;  4N6K A;  4N8G A;  1FBP A;  4OAN A;  1KA0 A;  2CZI A;  2BJI A;  2FHY A;  2OX3 A;  5F24 A;  2HZL A;  4HE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...