4N92A

Crystal structure of beta-lactamse penp_e166s
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
256
structure length
256
Chain Sequence
DDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFSPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Perturbing the General Base Residue Glu166 in the Active Site of Class A beta-Lactamase Leads to Enhanced Carbapenem Binding and Acylation
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
molecule keywords Beta-lactamase
total genus 90
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4n92A00
3V50A 1Q2QA 4KENB 4UA9A 1JWVA 5EPHA 2ZLYA 2ZQAA 3W4OA 5A92A 2QMIA 1MXOA 4O7DA 3GV9A 5TFQA 3ISGA 3ITBA 3BEBA 3WS2A 4PM9A 5CEBA 2HDUA 3G31A 2WGVA 3G34A 2EX9A 2DNSA 4GB7A 4WYYA 1KE4A 2J9PA 5EVIB 2J8YA 1ESIA 4R3BA 1L0DA 5HL1A 1BT5A 4OONA 1BZAA 2V20A 1K54A 4BL2A 4E3JA 4K0WA 3WS0A 1XP4A 1BTLA 1ES5A 1YLZA 4GOGA 4BQMA 1DY6A 3SH7A 3CMZA 1N9BA 5CRFA 5HAQA 2QZ6A 1ALQA 1MBLA 3PTEA 4WEJA 5CGWA 4RX3A 2Y2PA 1ZG4A 1NXYA 4OQIA 1IKIA 3CJMA 4LCMA 2C6WB 4RVAA 4N92A 4GKUA 4GDNA 5GLDA 3NDEA 4KG6A 1MWTA 1YLYA 1ONGA 4OQHA 4WZ4A 1K56D 1NJ4A 4MBFA 4EBPA 4P85A 5FQIA 4E3LA 3PBTA 4R1GA 2ZMAA 3UPPA 4KZBA 5GHZA 4DXBA 4QD4A 4MLLA 4HBUA 4C6YA 2WGWB 4OPRA 3UY6A 2HDQA 1MWRA 5FQQA 4UAAA 3QHYA 4ZAMA 3C4OA 5M19A 5EVID 5DTSA 1FQGA 4EBLA 1XA7A 1MWUA 1K25A 3ZFZA 4U3TA 3HLDA 5I94A 2XDMA 2HP5A 3V39A 2ZQCA 1WYCA 4CJNA 2G2UA 1KDWA 2ZC5B 3HLEA 4OOLA 1O7EA 1PI4A 4OP8A 4GD8A 1W8YA 3NC8A 4RX2A 2WKIA 2RL3A 1M40A 1RGYA 4KZ5A 5EECA 3OCLA 1HZOA 4OP5A 4WZ5A 2A49A 3WS5A 1S6RA 3BFCA 2ZC3B 3EQVA 1ESUA 2WK0A 4R4SA 3V3RA 2Q9MA 2XF3A 3OC2A 4OPQA 4FH4A 1E4DA 2WAEA 2EFXA 3C4PA 4E6WA 1E3UA 4EQIA 1H8YA 5EUAA 3IXGA 1K4FA 5AQ7A 4X56A 3HLBA 5D3OA 5TGFA 4KZ8A 3GR2A 1S0WA 3IF6A 4OLGA 5A93A 1H8ZA 2PU4A 3DTMA 4S2JA 2ZC6B 2BG1A 5E2HA 3BM6A 3DWZA 1K57A 1PZPA 1G68A 2Z2LB 2Y2NA 4IBXA 4QHCA 2ZJ9A 1MY8A 2Z2MB 3MXRA 1IELA 5KZHA 4LV2A 1M6KA 4H8RA 3VSKA 5EOOA 5M1AA 4R23A 4E3KA 1NZOA 4Z9QA 5KSCA 4KG2A 3O3VA 5CHJA 1XGIA 3G32A 1KGGA 1JWZA 1C3BA 5FI2A 4Y0UA 3EQUA 4OQ0A 1GCEA 5FQJA 4DKIA 5JYPA 1ZKJA 2IWDA 3DW0A 2FFYA 1JVJA 4KZ4A 4L0LA 2XD1A 2XH9A 4MBKA 5DF7A 1SCWA 3WWXA 3UPNA 1SDEA 3HLFA 4QB8A 5E2FA 1JWPA 3N4IA 1YLPA 4DDYA 1YQSA 1CEGA 2XR0A 3VP0A 1QMFA 4HESA 4DE0A 4U0TA 5F1GA 3WRTA 3NBLA 3PBRA 1K55C 1I2SA 1LL5A 4JF5A 4R0QA 5CTMA 5FDHA 4E6XA 4WM9A 3G2YA 3OPPA 5CGSA 3WS1A 1LL9A 4E3IA 5CGXA 3VP3A 5DVAA 3V5MA 3HLGA 4DE2A 2H0TA 2EXBA 3BFDA 2OSUA 3G2ZA 3G30A 2EX2A 1K6SA 3HLCA 4ZDXA 1PIOA 1J9MA 1GHMA 3OPRA 1W8QA 3M6BA 3MKEA 1NYYA 2Y55A 1CI9A 1KGEA 3LY3A 3M2JA 1BLSA 1ES2A 3E2KA 3NDGA 4JF4A 1NZUA 4JXSA 1K38A 1SDNA 2Y2LA 2Y2JA 4YFMA 4S2OA 5FA7A 2WGIA 3IXDA 1SHVA 4ZJ2A 3O88A 4B4ZA 4DE1A 4N1HA 3UDXA 4ID4A 1L2SA 1TDGA 5CHUA 5HARA 2EXAA 1KE3A 1FCNA 1L0EA 1EWZA 3C7VA 3FWLA 5GHYA 1XGJA 3LEZA 1L0GA 4D2OA 2WKEA 1WYBA 2X01A 2A3UA 1IYQA 1K4EA 1KVLA 5FQKA 4KQRA 1PI5A 2Y4AA 3TG9A 4IVIA 4OVDA 2H5SA 1JTGA 1GHIA 3HREA 4ZTKA 5J8XA 4YINA 3UO9A 1U60A 5FQMA 1NRFA 1L0FA 4C3QA 1KVMA 4OH0A 3PBNA 3HUOA 2GDNA 3PBSA 3WRZA 3PBOA 3M6HA 4IBRA 4GN2A 1KE0A 4MBHA 3UN7A 3A3EA 3IWQA 3W4PA 2ZQ9A 3ZVTA 4JXWA 3UDIA 4F94A 2IWCA 5FAPA 5HAPA 3M2KA 3ZCZA 2EFUA 1LI9A 1ES3A 3P09A 3Q7ZA 2E8IA 4NETA 4C75A 3IT9A 4OLDA 2Y2IA 1LI0A 1PW1A 3QNCA 1K54C 3GQZA 2CC1A 3SS5A 4X69A 1MPLA 5CECA 1MKIA 3A3JA 3UE3A 1PWGA 1XXMA 3UPOA 2OLUA 1JTDA 1E25A 4HBTA 2Y2GA 4BENA 1FSWA 5DTKA 1YMXA 4E3NA 2ZC4B 4OPZA 4X53A 5E2GA 4WBGA 3ZDJA 4RYEA 3MFDA 3N7WA 5IHVA 3P98A 4PM5A 1LHYA 4R3JA 3MBZA 3Q7VA 2ZD8A 4LCLA 4K0XA 3A3IA 4X6TA 1H5XA 4N9LA 4IEDA 4S2IA 1YLWA 2X71A 5FI7A 3VP4A 5M18A 3IWOA 5JYOA 1HD8A 3SOIA 3VOZA 4KQOA 1CK3A 4KZ6A 5GHXA 1XPBA 2XEPA 3Q1FA 3OPLA 4PM7A 4OKPA 3IXBA 3RXXA 3MXSA 4S2LA 4E3OA 1ONHA 5CTNA 2OLVA 3ZG9B 2FFFB 2XFSA 4Y7PA 2HP6A 3CG5A 1BLPA 1GA0A 4QJGA 4CPKA 3D4FA 3S1YA 5HAIA 1E3UD 4EWFA 3FYZA 1YM1A 3BFFA 5EVIA 3N8LA 4S2MA 3NY4A 1MWSA 5HW3A 3AGEA 3S22A 4QY6A 2VGJA 4KZ3A 4Y0TA 2WZXA 3RXWA 1W5DA 4WELA 1YT4A 2PBYA 4WZ5C 1HVBA 3ZNTA 3GMWA 3FKWA 4KZAA 1RP5A 3SH9A 1DJBA 3IH9A 4DE3A 4LV1A 1VM1A 4WMCA 4QY5A 4M3KA 1ES4A 3FZCA 3DWKA 5AQAA 4BL3A 3VP2A 1K57C 1IYSA 4KZ9A 3PBQA 5FQ9A 3SH8A 3IHBA 4B88A 4KZ7A 1QMEA 3TSGA 3I7JA 1BULA 1WE4A 3IF6C 3ZVWA 1GA9A 1IKGA 3LY4A 5CERA 2HP9A 2Y91A 1SKFA 2Y59A 4XUXA 3JYIA 4P6BA 3HL9A 4DXCA 1CEFA 1XA1A 1I2WA 4GD6A 3VFFA 5GLAA 3NCKA 5EVIC 1N4OA 2PU2A 1DJCA 4Y0OA 1FSYA 1PWDA 3G35A 2G2WA 3BYDA 3LO7A 3N6IA 4PMAA 3UE1A 2OV5A 5FASA 4UHUA 1TVFA 3B3XA 4HEFA 1PWCA 3MKFA 4S2PA 1NY0A 5CHMA 2VGKA 4OOYA 5GLCA 3Q07A 4FD8A 4GNUA 2B5RA 5HX9A 3MZDA 4PPRA 5FATA 5G18A 4R4RA 3W4QA 3G4PA 2R9WA 4RA7A 4BLMA 2XD5A 1VQQA 3IF5A 4ZJ3A 3OPHA 3AGDA 4PM8A 4A5RA 3HVFA 3FV7A 1ERQA 2WUQA 2JC7A 1PZOA 4S2KA 1Y54A 2HDSA 4X68A 5CXWA 5DF9A 5FSRA 3V3SA 4JXGA 5E2EA 3ZG8B 3N8SA 1TDLA 2P9VA 3ZG0A 1W7FA 4P87A 3ZG5A 3SS4A 3CZDA 2P74A 2I72A 2IWBA 3OCNA 4KQQA 5BOHA 4B4XA 1FOFA 1PYYA 5DTTA 4FCFA 5CEDA 5HFOA 2Y2MA 4LENA 3BFEA 1RCJA 2WAFA 5KSHA 5EVLA 1GHPA 5EOEA 3GSGA 3MZFA 2DRWA 4BJPA 5F82A 1FCOA 4N1XA 4UA7A 4KG5A 2ZM0A 3FKVA 1EROA 2ZM2A 4NK3A 2RCXA 3ZG7B 3VMAA 2WADA 1CI8A 3IWIA 4PM6A 4JXVA 3UNWA 1KDSA 3W8KA 1FR6A 2JCHA 5KMWA 4DRTA 3E2LA 1KGFA 3IH8A 2XQZA 1XX2A 2X02A 4JF6A 2P9VB 4JPMA 1K56A 1BUEA 5DF8A 2QPNA 1YLJA 5F83A 5F1FA 2EX8A 3QNBA 3LCEA 5FAQA 4EUZA 1PW8A 2JBFA 4FH2A 3IF6B 4MNRA 2XFTA 2ZQ7A 3IHAA 5GLBA 2ZC7A 4EBNA 3BRMA 3BLSA 3BLMA 4S2NC 1EI5A 1W79A 1K6RA 4IVKA 3A3FA 3BECA 3C7UA 3IQAA 1YLTA 4ZBEA 4XXRA 2ZM8A 1G6AA 2V2FF 4N9KA 2HPBA 3MZEA 2EX6A 4U0XA 4XUZA 1XKZA 3GRJA 2HDRA 4OPYA 1AXBA 5A91A 2DCFA 3GVBA 4X55A 2V1ZA 3ZNYA 2J7VA 5TR7A 3UE0A 1RGZA 1IEMA 2UWXA 4DDSA 2ZQDA 3UDFA 1HTZA 3HLWA 4FSFA 3IXHA 3AGFA 4ZJ1A 4OQGA 1LLBA 4OOMA 1IYOA 2XGNA 2Y2HA 2H10A 1BSGA 3VSLA 4WEKA 4BD0A 4K91A 1Z6FA 4JKTA 1O07A 2JE5A 5FI6A 2XK1A 3C5AA 4UA6A 3Q81A 3O86A 1TEMA 3HUNA 4GDBA 5U47A 4S2NA 4WMCD 2J9OA 3BFGA 1ERMA 4E3MA 3Q7VB 5A90A 1NYMA 2Y2KA 3Q82A 1ZG6A 5E43A 3S4XA 1K55A 5AQBA 5L2FA 2C5WB 3HBRA 1IYPA 3O87A 1ZC2A 2Y2OA 4JBFA 1DJAA 1BLHA 4MEZA 5EE8A 5AQ9A 5GL9A 4BD1A 4EV4A 1FCMA 3NI9A 3VP1A 3PAEA 1FR1A 2WYXA 2ZQ8A 2H0YA 3A3DA 4P0MA 3N8RA 3VFHA 2WKHA 1Q2PA 3RJUA 2Y2QA 4JLFA 3OZHA 4DF6A 2WZZA 1BLCA 2WGWA 4GZBA 4QU3A 5FAOA 1OMEA 3ZHHA 3VOYA 1YMSA 3ITAA 3PAGA 4LV3A 3WS4A 4LV0A 3GTCA 2XLNA 2BLSA 3SS3A 2Q9NA 3HUMA 1I5QA 3NIAA 3TOIA 2R9XA 3ZGAB 4Q8IA
chains in the Genus database with same CATH superfamily
5HPIA 3KSHA 4KENB 4HOIA 4UA9A 5FDSA 2ZLYA 5TFQA 4LFUA 3WS2A 4WYYA 4R3AA 3SZTA 2V20A 4BL2A 1TS0A 3CWFA 3WS0A 2L1MA 1XP4A 1BTLA 3NJAA 5HAQA 1ALQA 3PTEA 3IBJA 4GW9A 2Y2PA 1ZG4A 4OQIA 4D60A 2C6WB 3UMEA 1MWTA 4Z1WA 4OQHA 4Y13A 1XJ2A 1ZHHB 4E3LA 4R1GA 3UB9A 2ZOIA 5GHZA 3B47A 1T18A 5FQQA 4UAAA 3QHYA 4ZAMA 1P0ZA 3B33A 3E4QA 5DTSA 1K25A 3U2AA 4XT2A 2PYRA 2XDMA 2HP5A 4GJ4A 3V39A 3HLEA 5F6AA 2V0UA 4GD8A 2ZBBA 4RX2A 2QWSA 3F1NB 2A49A 1S6RA 4JGQA 1X0OA 1ESUA 4R4SA 4OPQA 2WAEA 1T19A 1LSWA 4X56A 5D3OA 5A93A 1H8ZA 5E2HA 2JKGA 2Z2LB 2P08A 2Y2NA 1MY8A 3LIBA 1IELA 5KZHA 1M6KA 3IS2B 4R23A 4E3KA 3H82A 4KG2A 3O3VA 3G32A 4Y0UA 3EQUA 1GCEA 4DKIA 1JVJA 3IX8A 4F3LB 4QB8A 3N4IA 1FILA 3VP0A 3D72A 3RH8B 5CTMA 4WM9A 3EEAA 3WS1A 1Z09A 2OSUA 3G2ZA 2VX8A 1OTBA 5L10A 1CI9A 1KGEA 3E2KA 1K38A 2WGIA 4ZJ2A 4B4ZA 1TDGA 5L09A 1KE3A 3V67A 1FCNA 1DP6A 1L0GA 4CLCA 2Y4AA 3TG9A 1D1JA 3MQOA 1NRFA 3DTIA 1KVMA 5HD5A 4OH0A 3PBNA 4LRXC 3MR0A 2E8JA 3TRCA 1SZVA 1TD5A 3UDIA 2IWCA 3M2KA 5DKLA 2HV1A 4LPZA 2E8IA 3IT9A 2Y2IA 1LI0A 2CC1A 5CECA 5F69A 3MXQA 2B02A 4BENA 1FSWA 5DTKA 1IOUA 1VB6A 4NXGA 2VV7A 3T12B 2A2LA 3N7WA 4PM5A 4X6TA 3A0RA 1YLWA 5FI7A 5M18A 4K08A 3IWOA 4HJ4A 3SOIA 3VOZA 4KQOA 5GHXA 1HLUP 3C30A 3EOIA 3VE4A 3CG5A 1BLPA 1GA0A 3SW1A 2YKHA 1YM1A 5EVIA 5DKKA 1P9WA 2JHEA 1W5DA 1YT4A 1ODVA 3ZNTA 3SH9A 4LV1A 4HHDA 5AQAA 1KOUA 1K57C 4KZ9A 3PBQA 5AJGA 3FPVA 2Y79A 4FOFA 2V8FA 3CUEC 1GA9A 5CERA 4PKYA 3JYIA 4DXCA 2PR6A 1N4OA 1FSYA 3G35A 3BYDA 2OV5A 2PD7A 3MKFA 2VGKA 4OOYA 5J3WA 5G4ZA 4WUJA 5G18A 1T1CA 3G4PA 2XD5A 4PM8A 1Y54A 5DF9A 3ZG8B 1TDLA 2P9VA 4P87A 1XFQA 3ZG5A 3CZDA 3OCNA 4KQQA 1OPXA 1FOFA 3E0YA 2JKRI 3O5YA 5HFOA 2Y2MA 4ESPA 3LR3A 3BFEA 4Y17A 1GHPA 2DRWA 2W27A 3FKVA 1CI8A 4PM6A 5TBMA 3UNWA 4HH2A 3W8KA 1FR6A 1S4SA 1KGFA 3IH8A 4CLCE 2XQZA 4ETZA 1XX2A 2X02A 4JF6A 2P9VB 1K56A 1BUEA 3MJQA 3QP6A 4FH2A 2B95A 2JN7A 4HNBA 2ZQ7A 4S2NC 1CQAA 4IVKA 3FPWA 1S66L 3IQAA 4ZBEA 4XXRA 2ZM8A 3BW6A 3T4SA 2L4RA 2CMNA 3GRJA 4UEYA 1K0KA 1AXBA 5A91A 2A24B 4X55A 5J4EA 1CF0A 3RTYA 2J7VA 3T1SA 1RGZA 2UWXA 4EQ1A 1OJGA 4OQGA 1XFNA 3F1PA 2XGNA 2Y2HA 4WEKA 4JKTA 4ME4A 3Q81A 5C5KA 4GDBA 5U47A 2PT7A 4WMCD 4Q0JA 3IX3A 3ULFA 1ZG6A 3T4OA 2VV6A 1IYPA 3O87A 1ZC2A 4JBFA 5AQ9A 4EV4A 4G3WA 3NI9A 3PAEA 1FR1A 1GSVA 2H0YA 4P0MA 3VFHA 2WKHA 2WZZA 4QU3A 3VOYA 2ZL1B 2BLSA 3SS3A 4NXEA 2XA7M 4EEUA 3NIAA 1Q2QA 3G6OA 3NHQA 1PRQA 5A92A 4CLCC 3QP1A 4GS9A 3ITBA 5CEBA 3C38A 3G34A 2DNSA 2J9PA 1L0DA 2KDKA 1MZUA 2VJWA 4ARZB 1DP8A 2BASA 1H8MA 2VK3A 4LLOB 1DY6A 3TE8A 5CRFA 2QZ6A 4WEJA 4P6ZS 2BTFP 4N92A 2W1TB 2GJ3A 3NDEA 4KG6A 3T1QB 1ONGA 1K56D 4EBPA 5FQIA 4KZBA 4MCWA 3MSHA 4MLLA 2K2NA 4OPRA 1XJ6A 2HJ9C 5M19A 5EVID 4CLCD 4F3LA 1MWUA 3ZFZA 1WYCA 2G2UA 2D02A 1KDWA 3HCYA 4O0PA 4EU0A 1O7EA 3UB5P 1PI4A 2MJ6A 3NC8A 1RGYA 3VV4A 1HZOA 4R6LA 4IUHA 4WZ5A 3BFCA 2M1CA 2ZC3B 1YSQA 3EQVA 3MS6A 1YSPA 2WK0A 2EFXA 4L9EA 5EUAA 5TGFA 3OLOA 4KZ8A 3CITA 4OLGA 4XT2B 2VGLM 5EM1A 1K57A 3CAXA 5EVEA 3T1XA 4YWZA 2Z2MB 3MXRA 1YAXA 4H8RA 3VSKA 5FL3A 3FC7A 3CI6A 5EFWA 4Z9QA 5KSCA 3H7WB 3VOLA 2G7UA 1ZKJA 4Q0IA 2IWDA 2FFYA 1W63Q 3EGDC 1SCWA 3HLFA 4X1MA 3D9YA 3K3CA 2XR0A 1QMFA 1OT9A 3PBRA 3T1RA 4R0QA 4E6XA 2I9VA 3G2YA 3OPPA 1EW0A 1SKOA 1LL9A 3VP3A 3HLGA 2OAP1 2EXBA 3BFDA 5EM0A 3HLCA 1K6SA 3P7NA 2XROA 1W8QA 1NYYA 3LY3A 3M2JA 1NZUA 5AVEA 2Y2LA 2Y2JA 4S2OA 3IXDA 4DE1A 3UDXA 1L2SA 5CHUA 5HSQA 5DFYA 3E4OA 3FWLA 5GHYA 1WYBA 2AVXA 2A3UA 5FQKA 2OWJA 4KQRA 3HREA 5J8XA 1XJ3A 4X1LA 5FQMA 4LRYC 1L3LA 2V0WA 2JKTI 2GDNA 3PR6A 2PYPA 3WRZA 4IBRA 4GN2A 1KE0A 3UN7A 2ZQ9A 1PFLA 3ZVTA 2LB5A 3KSGA 2EFUA 1LI9A 3Q7ZA 4IUKA 4C75A 4OLDA 3QNCA 4O01A 1K54C 1T1BA 4HH3A 3T50A 3A3JA 1XXMA 4I38A 2OLUA 2KLIA 3UE6A 3KYEA 4E3NA 2P04A 4ZRRA 1Y4OA 4RYEA 4EW7A 5IHVA 4KQDA 4R3JA 2ZD8A 4LCLA 4K0XA 4DN0A 4HI4A 4I39A 4WF0A 1H5XA 4IEDA 3VP4A 5JYOA 2XEPA 2M7UA 4OKPA 3IXBA 1ONHA 5CTNA 2OLVA 2XFSA 4Y7PA 3CUEA 4NG2A 2HP6A 2VZWA 4QJGA 4CPKA 3S1YA 5HAIA 4R70A 3BFFA 3N8LA 3NY4A 3S22A 3LIAA 4QY6A 4WZ5C 5HDDA 1TF1A 4DE3A 3S7PA 4QY5A 3FZCA 3DWKA 3VP2A 1F2KA 5J7EA 2PDRA 3BJNA 4KZ7A 2O9CA 1QMEA 3CPTA 3CPTB 3LY4A 1SKFA 2Y59A 4XUXA 2QHKA 4P6BA 5HWWA 2VKSA 1I2WA 4GD6A 5HZHA 2H28A 2KOIA 1NRJA 4GCZA 1DJCA 2QJ7A 3UE1A 1TS7A 4Y5FA 5FASA 4UHUA 3B3XA 3EEHA 3KSIA 2O9BA 1NLYA 2B5RA 3MZDA 5HDSA 4R4RA 4WL9A 3JVUA 3W4QA 2R9WA 1VQQA 3RFBA 1N9LA 1G6OA 1ERQA 2JC7A 1PZOA 5CXWA 4MDZA 1G28A 4X68A 3U4LP 3LIEA 4JXGA 5EV0A 5E2EA 5CX7A 1W7FA 2P74A 2I72A 3LEQA 5BOHA 4L9FA 3LI9A 1PYYA 2INWA 5AVFA 5KSHA 1RCJA 4MN5A 4QPRA 4BJPA 4N1XA 4KG5A 4NK3A 3IWIA 3IX4A 4JXVA 1KDSA 2JCHA 1LL8A 1N9NA 4JPMA 4EERA 3F1NA 3T4TA 1YLJA 3UMDA 3LCEA 1PW8A 2JBFA 5IS1A 3KO6A 4EBNA 3BLSA 3FG8A 3B42A 3BQAA 3C7UA 5MC7A 3EWKA 3NOTC 2HDRA 3IS2A 4OPYA 2V1ZA 5G4YA 3ZNYA 1IEMA 4DDSA 4PHTA 3UDFA 3NULA 3IXHA 4ZJ1A 4MMNA 1LLBA 1IYOA 2H10A 3VSLA 2JE5A 5FI6A 3CHWP 4UA6A 1TEMA 1S1YA 2EWVA 3CLOA 3Q7VB 2Y2KA 3Q82A 5EE8A 1F5MA 2W1TA 1DJAA 5GL9A 1FCMA 4JLFA 3OZHA 3D3OA 3ZHHA 5DJUA 1YMSA 3PAGA 3QP5A 5L8MA 3BY8A 4Q8IA 3V50A 4BBUA 3LYXA 2O99A 1JWVA 5EPHA 2ZQAA 3W4OA 2QMIA 4O7DA 1ZTUA 3GV9A 3ISGA 3BEBA 4BBVA 3G31A 3KYQA 2WGVA 4GB7A 1KE4A 4R3BA 1NLZA 5FEFA 3LUQA 3KYZA 2HGVA 4K0WA 4GOGA 4BQMA 2K31A 3SH7A 3CMZA 4RX3A 1T1AA 4O8GA 1IKIA 3CJMA 4LCMA 4MN7A 3QP8A 5GLDA 3MQ0A 2HF6A 4WZ4A 4MBFA 4P85A 2J3TD 3UPPA 4DXBA 2QKPA 2W3FA 4KUKA 2WGWB 1MWRA 2EA9A 2XA7S 2O0YA 3C4OA 3F1PB 1FQGA 1VETA 4U3TA 1H0MA 1OTIA 2ZQCA 3TJZC 4CJNA 2ZC5B 2ZOHA 4M4XA 1W8YA 4HP9A 3MMHA 2WKIA 2RL3A 4KZ5A 3OCLA 4WLAA 3HJKA 3V3RA 2XF3A 4FH4A 2ZL1A 1E3UA 4EQIA 1H8YA 1K4FA 5AQ7A 3HLBA 3IF6A 3LI8A 5HDCA 2PU4A 3DTMA 2ZC6B 2BG1A 1D7EA 3BM6A 3DWZA 4FUWA 1PZPA 2PR5A 4HJ6A 4IBXA 4QHCA 2ZJ9A 2JKFA 4LGWA 4FTXA 2V8CA 5EOOA 5M1AA 2JKTM 5CHJA 5FI2A 3MF0A 4OQ0A 5FQJA 5JYPA 2XH9A 1A0KA 5DF7A 3WWXA 3UPNA 3OOVA 3LR5A 1JWPA 3H9WA 1YLPA 3UB8A 5F68A 4DE0A 5F1GA 1K55C 1LL5A 4JF5A 5FDHA 1AWIA 2JKRM 3W2ZA 4E3IA 5IU1A 3V5MA 1D06A 2H0TA 3G30A 4H6JB 2EX2A 1PIOA 3MKEA 2Y55A 3NDGA 1BLSA 3SH8A 3E4PA 4JXSA 4YFMA 3O88A 4N1HA 4G3VA 4ID4A 4B93A 2M7VA 5HARA 2EXAA 3C7VA 1XGJA 2W3HA 1IYQA 1K4EA 1SKOB 4IVIA 4OVDA 3LIFA 2J3TC 1JTGA 4ZTKA 4YINA 5HWTA 3L7HA 1U60A 3LFVA 4C3QA 3K2NA 3HUOA 3LR0A 3PBSA 3M6HA 4MBHA 3A3EA 3IWQA 3S7OA 2J3WA 4JXWA 4F94A 5FAPA 5HAPA 5KIZA 1F9IA 4NETA 3GQZA 4JGRA 4I3AA 4PAUA 4X69A 1MKIA 5LBRA 3UE3A 2WKQA 4HBTA 1JTDA 1E25A 2Y2GA 1YMXA 4OPZA 1YPRA 5E2GA 2ZMFA 3BWLA 2OAQ1 1OTEA 3MFDA 2W3EA 3A3IA 5HL6A 4S2IA 2X71A 2QYBA 3DTKA 1LSVA 4UQIS 1S4RA 1XPBA 3E98A 3PHYA 3MXSA 3RXXA 3R7WB 2VA0A 3PYPA 2FFFB 1V9YA 2GX5A 3IBRA 3JPUA 3C2WA 2K7SA 2VGJA 4Y0TA 1ACFA 3RXWA 2PBYA 3GMWA 3FKWA 4KZAA 1DJBA 4WMCA 1IYSA 1CJFA 5L07A 3IHBA 3TW8A 3I7JA 1BULA 2HP9A 2J80A 3HL9A 3DBAA 3MQQA 4JGPA 3NCKA 5EVIC 2PU2A 1PWDA 2GNXA 4HEFA 4S2PA 5GLCA 3Q07A 4GNUA 2W1RA 5FATA 1VHMA 4ZJ3A 3IF5A 3OPHA 4A5RA 3HVFA 3FV7A 2WUQA 2HDSA 5FSRA 5HWVA 3R4KA 3N8SA 2R78A 4IHQA 1UWNX 3SS4A 3BQ8A 2IWBA 3PXPA 4B4XA 1OTAA 3UB7A 4IJGA 3T4QA 3GSGA 1FCOA 4CQHA 1VEUA 2ZM0A 1EROA 2HJEA 2V9AA 2VLGA 2HZ5A 3E2LA 4DJ3A 3ZQ5A 5FAQA 2VEAA 4EUZA 2EWWA 4MNRA 3IHAA 5GLBA 4HIAA 1EI5A 1W79A 1K6RA 3A3FA 3BECA 4LRZE 1YLTA 2V1BA 2V2FF 4XUZA 4N9KA 2EX6A 1MKMA 2A24A 2DCFA 3GVBA 2IA2A 5TR7A 4X25A 2ZQDA 3HLWA 4FSFA 3AGFA 4Q0HA 4OOMA 1BSGA 1Z6FA 1O07A 3O86A 3HUNA 4S2NA 1ERMA 1NYMA 5L2FA 1K55A 5AQBA 2C5WB 1OJ5A 3C8CA 2Y2OA 4GS9B 1BLHA 4MEZA 4BD1A 2O9AA 2WYXA 1GSXA 1OTDA 3N8RA 2Z6DA 2Y2QA 3H7WA 3P01A 2WGWA 4MN6A 1XJ4A 1H3QA 1OMEA 5TJJA 3A0SA 2W0NA 4LV0A 3GTCA 2Q9NA 2XSSA 1I5QA 3DAVA 4NKPA 2R9XA 1IFQA 2LB9A 4QWOA 1MXOA 5I5LA 3F1OB 1JNUA 4PM9A 2HDUA 2NUTC 3R7WA 4DJ2A 2EX9A 5EVIB 4P6ZM 2J8YA 1ESIA 5HL1A 1BT5A 4OONA 1BZAA 3DTEA 1K54A 3NOUC 4E3JA 4YNRA 1YLZA 1ES5A 3QP4A 4Y15A 1N9BA 1MBLA 5CGWA 3ZYTA 1NXYA 4HQAA 4G3KA 2DMWA 4RVAA 4GKUA 4GDNA 2KX6A 1YLYA 1NJ4A 1LT0A 1WA9A 3PBTA 2ZMAA 4B9OA 2PRFA 4QD4A 4C6YA 4HBUA 5F5YA 3UY6A 2HDQA 3HJIA 4II7A 3LR4A 4EBLA 2V1AA 1XA7A 2QJ5A 3MFXA 3HLDA 5I94A 4E04A 2B18A 4OOLA 3S7QA 4OP8A 5TBMB 1M40A 5EECA 4L9GA 4OP5A 5HD3A 3WS5A 1OT6A 1NWZA 2Q9MA 3OC2A 1E4DA 2ACGA 3C4PA 4E6WA 1P97A 3IXGA 3GR2A 1S0WA 4S2JA 1G68A 2YKFA 4KUOA 4LV2A 3BY9A 1NZOA 3NOPC 1GSWA 1XGIA 1KGGA 1JWZA 1C3BA 3DW0A 4KZ4A 4L0LA 2XD1A 4MBKA 1SDEA 5E2FA 3GECA 4DDYA 1YQSA 1CEGA 4HESA 4U0TA 1TS6A 3WRTA 1UGUA 3NBLA 1I2SA 1J3WA 5CGSA 4GHIA 5CGXA 5DVAA 4DE2A 2ZMVA 4ZDXA 1J9MA 1GHMA 3OPRA 3M6BA 2NUPC 2Z6CA 1ES2A 3KSFA 4JF4A 1SDNA 5FA7A 1SHVA 4PKYG 1F98A 4I5SA 2FZ0A 1L0EA 1VETB 1EWZA 4Y2FA 4HJ3A 3LEZA 4D2OA 2WKEA 2X01A 1KVLA 1PI5A 2W3GA 4GHIB 4BWIA 2H5SA 1GHIA 4NXBA 4JGOA 3UO9A 2OOLA 1L0FA 5DJTA 2P7JA 3PBOA 3ICYA 3W4PA 4HP4A 5IT5A 5K5BA 3ZCZA 1ES3A 3P09A 1PW1A 1MC0A 4WN5A 3SS5A 3QP2A 1MPLA 1PWGA 1Y28A 4H6JA 3UPOA 2ZC4B 4RQ9A 3L9KA 4X53A 4WBGA 3ZDJA 1PNEA 2PHYA 3P98A 1LHYA 3MBZA 3Q7VA 1G5UA 1DP9A 1VEUB 4N9LA 4EXOA 1HD8A 1S1ZA 2Q0OA 1CK3A 4KZ6A 4PM7A 3Q1FA 3OPLA 4S2LA 4GLQA 3S7NA 3ZG9B 3OBFA 2OWHA 2PBDP 2Y8HA 3D4FA 1E3UD 4EWFA 3FYZA 4HY8A 4S2MA 1MWSA 5HW3A 3AGEA 4EETB 4KZ3A 2VV8A 4AFIA 2WZXA 3T4JA 4BBTA 4WELA 1HVBA 1RP5A 3IH9A 4NEED 5DFXA 1VM1A 3A0VA 4EUVA 4M3KA 3VE3A 1ES4A 4BL3A 5FQ9A 2GZAA 4B88A 3TSGA 1WE4A 3IF6C 3ZVWA 1IKGA 2Y91A 4Y3IA 1CEFA 1XA1A 3VFFA 5GLAA 5FEGA 1TS8A 4Y0OA 4EESA 3N6IA 2G2WA 1DRMA 3LO7A 1LSXA 4PMAA 3NECA 1TVFA 2WKPA 3K3DA 1PWCA 1NY0A 5CHMA 4FD8A 2WKRA 5HX9A 1P9RA 4PPRA 4CLCB 4ETXA 4RA7A 4BLMA 1V9ZA 4I3IA 3AGDA 2XRNA 4S2KA 4E3OA 3V3SA 4YOFA 1FIKA 3ZG0A 1BYWA 4R38A 2FH5A 4EEPA 5DTTA 4FCFA 5CEDA 4LENA 3LGOA 2WAFA 5EVLA 5EOEA 3MZFA 5F82A 4UA7A 2ZM2A 2RCXA 3ZG7B 3VMAA 2WADA 1UWPX 3EGXC 5KMWA 4DRTA 4I3JA 4NXFA 1W63M 4ARZA 5DF8A 2QPNA 1YKDA 5F83A 5F1FA 2EX8A 3QNBA 3IF6B 2XFTA 2ZC7A 5A8BA 3BRMA 3BLMA 5HPFA 2PAVP 1G6AA 2HPBA 2L0WA 3MZEA 4U0XA 1XKZA 2W3DA 3F1OA 3UE0A 3KX0X 1HTZA 2VGLS 1N9OA 4BD0A 4K91A 3UB6A 1STZA 4DMZA 4UQIM 2XK1A 3C5AA 3T4KA 2UV0E 2PD8A 2J9OA 3BFGA 4E3MA 5A90A 3S4XA 5E43A 3LICA 3HBRA 3VP1A 2ZQ8A 3A3DA 2D01A 4BMWA 1Q2PA 3RJUA 3JVVA 4DF6A 1S67L 1BLCA 3H82B 3LIDA 3T4LA 4GZBA 5FAOA 3ITAA 3WS4A 4LV3A 2XLNA 3GDIA 3HUMA 3TOIA 3ZGAB
chains in the Genus database with same CATH topology
3V50A 1Q2QA 4KENB 4UA9A 1JWVA 5EPHA 2ZLYA 2ZQAA 3W4OA 5A92A 2QMIA 1MXOA 4O7DA 3GV9A 5TFQA 3ISGA 3ITBA 3BEBA 3WS2A 4PM9A 5CEBA 2HDUA 3G31A 2WGVA 3G34A 2EX9A 2DNSA 4GB7A 4WYYA 1KE4A 2J9PA 5EVIB 2J8YA 1ESIA 4R3BA 1L0DA 5HL1A 1BT5A 4OONA 1BZAA 2V20A 1K54A 4BL2A 4E3JA 4K0WA 3WS0A 1XP4A 1BTLA 1ES5A 1YLZA 4GOGA 4BQMA 1DY6A 3SH7A 3CMZA 1N9BA 5CRFA 5HAQA 2QZ6A 1ALQA 1MBLA 3PTEA 4WEJA 5CGWA 4RX3A 2Y2PA 1ZG4A 1NXYA 4OQIA 1IKIA 3CJMA 4LCMA 2C6WB 4RVAA 4N92A 4GKUA 4GDNA 5GLDA 3NDEA 4KG6A 1MWTA 1YLYA 1ONGA 4OQHA 4WZ4A 1K56D 1NJ4A 4MBFA 4EBPA 4P85A 5FQIA 4E3LA 3PBTA 4R1GA 2ZMAA 3UPPA 4KZBA 5GHZA 4DXBA 4QD4A 4MLLA 4HBUA 4C6YA 2WGWB 4OPRA 3UY6A 2HDQA 1MWRA 5FQQA 4UAAA 3QHYA 4ZAMA 3C4OA 5M19A 5EVID 5DTSA 1FQGA 4EBLA 1XA7A 1MWUA 1K25A 3ZFZA 4U3TA 3HLDA 5I94A 2XDMA 2HP5A 3V39A 2ZQCA 1WYCA 4CJNA 2G2UA 1KDWA 2ZC5B 3HLEA 4OOLA 1O7EA 1PI4A 4OP8A 4GD8A 1W8YA 3NC8A 4RX2A 2WKIA 2RL3A 1M40A 1RGYA 4KZ5A 5EECA 3OCLA 1HZOA 4OP5A 4WZ5A 2A49A 3WS5A 1S6RA 3BFCA 2ZC3B 3EQVA 1ESUA 2WK0A 4R4SA 3V3RA 2Q9MA 2XF3A 3OC2A 4OPQA 4FH4A 1E4DA 2WAEA 2EFXA 3C4PA 4E6WA 1E3UA 4EQIA 1H8YA 5EUAA 3IXGA 1K4FA 5AQ7A 4X56A 3HLBA 5D3OA 5TGFA 4KZ8A 3GR2A 1S0WA 3IF6A 4OLGA 5A93A 1H8ZA 2PU4A 3DTMA 4S2JA 2ZC6B 2BG1A 5E2HA 3BM6A 3DWZA 1K57A 1PZPA 1G68A 2Z2LB 2Y2NA 4IBXA 4QHCA 2ZJ9A 1MY8A 2Z2MB 3MXRA 1IELA 5KZHA 4LV2A 1M6KA 4H8RA 3VSKA 5EOOA 5M1AA 4R23A 4E3KA 1NZOA 4Z9QA 5KSCA 4KG2A 3O3VA 5CHJA 1XGIA 3G32A 1KGGA 1JWZA 1C3BA 5FI2A 4Y0UA 3EQUA 4OQ0A 1GCEA 5FQJA 4DKIA 5JYPA 1ZKJA 2IWDA 3DW0A 2FFYA 1JVJA 4KZ4A 4L0LA 2XD1A 2XH9A 4MBKA 5DF7A 1SCWA 3WWXA 3UPNA 1SDEA 3HLFA 4QB8A 5E2FA 1JWPA 3N4IA 1YLPA 4DDYA 1YQSA 1CEGA 2XR0A 3VP0A 1QMFA 4HESA 4DE0A 4U0TA 5F1GA 3WRTA 3NBLA 3PBRA 1K55C 1I2SA 1LL5A 4JF5A 4R0QA 5CTMA 5FDHA 4E6XA 4WM9A 3G2YA 3OPPA 5CGSA 3WS1A 1LL9A 4E3IA 5CGXA 3VP3A 5DVAA 3V5MA 3HLGA 4DE2A 2H0TA 2EXBA 3BFDA 2OSUA 3G2ZA 3G30A 2EX2A 1K6SA 3HLCA 4ZDXA 1PIOA 1J9MA 1GHMA 3OPRA 1W8QA 3M6BA 3MKEA 1NYYA 2Y55A 1CI9A 1KGEA 3LY3A 3M2JA 1BLSA 1ES2A 3E2KA 3NDGA 4JF4A 1NZUA 4JXSA 1K38A 1SDNA 2Y2LA 2Y2JA 4YFMA 4S2OA 5FA7A 2WGIA 3IXDA 1SHVA 4ZJ2A 3O88A 4B4ZA 4DE1A 4N1HA 3UDXA 4ID4A 1L2SA 1TDGA 5CHUA 5HARA 2EXAA 1KE3A 1FCNA 1L0EA 1EWZA 3C7VA 3FWLA 5GHYA 1XGJA 3LEZA 1L0GA 4D2OA 2WKEA 1WYBA 2X01A 2A3UA 1IYQA 1K4EA 1KVLA 5FQKA 4KQRA 1PI5A 2Y4AA 3TG9A 4IVIA 4OVDA 2H5SA 1JTGA 1GHIA 3HREA 4ZTKA 5J8XA 4YINA 3UO9A 1U60A 5FQMA 1NRFA 1L0FA 4C3QA 1KVMA 4OH0A 3PBNA 3HUOA 2GDNA 3PBSA 3WRZA 3PBOA 3M6HA 4IBRA 4GN2A 1KE0A 4MBHA 3UN7A 3A3EA 3IWQA 3W4PA 2ZQ9A 3ZVTA 4JXWA 3UDIA 4F94A 2IWCA 5FAPA 5HAPA 3M2KA 3ZCZA 2EFUA 1LI9A 1ES3A 3P09A 3Q7ZA 2E8IA 4NETA 4C75A 3IT9A 4OLDA 2Y2IA 1LI0A 1PW1A 3QNCA 1K54C 3GQZA 2CC1A 3SS5A 4X69A 1MPLA 5CECA 1MKIA 3A3JA 3UE3A 1PWGA 1XXMA 3UPOA 2OLUA 1JTDA 1E25A 4HBTA 2Y2GA 4BENA 1FSWA 5DTKA 1YMXA 4E3NA 2ZC4B 4OPZA 4X53A 5E2GA 4WBGA 3ZDJA 4RYEA 3MFDA 3N7WA 5IHVA 3P98A 4PM5A 1LHYA 4R3JA 3MBZA 3Q7VA 2ZD8A 4LCLA 4K0XA 3A3IA 4X6TA 1H5XA 4N9LA 4IEDA 4S2IA 1YLWA 2X71A 5FI7A 3VP4A 5M18A 3IWOA 5JYOA 1HD8A 3SOIA 3VOZA 4KQOA 1CK3A 4KZ6A 5GHXA 1XPBA 2XEPA 3Q1FA 3OPLA 4PM7A 4OKPA 3IXBA 3RXXA 3MXSA 4S2LA 4E3OA 1ONHA 5CTNA 2OLVA 3ZG9B 2FFFB 2XFSA 4Y7PA 2HP6A 3CG5A 1BLPA 1GA0A 4QJGA 4CPKA 3D4FA 3S1YA 5HAIA 1E3UD 4EWFA 3FYZA 1YM1A 3BFFA 5EVIA 3N8LA 4S2MA 3NY4A 1MWSA 5HW3A 3AGEA 3S22A 4QY6A 2VGJA 4KZ3A 4Y0TA 2WZXA 3RXWA 1W5DA 4WELA 1YT4A 2PBYA 4WZ5C 1HVBA 3ZNTA 3GMWA 3FKWA 4KZAA 1RP5A 3SH9A 1DJBA 3IH9A 4DE3A 4LV1A 1VM1A 4WMCA 4QY5A 4M3KA 1ES4A 3FZCA 3DWKA 5AQAA 4BL3A 3VP2A 1K57C 1IYSA 4KZ9A 3PBQA 5FQ9A 3SH8A 3IHBA 4B88A 4KZ7A 1QMEA 3TSGA 3I7JA 1BULA 1WE4A 3IF6C 3ZVWA 1GA9A 1IKGA 3LY4A 5CERA 2HP9A 2Y91A 1SKFA 2Y59A 4XUXA 3JYIA 4P6BA 3HL9A 4DXCA 1CEFA 1XA1A 1I2WA 4GD6A 3VFFA 5GLAA 3NCKA 5EVIC 1N4OA 2PU2A 1DJCA 4Y0OA 1FSYA 1PWDA 3G35A 2G2WA 3BYDA 3LO7A 3N6IA 4PMAA 3UE1A 2OV5A 5FASA 4UHUA 1TVFA 3B3XA 4HEFA 1PWCA 3MKFA 4S2PA 1NY0A 5CHMA 2VGKA 4OOYA 5GLCA 3Q07A 4FD8A 4GNUA 2B5RA 5HX9A 3MZDA 4PPRA 5FATA 5G18A 4R4RA 3W4QA 3G4PA 2R9WA 4RA7A 4BLMA 2XD5A 1VQQA 3IF5A 4ZJ3A 3OPHA 3AGDA 4PM8A 4A5RA 3HVFA 3FV7A 1ERQA 2WUQA 2JC7A 1PZOA 4S2KA 1Y54A 2HDSA 4X68A 5CXWA 5DF9A 5FSRA 3V3SA 4JXGA 5E2EA 3ZG8B 3N8SA 1TDLA 2P9VA 3ZG0A 1W7FA 4P87A 3ZG5A 3SS4A 3CZDA 2P74A 2I72A 2IWBA 3OCNA 4KQQA 5BOHA 4B4XA 1FOFA 1PYYA 5DTTA 4FCFA 5CEDA 5HFOA 2Y2MA 4LENA 3BFEA 1RCJA 2WAFA 5KSHA 5EVLA 1GHPA 5EOEA 3GSGA 3MZFA 2DRWA 4BJPA 5F82A 1FCOA 4N1XA 4UA7A 4KG5A 2ZM0A 3FKVA 1EROA 2ZM2A 4NK3A 2RCXA 3ZG7B 3VMAA 2WADA 1CI8A 3IWIA 4PM6A 4JXVA 3UNWA 1KDSA 3W8KA 1FR6A 2JCHA 5KMWA 4DRTA 3E2LA 1KGFA 3IH8A 2XQZA 1XX2A 2X02A 4JF6A 2P9VB 4JPMA 1K56A 1BUEA 5DF8A 2QPNA 1YLJA 5F83A 5F1FA 2EX8A 3QNBA 3LCEA 5FAQA 4EUZA 1PW8A 2JBFA 4FH2A 3IF6B 4MNRA 2XFTA 2ZQ7A 3IHAA 5GLBA 2ZC7A 4EBNA 3BRMA 3BLSA 3BLMA 4S2NC 1EI5A 1W79A 1K6RA 4IVKA 3A3FA 3BECA 3C7UA 3IQAA 1YLTA 4ZBEA 4XXRA 2ZM8A 1G6AA 2V2FF 4N9KA 2HPBA 3MZEA 2EX6A 4U0XA 4XUZA 1XKZA 3GRJA 2HDRA 4OPYA 1AXBA 5A91A 2DCFA 3GVBA 4X55A 2V1ZA 3ZNYA 2J7VA 5TR7A 3UE0A 1RGZA 1IEMA 2UWXA 4DDSA 2ZQDA 3UDFA 1HTZA 3HLWA 4FSFA 3IXHA 3AGFA 4ZJ1A 4OQGA 1LLBA 4OOMA 1IYOA 2XGNA 2Y2HA 2H10A 1BSGA 3VSLA 4WEKA 4BD0A 4K91A 1Z6FA 4JKTA 1O07A 2JE5A 5FI6A 2XK1A 3C5AA 4UA6A 3Q81A 3O86A 1TEMA 3HUNA 4GDBA 5U47A 4S2NA 4WMCD 2J9OA 3BFGA 1ERMA 4E3MA 3Q7VB 5A90A 1NYMA 2Y2KA 3Q82A 1ZG6A 5E43A 3S4XA 1K55A 5AQBA 5L2FA 2C5WB 3HBRA 1IYPA 3O87A 1ZC2A 2Y2OA 4JBFA 1DJAA 1BLHA 4MEZA 5EE8A 5AQ9A 5GL9A 4BD1A 4EV4A 1FCMA 3NI9A 3VP1A 3PAEA 1FR1A 2WYXA 2ZQ8A 2H0YA 3A3DA 4P0MA 3N8RA 3VFHA 2WKHA 1Q2PA 3RJUA 2Y2QA 4JLFA 3OZHA 4DF6A 2WZZA 1BLCA 2WGWA 4GZBA 4QU3A 5FAOA 1OMEA 3ZHHA 3VOYA 1YMSA 3ITAA 3PAGA 4LV3A 3WS4A 4LV0A 3GTCA 2XLNA 2BLSA 3SS3A 2Q9NA 3HUMA 1I5QA 3NIAA 3TOIA 2R9XA 3ZGAB 4Q8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V50 A;  1Q2Q A;  4KEN B;  4UA9 A;  1JWV A;  5EPH A;  2ZLY A;  2ZQA A;  3W4O A;  5A92 A;  2QMI A;  1MXO A;  4O7D A;  3GV9 A;  5TFQ A;  3ISG A;  3ITB A;  3BEB A;  3WS2 A;  4PM9 A;  5CEB A;  2HDU A;  3G31 A;  2WGV A;  3G34 A;  2EX9 A;  2DNS A;  4GB7 A;  4WYY A;  1KE4 A;  2J9P A;  5EVI B;  2J8Y A;  1ESI A;  4R3B A;  1L0D A;  5HL1 A;  1BT5 A;  4OON A;  1BZA A;  2V20 A;  1K54 A;  4BL2 A;  4E3J A;  4K0W A;  3WS0 A;  1XP4 A;  1BTL A;  1ES5 A;  1YLZ A;  4GOG A;  4BQM A;  1DY6 A;  3SH7 A;  3CMZ A;  1N9B A;  5CRF A;  5HAQ A;  2QZ6 A;  1ALQ A;  1MBL A;  3PTE A;  4WEJ A;  5CGW A;  4RX3 A;  2Y2P A;  1ZG4 A;  1NXY A;  4OQI A;  1IKI A;  3CJM A;  4LCM A;  2C6W B;  4RVA A;  4N92 A;  4GKU A;  4GDN A;  5GLD A;  3NDE A;  4KG6 A;  1MWT A;  1YLY A;  1ONG A;  4OQH A;  4WZ4 A;  1K56 D;  1NJ4 A;  4MBF A;  4EBP A;  4P85 A;  5FQI A;  4E3L A;  3PBT A;  4R1G A;  2ZMA A;  3UPP A;  4KZB A;  5GHZ A;  4DXB A;  4QD4 A;  4MLL A;  4HBU A;  4C6Y A;  2WGW B;  4OPR A;  3UY6 A;  2HDQ A;  1MWR A;  5FQQ A;  4UAA A;  3QHY A;  4ZAM A;  3C4O A;  5M19 A;  5EVI D;  5DTS A;  1FQG A;  4EBL A;  1XA7 A;  1MWU A;  1K25 A;  3ZFZ A;  4U3T A;  3HLD A;  5I94 A;  2XDM A;  2HP5 A;  3V39 A;  2ZQC A;  1WYC A;  4CJN A;  2G2U A;  1KDW A;  2ZC5 B;  3HLE A;  4OOL A;  1O7E A;  1PI4 A;  4OP8 A;  4GD8 A;  1W8Y A;  3NC8 A;  4RX2 A;  2WKI A;  2RL3 A;  1M40 A;  1RGY A;  4KZ5 A;  5EEC A;  3OCL A;  1HZO A;  4OP5 A;  4WZ5 A;  2A49 A;  3WS5 A;  1S6R A;  3BFC A;  2ZC3 B;  3EQV A;  1ESU A;  2WK0 A;  4R4S A;  3V3R A;  2Q9M A;  2XF3 A;  3OC2 A;  4OPQ A;  4FH4 A;  1E4D A;  2WAE A;  2EFX A;  3C4P A;  4E6W A;  1E3U A;  4EQI A;  1H8Y A;  5EUA A;  3IXG A;  1K4F A;  5AQ7 A;  4X56 A;  3HLB A;  5D3O A;  5TGF A;  4KZ8 A;  3GR2 A;  1S0W A;  3IF6 A;  4OLG A;  5A93 A;  1H8Z A;  2PU4 A;  3DTM A;  4S2J A;  2ZC6 B;  2BG1 A;  5E2H A;  3BM6 A;  3DWZ A;  1K57 A;  1PZP A;  1G68 A;  2Z2L B;  2Y2N A;  4IBX A;  4QHC A;  2ZJ9 A;  1MY8 A;  2Z2M B;  3MXR A;  1IEL A;  5KZH A;  4LV2 A;  1M6K A;  4H8R A;  3VSK A;  5EOO A;  5M1A A;  4R23 A;  4E3K A;  1NZO A;  4Z9Q A;  5KSC A;  4KG2 A;  3O3V A;  5CHJ A;  1XGI A;  3G32 A;  1KGG A;  1JWZ A;  1C3B A;  5FI2 A;  4Y0U A;  3EQU A;  4OQ0 A;  1GCE A;  5FQJ A;  4DKI A;  5JYP A;  1ZKJ A;  2IWD A;  3DW0 A;  2FFY A;  1JVJ A;  4KZ4 A;  4L0L A;  2XD1 A;  2XH9 A;  4MBK A;  5DF7 A;  1SCW A;  3WWX A;  3UPN A;  1SDE A;  3HLF A;  4QB8 A;  5E2F A;  1JWP A;  3N4I A;  1YLP A;  4DDY A;  1YQS A;  1CEG A;  2XR0 A;  3VP0 A;  1QMF A;  4HES A;  4DE0 A;  4U0T A;  5F1G A;  3WRT A;  3NBL A;  3PBR A;  1K55 C;  1I2S A;  1LL5 A;  4JF5 A;  4R0Q A;  5CTM A;  5FDH A;  4E6X A;  4WM9 A;  3G2Y A;  3OPP A;  5CGS A;  3WS1 A;  1LL9 A;  4E3I A;  5CGX A;  3VP3 A;  5DVA A;  3V5M A;  3HLG A;  4DE2 A;  2H0T A;  2EXB A;  3BFD A;  2OSU A;  3G2Z A;  3G30 A;  2EX2 A;  1K6S A;  3HLC A;  4ZDX A;  1PIO A;  1J9M A;  1GHM A;  3OPR A;  1W8Q A;  3M6B A;  3MKE A;  1NYY A;  2Y55 A;  1CI9 A;  1KGE A;  3LY3 A;  3M2J A;  1BLS A;  1ES2 A;  3E2K A;  3NDG A;  4JF4 A;  1NZU A;  4JXS A;  1K38 A;  1SDN A;  2Y2L A;  2Y2J A;  4YFM A;  4S2O A;  5FA7 A;  2WGI A;  3IXD A;  1SHV A;  4ZJ2 A;  3O88 A;  4B4Z A;  4DE1 A;  4N1H A;  3UDX A;  4ID4 A;  1L2S A;  1TDG A;  5CHU A;  5HAR A;  2EXA A;  1KE3 A;  1FCN A;  1L0E A;  1EWZ A;  3C7V A;  3FWL A;  5GHY A;  1XGJ A;  3LEZ A;  1L0G A;  4D2O A;  2WKE A;  1WYB A;  2X01 A;  2A3U A;  1IYQ A;  1K4E A;  1KVL A;  5FQK A;  4KQR A;  1PI5 A;  2Y4A A;  3TG9 A;  4IVI A;  4OVD A;  2H5S A;  1JTG A;  1GHI A;  3HRE A;  4ZTK A;  5J8X A;  4YIN A;  3UO9 A;  1U60 A;  5FQM A;  1NRF A;  1L0F A;  4C3Q A;  1KVM A;  4OH0 A;  3PBN A;  3HUO A;  2GDN A;  3PBS A;  3WRZ A;  3PBO A;  3M6H A;  4IBR A;  4GN2 A;  1KE0 A;  4MBH A;  3UN7 A;  3A3E A;  3IWQ A;  3W4P A;  2ZQ9 A;  3ZVT A;  4JXW A;  3UDI A;  4F94 A;  2IWC A;  5FAP A;  5HAP A;  3M2K A;  3ZCZ A;  2EFU A;  1LI9 A;  1ES3 A;  3P09 A;  3Q7Z A;  2E8I A;  4NET A;  4C75 A;  3IT9 A;  4OLD A;  2Y2I A;  1LI0 A;  1PW1 A;  3QNC A;  1K54 C;  3GQZ A;  2CC1 A;  3SS5 A;  4X69 A;  1MPL A;  5CEC A;  1MKI A;  3A3J A;  3UE3 A;  1PWG A;  1XXM A;  3UPO A;  2OLU A;  1JTD A;  1E25 A;  4HBT A;  2Y2G A;  4BEN A;  1FSW A;  5DTK A;  1YMX A;  4E3N A;  2ZC4 B;  4OPZ A;  4X53 A;  5E2G A;  4WBG A;  3ZDJ A;  4RYE A;  3MFD A;  3N7W A;  5IHV A;  3P98 A;  4PM5 A;  1LHY A;  4R3J A;  3MBZ A;  3Q7V A;  2ZD8 A;  4LCL A;  4K0X A;  3A3I A;  4X6T A;  1H5X A;  4N9L A;  4IED A;  4S2I A;  1YLW A;  2X71 A;  5FI7 A;  3VP4 A;  5M18 A;  3IWO A;  5JYO A;  1HD8 A;  3SOI A;  3VOZ A;  4KQO A;  1CK3 A;  4KZ6 A;  5GHX A;  1XPB A;  2XEP A;  3Q1F A;  3OPL A;  4PM7 A;  4OKP A;  3IXB A;  3RXX A;  3MXS A;  4S2L A;  4E3O A;  1ONH A;  5CTN A;  2OLV A;  3ZG9 B;  2FFF B;  2XFS A;  4Y7P A;  2HP6 A;  3CG5 A;  1BLP A;  1GA0 A;  4QJG A;  4CPK A;  3D4F A;  3S1Y A;  5HAI A;  1E3U D;  4EWF A;  3FYZ A;  1YM1 A;  3BFF A;  5EVI A;  3N8L A;  4S2M A;  3NY4 A;  1MWS A;  5HW3 A;  3AGE A;  3S22 A;  4QY6 A;  2VGJ A;  4KZ3 A;  4Y0T A;  2WZX A;  3RXW A;  1W5D A;  4WEL A;  1YT4 A;  2PBY A;  4WZ5 C;  1HVB A;  3ZNT A;  3GMW A;  3FKW A;  4KZA A;  1RP5 A;  3SH9 A;  1DJB A;  3IH9 A;  4DE3 A;  4LV1 A;  1VM1 A;  4WMC A;  4QY5 A;  4M3K A;  1ES4 A;  3FZC A;  3DWK A;  5AQA A;  4BL3 A;  3VP2 A;  1K57 C;  1IYS A;  4KZ9 A;  3PBQ A;  5FQ9 A;  3SH8 A;  3IHB A;  4B88 A;  4KZ7 A;  1QME A;  3TSG A;  3I7J A;  1BUL A;  1WE4 A;  3IF6 C;  3ZVW A;  1GA9 A;  1IKG A;  3LY4 A;  5CER A;  2HP9 A;  2Y91 A;  1SKF A;  2Y59 A;  4XUX A;  3JYI A;  4P6B A;  3HL9 A;  4DXC A;  1CEF A;  1XA1 A;  1I2W A;  4GD6 A;  3VFF A;  5GLA A;  3NCK A;  5EVI C;  1N4O A;  2PU2 A;  1DJC A;  4Y0O A;  1FSY A;  1PWD A;  3G35 A;  2G2W A;  3BYD A;  3LO7 A;  3N6I A;  4PMA A;  3UE1 A;  2OV5 A;  5FAS A;  4UHU A;  1TVF A;  3B3X A;  4HEF A;  1PWC A;  3MKF A;  4S2P A;  1NY0 A;  5CHM A;  2VGK A;  4OOY A;  5GLC A;  3Q07 A;  4FD8 A;  4GNU A;  2B5R A;  5HX9 A;  3MZD A;  4PPR A;  5FAT A;  5G18 A;  4R4R A;  3W4Q A;  3G4P A;  2R9W A;  4RA7 A;  4BLM A;  2XD5 A;  1VQQ A;  3IF5 A;  4ZJ3 A;  3OPH A;  3AGD A;  4PM8 A;  4A5R A;  3HVF A;  3FV7 A;  1ERQ A;  2WUQ A;  2JC7 A;  1PZO A;  4S2K A;  1Y54 A;  2HDS A;  4X68 A;  5CXW A;  5DF9 A;  5FSR A;  3V3S A;  4JXG A;  5E2E A;  3ZG8 B;  3N8S A;  1TDL A;  2P9V A;  3ZG0 A;  1W7F A;  4P87 A;  3ZG5 A;  3SS4 A;  3CZD A;  2P74 A;  2I72 A;  2IWB A;  3OCN A;  4KQQ A;  5BOH A;  4B4X A;  1FOF A;  1PYY A;  5DTT A;  4FCF A;  5CED A;  5HFO A;  2Y2M A;  4LEN A;  3BFE A;  1RCJ A;  2WAF A;  5KSH A;  5EVL A;  1GHP A;  5EOE A;  3GSG A;  3MZF A;  2DRW A;  4BJP A;  5F82 A;  1FCO A;  4N1X A;  4UA7 A;  4KG5 A;  2ZM0 A;  3FKV A;  1ERO A;  2ZM2 A;  4NK3 A;  2RCX A;  3ZG7 B;  3VMA A;  2WAD A;  1CI8 A;  3IWI A;  4PM6 A;  4JXV A;  3UNW A;  1KDS A;  3W8K A;  1FR6 A;  2JCH A;  5KMW A;  4DRT A;  3E2L A;  1KGF A;  3IH8 A;  2XQZ A;  1XX2 A;  2X02 A;  4JF6 A;  2P9V B;  4JPM A;  1K56 A;  1BUE A;  5DF8 A;  2QPN A;  1YLJ A;  5F83 A;  5F1F A;  2EX8 A;  3QNB A;  3LCE A;  5FAQ A;  4EUZ A;  1PW8 A;  2JBF A;  4FH2 A;  3IF6 B;  4MNR A;  2XFT A;  2ZQ7 A;  3IHA A;  5GLB A;  2ZC7 A;  4EBN A;  3BRM A;  3BLS A;  3BLM A;  4S2N C;  1EI5 A;  1W79 A;  1K6R A;  4IVK A;  3A3F A;  3BEC A;  3C7U A;  3IQA A;  1YLT A;  4ZBE A;  4XXR A;  2ZM8 A;  1G6A A;  2V2F F;  4N9K A;  2HPB A;  3MZE A;  2EX6 A;  4U0X A;  4XUZ A;  1XKZ A;  3GRJ A;  2HDR A;  4OPY A;  1AXB A;  5A91 A;  2DCF A;  3GVB A;  4X55 A;  2V1Z A;  3ZNY A;  2J7V A;  5TR7 A;  3UE0 A;  1RGZ A;  1IEM A;  2UWX A;  4DDS A;  2ZQD A;  3UDF A;  1HTZ A;  3HLW A;  4FSF A;  3IXH A;  3AGF A;  4ZJ1 A;  4OQG A;  1LLB A;  4OOM A;  1IYO A;  2XGN A;  2Y2H A;  2H10 A;  1BSG A;  3VSL A;  4WEK A;  4BD0 A;  4K91 A;  1Z6F A;  4JKT A;  1O07 A;  2JE5 A;  5FI6 A;  2XK1 A;  3C5A A;  4UA6 A;  3Q81 A;  3O86 A;  1TEM A;  3HUN A;  4GDB A;  5U47 A;  4S2N A;  4WMC D;  2J9O A;  3BFG A;  1ERM A;  4E3M A;  3Q7V B;  5A90 A;  1NYM A;  2Y2K A;  3Q82 A;  1ZG6 A;  5E43 A;  3S4X A;  1K55 A;  5AQB A;  5L2F A;  2C5W B;  3HBR A;  1IYP A;  3O87 A;  1ZC2 A;  2Y2O A;  4JBF A;  1DJA A;  1BLH A;  4MEZ A;  5EE8 A;  5AQ9 A;  5GL9 A;  4BD1 A;  4EV4 A;  1FCM A;  3NI9 A;  3VP1 A;  3PAE A;  1FR1 A;  2WYX A;  2ZQ8 A;  2H0Y A;  3A3D A;  4P0M A;  3N8R A;  3VFH A;  2WKH A;  1Q2P A;  3RJU A;  2Y2Q A;  4JLF A;  3OZH A;  4DF6 A;  2WZZ A;  1BLC A;  2WGW A;  4GZB A;  4QU3 A;  5FAO A;  1OME A;  3ZHH A;  3VOY A;  1YMS A;  3ITA A;  3PAG A;  4LV3 A;  3WS4 A;  4LV0 A;  3GTC A;  2XLN A;  2BLS A;  3SS3 A;  2Q9N A;  3HUM A;  1I5Q A;  3NIA A;  3TOI A;  2R9X A;  3ZGA B;  4Q8I A; 
#chains in the Genus database with same CATH topology
 5HPI A;  3KSH A;  4KEN B;  4HOI A;  4UA9 A;  5FDS A;  2ZLY A;  5TFQ A;  4LFU A;  3WS2 A;  4WYY A;  4R3A A;  3SZT A;  2V20 A;  4BL2 A;  1TS0 A;  3CWF A;  3WS0 A;  2L1M A;  1XP4 A;  1BTL A;  3NJA A;  5HAQ A;  1ALQ A;  3PTE A;  3IBJ A;  4GW9 A;  2Y2P A;  1ZG4 A;  4OQI A;  4D60 A;  2C6W B;  3UME A;  1MWT A;  4Z1W A;  4OQH A;  4Y13 A;  1XJ2 A;  1ZHH B;  4E3L A;  4R1G A;  3UB9 A;  2ZOI A;  5GHZ A;  3B47 A;  1T18 A;  5FQQ A;  4UAA A;  3QHY A;  4ZAM A;  1P0Z A;  3B33 A;  3E4Q A;  5DTS A;  1K25 A;  3U2A A;  4XT2 A;  2PYR A;  2XDM A;  2HP5 A;  4GJ4 A;  3V39 A;  3HLE A;  5F6A A;  2V0U A;  4GD8 A;  2ZBB A;  4RX2 A;  2QWS A;  3F1N B;  2A49 A;  1S6R A;  4JGQ A;  1X0O A;  1ESU A;  4R4S A;  4OPQ A;  2WAE A;  1T19 A;  1LSW A;  4X56 A;  5D3O A;  5A93 A;  1H8Z A;  5E2H A;  2JKG A;  2Z2L B;  2P08 A;  2Y2N A;  1MY8 A;  3LIB A;  1IEL A;  5KZH A;  1M6K A;  3IS2 B;  4R23 A;  4E3K A;  3H82 A;  4KG2 A;  3O3V A;  3G32 A;  4Y0U A;  3EQU A;  1GCE A;  4DKI A;  1JVJ A;  3IX8 A;  4F3L B;  4QB8 A;  3N4I A;  1FIL A;  3VP0 A;  3D72 A;  3RH8 B;  5CTM A;  4WM9 A;  3EEA A;  3WS1 A;  1Z09 A;  2OSU A;  3G2Z A;  2VX8 A;  1OTB A;  5L10 A;  1CI9 A;  1KGE A;  3E2K A;  1K38 A;  2WGI A;  4ZJ2 A;  4B4Z A;  1TDG A;  5L09 A;  1KE3 A;  3V67 A;  1FCN A;  1DP6 A;  1L0G A;  4CLC A;  2Y4A A;  3TG9 A;  1D1J A;  3MQO A;  1NRF A;  3DTI A;  1KVM A;  5HD5 A;  4OH0 A;  3PBN A;  4LRX C;  3MR0 A;  2E8J A;  3TRC A;  1SZV A;  1TD5 A;  3UDI A;  2IWC A;  3M2K A;  5DKL A;  2HV1 A;  4LPZ A;  2E8I A;  3IT9 A;  2Y2I A;  1LI0 A;  2CC1 A;  5CEC A;  5F69 A;  3MXQ A;  2B02 A;  4BEN A;  1FSW A;  5DTK A;  1IOU A;  1VB6 A;  4NXG A;  2VV7 A;  3T12 B;  2A2L A;  3N7W A;  4PM5 A;  4X6T A;  3A0R A;  1YLW A;  5FI7 A;  5M18 A;  4K08 A;  3IWO A;  4HJ4 A;  3SOI A;  3VOZ A;  4KQO A;  5GHX A;  1HLU P;  3C30 A;  3EOI A;  3VE4 A;  3CG5 A;  1BLP A;  1GA0 A;  3SW1 A;  2YKH A;  1YM1 A;  5EVI A;  5DKK A;  1P9W A;  2JHE A;  1W5D A;  1YT4 A;  1ODV A;  3ZNT A;  3SH9 A;  4LV1 A;  4HHD A;  5AQA A;  1KOU A;  1K57 C;  4KZ9 A;  3PBQ A;  5AJG A;  3FPV A;  2Y79 A;  4FOF A;  2V8F A;  3CUE C;  1GA9 A;  5CER A;  4PKY A;  3JYI A;  4DXC A;  2PR6 A;  1N4O A;  1FSY A;  3G35 A;  3BYD A;  2OV5 A;  2PD7 A;  3MKF A;  2VGK A;  4OOY A;  5J3W A;  5G4Z A;  4WUJ A;  5G18 A;  1T1C A;  3G4P A;  2XD5 A;  4PM8 A;  1Y54 A;  5DF9 A;  3ZG8 B;  1TDL A;  2P9V A;  4P87 A;  1XFQ A;  3ZG5 A;  3CZD A;  3OCN A;  4KQQ A;  1OPX A;  1FOF A;  3E0Y A;  2JKR I;  3O5Y A;  5HFO A;  2Y2M A;  4ESP A;  3LR3 A;  3BFE A;  4Y17 A;  1GHP A;  2DRW A;  2W27 A;  3FKV A;  1CI8 A;  4PM6 A;  5TBM A;  3UNW A;  4HH2 A;  3W8K A;  1FR6 A;  1S4S A;  1KGF A;  3IH8 A;  4CLC E;  2XQZ A;  4ETZ A;  1XX2 A;  2X02 A;  4JF6 A;  2P9V B;  1K56 A;  1BUE A;  3MJQ A;  3QP6 A;  4FH2 A;  2B95 A;  2JN7 A;  4HNB A;  2ZQ7 A;  4S2N C;  1CQA A;  4IVK A;  3FPW A;  1S66 L;  3IQA A;  4ZBE A;  4XXR A;  2ZM8 A;  3BW6 A;  3T4S A;  2L4R A;  2CMN A;  3GRJ A;  4UEY A;  1K0K A;  1AXB A;  5A91 A;  2A24 B;  4X55 A;  5J4E A;  1CF0 A;  3RTY A;  2J7V A;  3T1S A;  1RGZ A;  2UWX A;  4EQ1 A;  1OJG A;  4OQG A;  1XFN A;  3F1P A;  2XGN A;  2Y2H A;  4WEK A;  4JKT A;  4ME4 A;  3Q81 A;  5C5K A;  4GDB A;  5U47 A;  2PT7 A;  4WMC D;  4Q0J A;  3IX3 A;  3ULF A;  1ZG6 A;  3T4O A;  2VV6 A;  1IYP A;  3O87 A;  1ZC2 A;  4JBF A;  5AQ9 A;  4EV4 A;  4G3W A;  3NI9 A;  3PAE A;  1FR1 A;  1GSV A;  2H0Y A;  4P0M A;  3VFH A;  2WKH A;  2WZZ A;  4QU3 A;  3VOY A;  2ZL1 B;  2BLS A;  3SS3 A;  4NXE A;  2XA7 M;  4EEU A;  3NIA A;  1Q2Q A;  3G6O A;  3NHQ A;  1PRQ A;  5A92 A;  4CLC C;  3QP1 A;  4GS9 A;  3ITB A;  5CEB A;  3C38 A;  3G34 A;  2DNS A;  2J9P A;  1L0D A;  2KDK A;  1MZU A;  2VJW A;  4ARZ B;  1DP8 A;  2BAS A;  1H8M A;  2VK3 A;  4LLO B;  1DY6 A;  3TE8 A;  5CRF A;  2QZ6 A;  4WEJ A;  4P6Z S;  2BTF P;  4N92 A;  2W1T B;  2GJ3 A;  3NDE A;  4KG6 A;  3T1Q B;  1ONG A;  1K56 D;  4EBP A;  5FQI A;  4KZB A;  4MCW A;  3MSH A;  4MLL A;  2K2N A;  4OPR A;  1XJ6 A;  2HJ9 C;  5M19 A;  5EVI D;  4CLC D;  4F3L A;  1MWU A;  3ZFZ A;  1WYC A;  2G2U A;  2D02 A;  1KDW A;  3HCY A;  4O0P A;  4EU0 A;  1O7E A;  3UB5 P;  1PI4 A;  2MJ6 A;  3NC8 A;  1RGY A;  3VV4 A;  1HZO A;  4R6L A;  4IUH A;  4WZ5 A;  3BFC A;  2M1C A;  2ZC3 B;  1YSQ A;  3EQV A;  3MS6 A;  1YSP A;  2WK0 A;  2EFX A;  4L9E A;  5EUA A;  5TGF A;  3OLO A;  4KZ8 A;  3CIT A;  4OLG A;  4XT2 B;  2VGL M;  5EM1 A;  1K57 A;  3CAX A;  5EVE A;  3T1X A;  4YWZ A;  2Z2M B;  3MXR A;  1YAX A;  4H8R A;  3VSK A;  5FL3 A;  3FC7 A;  3CI6 A;  5EFW A;  4Z9Q A;  5KSC A;  3H7W B;  3VOL A;  2G7U A;  1ZKJ A;  4Q0I A;  2IWD A;  2FFY A;  1W63 Q;  3EGD C;  1SCW A;  3HLF A;  4X1M A;  3D9Y A;  3K3C A;  2XR0 A;  1QMF A;  1OT9 A;  3PBR A;  3T1R A;  4R0Q A;  4E6X A;  2I9V A;  3G2Y A;  3OPP A;  1EW0 A;  1SKO A;  1LL9 A;  3VP3 A;  3HLG A;  2OAP 1;  2EXB A;  3BFD A;  5EM0 A;  3HLC A;  1K6S A;  3P7N A;  2XRO A;  1W8Q A;  1NYY A;  3LY3 A;  3M2J A;  1NZU A;  5AVE A;  2Y2L A;  2Y2J A;  4S2O A;  3IXD A;  4DE1 A;  3UDX A;  1L2S A;  5CHU A;  5HSQ A;  5DFY A;  3E4O A;  3FWL A;  5GHY A;  1WYB A;  2AVX A;  2A3U A;  5FQK A;  2OWJ A;  4KQR A;  3HRE A;  5J8X A;  1XJ3 A;  4X1L A;  5FQM A;  4LRY C;  1L3L A;  2V0W A;  2JKT I;  2GDN A;  3PR6 A;  2PYP A;  3WRZ A;  4IBR A;  4GN2 A;  1KE0 A;  3UN7 A;  2ZQ9 A;  1PFL A;  3ZVT A;  2LB5 A;  3KSG A;  2EFU A;  1LI9 A;  3Q7Z A;  4IUK A;  4C75 A;  4OLD A;  3QNC A;  4O01 A;  1K54 C;  1T1B A;  4HH3 A;  3T50 A;  3A3J A;  1XXM A;  4I38 A;  2OLU A;  2KLI A;  3UE6 A;  3KYE A;  4E3N A;  2P04 A;  4ZRR A;  1Y4O A;  4RYE A;  4EW7 A;  5IHV A;  4KQD A;  4R3J A;  2ZD8 A;  4LCL A;  4K0X A;  4DN0 A;  4HI4 A;  4I39 A;  4WF0 A;  1H5X A;  4IED A;  3VP4 A;  5JYO A;  2XEP A;  2M7U A;  4OKP A;  3IXB A;  1ONH A;  5CTN A;  2OLV A;  2XFS A;  4Y7P A;  3CUE A;  4NG2 A;  2HP6 A;  2VZW A;  4QJG A;  4CPK A;  3S1Y A;  5HAI A;  4R70 A;  3BFF A;  3N8L A;  3NY4 A;  3S22 A;  3LIA A;  4QY6 A;  4WZ5 C;  5HDD A;  1TF1 A;  4DE3 A;  3S7P A;  4QY5 A;  3FZC A;  3DWK A;  3VP2 A;  1F2K A;  5J7E A;  2PDR A;  3BJN A;  4KZ7 A;  2O9C A;  1QME A;  3CPT A;  3CPT B;  3LY4 A;  1SKF A;  2Y59 A;  4XUX A;  2QHK A;  4P6B A;  5HWW A;  2VKS A;  1I2W A;  4GD6 A;  5HZH A;  2H28 A;  2KOI A;  1NRJ A;  4GCZ A;  1DJC A;  2QJ7 A;  3UE1 A;  1TS7 A;  4Y5F A;  5FAS A;  4UHU A;  3B3X A;  3EEH A;  3KSI A;  2O9B A;  1NLY A;  2B5R A;  3MZD A;  5HDS A;  4R4R A;  4WL9 A;  3JVU A;  3W4Q A;  2R9W A;  1VQQ A;  3RFB A;  1N9L A;  1G6O A;  1ERQ A;  2JC7 A;  1PZO A;  5CXW A;  4MDZ A;  1G28 A;  4X68 A;  3U4L P;  3LIE A;  4JXG A;  5EV0 A;  5E2E A;  5CX7 A;  1W7F A;  2P74 A;  2I72 A;  3LEQ A;  5BOH A;  4L9F A;  3LI9 A;  1PYY A;  2INW A;  5AVF A;  5KSH A;  1RCJ A;  4MN5 A;  4QPR A;  4BJP A;  4N1X A;  4KG5 A;  4NK3 A;  3IWI A;  3IX4 A;  4JXV A;  1KDS A;  2JCH A;  1LL8 A;  1N9N A;  4JPM A;  4EER A;  3F1N A;  3T4T A;  1YLJ A;  3UMD A;  3LCE A;  1PW8 A;  2JBF A;  5IS1 A;  3KO6 A;  4EBN A;  3BLS A;  3FG8 A;  3B42 A;  3BQA A;  3C7U A;  5MC7 A;  3EWK A;  3NOT C;  2HDR A;  3IS2 A;  4OPY A;  2V1Z A;  5G4Y A;  3ZNY A;  1IEM A;  4DDS A;  4PHT A;  3UDF A;  3NUL A;  3IXH A;  4ZJ1 A;  4MMN A;  1LLB A;  1IYO A;  2H10 A;  3VSL A;  2JE5 A;  5FI6 A;  3CHW P;  4UA6 A;  1TEM A;  1S1Y A;  2EWV A;  3CLO A;  3Q7V B;  2Y2K A;  3Q82 A;  5EE8 A;  1F5M A;  2W1T A;  1DJA A;  5GL9 A;  1FCM A;  4JLF A;  3OZH A;  3D3O A;  3ZHH A;  5DJU A;  1YMS A;  3PAG A;  3QP5 A;  5L8M A;  3BY8 A;  4Q8I A;  3V50 A;  4BBU A;  3LYX A;  2O99 A;  1JWV A;  5EPH A;  2ZQA A;  3W4O A;  2QMI A;  4O7D A;  1ZTU A;  3GV9 A;  3ISG A;  3BEB A;  4BBV A;  3G31 A;  3KYQ A;  2WGV A;  4GB7 A;  1KE4 A;  4R3B A;  1NLZ A;  5FEF A;  3LUQ A;  3KYZ A;  2HGV A;  4K0W A;  4GOG A;  4BQM A;  2K31 A;  3SH7 A;  3CMZ A;  4RX3 A;  1T1A A;  4O8G A;  1IKI A;  3CJM A;  4LCM A;  4MN7 A;  3QP8 A;  5GLD A;  3MQ0 A;  2HF6 A;  4WZ4 A;  4MBF A;  4P85 A;  2J3T D;  3UPP A;  4DXB A;  2QKP A;  2W3F A;  4KUK A;  2WGW B;  1MWR A;  2EA9 A;  2XA7 S;  2O0Y A;  3C4O A;  3F1P B;  1FQG A;  1VET A;  4U3T A;  1H0M A;  1OTI A;  2ZQC A;  3TJZ C;  4CJN A;  2ZC5 B;  2ZOH A;  4M4X A;  1W8Y A;  4HP9 A;  3MMH A;  2WKI A;  2RL3 A;  4KZ5 A;  3OCL A;  4WLA A;  3HJK A;  3V3R A;  2XF3 A;  4FH4 A;  2ZL1 A;  1E3U A;  4EQI A;  1H8Y A;  1K4F A;  5AQ7 A;  3HLB A;  3IF6 A;  3LI8 A;  5HDC A;  2PU4 A;  3DTM A;  2ZC6 B;  2BG1 A;  1D7E A;  3BM6 A;  3DWZ A;  4FUW A;  1PZP A;  2PR5 A;  4HJ6 A;  4IBX A;  4QHC A;  2ZJ9 A;  2JKF A;  4LGW A;  4FTX A;  2V8C A;  5EOO A;  5M1A A;  2JKT M;  5CHJ A;  5FI2 A;  3MF0 A;  4OQ0 A;  5FQJ A;  5JYP A;  2XH9 A;  1A0K A;  5DF7 A;  3WWX A;  3UPN A;  3OOV A;  3LR5 A;  1JWP A;  3H9W A;  1YLP A;  3UB8 A;  5F68 A;  4DE0 A;  5F1G A;  1K55 C;  1LL5 A;  4JF5 A;  5FDH A;  1AWI A;  2JKR M;  3W2Z A;  4E3I A;  5IU1 A;  3V5M A;  1D06 A;  2H0T A;  3G30 A;  4H6J B;  2EX2 A;  1PIO A;  3MKE A;  2Y55 A;  3NDG A;  1BLS A;  3SH8 A;  3E4P A;  4JXS A;  4YFM A;  3O88 A;  4N1H A;  4G3V A;  4ID4 A;  4B93 A;  2M7V A;  5HAR A;  2EXA A;  3C7V A;  1XGJ A;  2W3H A;  1IYQ A;  1K4E A;  1SKO B;  4IVI A;  4OVD A;  3LIF A;  2J3T C;  1JTG A;  4ZTK A;  4YIN A;  5HWT A;  3L7H A;  1U60 A;  3LFV A;  4C3Q A;  3K2N A;  3HUO A;  3LR0 A;  3PBS A;  3M6H A;  4MBH A;  3A3E A;  3IWQ A;  3S7O A;  2J3W A;  4JXW A;  4F94 A;  5FAP A;  5HAP A;  5KIZ A;  1F9I A;  4NET A;  3GQZ A;  4JGR A;  4I3A A;  4PAU A;  4X69 A;  1MKI A;  5LBR A;  3UE3 A;  2WKQ A;  4HBT A;  1JTD A;  1E25 A;  2Y2G A;  1YMX A;  4OPZ A;  1YPR A;  5E2G A;  2ZMF A;  3BWL A;  2OAQ 1;  1OTE A;  3MFD A;  2W3E A;  3A3I A;  5HL6 A;  4S2I A;  2X71 A;  2QYB A;  3DTK A;  1LSV A;  4UQI S;  1S4R A;  1XPB A;  3E98 A;  3PHY A;  3MXS A;  3RXX A;  3R7W B;  2VA0 A;  3PYP A;  2FFF B;  1V9Y A;  2GX5 A;  3IBR A;  3JPU A;  3C2W A;  2K7S A;  2VGJ A;  4Y0T A;  1ACF A;  3RXW A;  2PBY A;  3GMW A;  3FKW A;  4KZA A;  1DJB A;  4WMC A;  1IYS A;  1CJF A;  5L07 A;  3IHB A;  3TW8 A;  3I7J A;  1BUL A;  2HP9 A;  2J80 A;  3HL9 A;  3DBA A;  3MQQ A;  4JGP A;  3NCK A;  5EVI C;  2PU2 A;  1PWD A;  2GNX A;  4HEF A;  4S2P A;  5GLC A;  3Q07 A;  4GNU A;  2W1R A;  5FAT A;  1VHM A;  4ZJ3 A;  3IF5 A;  3OPH A;  4A5R A;  3HVF A;  3FV7 A;  2WUQ A;  2HDS A;  5FSR A;  5HWV A;  3R4K A;  3N8S A;  2R78 A;  4IHQ A;  1UWN X;  3SS4 A;  3BQ8 A;  2IWB A;  3PXP A;  4B4X A;  1OTA A;  3UB7 A;  4IJG A;  3T4Q A;  3GSG A;  1FCO A;  4CQH A;  1VEU A;  2ZM0 A;  1ERO A;  2HJE A;  2V9A A;  2VLG A;  2HZ5 A;  3E2L A;  4DJ3 A;  3ZQ5 A;  5FAQ A;  2VEA A;  4EUZ A;  2EWW A;  4MNR A;  3IHA A;  5GLB A;  4HIA A;  1EI5 A;  1W79 A;  1K6R A;  3A3F A;  3BEC A;  4LRZ E;  1YLT A;  2V1B A;  2V2F F;  4XUZ A;  4N9K A;  2EX6 A;  1MKM A;  2A24 A;  2DCF A;  3GVB A;  2IA2 A;  5TR7 A;  4X25 A;  2ZQD A;  3HLW A;  4FSF A;  3AGF A;  4Q0H A;  4OOM A;  1BSG A;  1Z6F A;  1O07 A;  3O86 A;  3HUN A;  4S2N A;  1ERM A;  1NYM A;  5L2F A;  1K55 A;  5AQB A;  2C5W B;  1OJ5 A;  3C8C A;  2Y2O A;  4GS9 B;  1BLH A;  4MEZ A;  4BD1 A;  2O9A A;  2WYX A;  1GSX A;  1OTD A;  3N8R A;  2Z6D A;  2Y2Q A;  3H7W A;  3P01 A;  2WGW A;  4MN6 A;  1XJ4 A;  1H3Q A;  1OME A;  5TJJ A;  3A0S A;  2W0N A;  4LV0 A;  3GTC A;  2Q9N A;  2XSS A;  1I5Q A;  3DAV A;  4NKP A;  2R9X A;  1IFQ A;  2LB9 A;  4QWO A;  1MXO A;  5I5L A;  3F1O B;  1JNU A;  4PM9 A;  2HDU A;  2NUT C;  3R7W A;  4DJ2 A;  2EX9 A;  5EVI B;  4P6Z M;  2J8Y A;  1ESI A;  5HL1 A;  1BT5 A;  4OON A;  1BZA A;  3DTE A;  1K54 A;  3NOU C;  4E3J A;  4YNR A;  1YLZ A;  1ES5 A;  3QP4 A;  4Y15 A;  1N9B A;  1MBL A;  5CGW A;  3ZYT A;  1NXY A;  4HQA A;  4G3K A;  2DMW A;  4RVA A;  4GKU A;  4GDN A;  2KX6 A;  1YLY A;  1NJ4 A;  1LT0 A;  1WA9 A;  3PBT A;  2ZMA A;  4B9O A;  2PRF A;  4QD4 A;  4C6Y A;  4HBU A;  5F5Y A;  3UY6 A;  2HDQ A;  3HJI A;  4II7 A;  3LR4 A;  4EBL A;  2V1A A;  1XA7 A;  2QJ5 A;  3MFX A;  3HLD A;  5I94 A;  4E04 A;  2B18 A;  4OOL A;  3S7Q A;  4OP8 A;  5TBM B;  1M40 A;  5EEC A;  4L9G A;  4OP5 A;  5HD3 A;  3WS5 A;  1OT6 A;  1NWZ A;  2Q9M A;  3OC2 A;  1E4D A;  2ACG A;  3C4P A;  4E6W A;  1P97 A;  3IXG A;  3GR2 A;  1S0W A;  4S2J A;  1G68 A;  2YKF A;  4KUO A;  4LV2 A;  3BY9 A;  1NZO A;  3NOP C;  1GSW A;  1XGI A;  1KGG A;  1JWZ A;  1C3B A;  3DW0 A;  4KZ4 A;  4L0L A;  2XD1 A;  4MBK A;  1SDE A;  5E2F A;  3GEC A;  4DDY A;  1YQS A;  1CEG A;  4HES A;  4U0T A;  1TS6 A;  3WRT A;  1UGU A;  3NBL A;  1I2S A;  1J3W A;  5CGS A;  4GHI A;  5CGX A;  5DVA A;  4DE2 A;  2ZMV A;  4ZDX A;  1J9M A;  1GHM A;  3OPR A;  3M6B A;  2NUP C;  2Z6C A;  1ES2 A;  3KSF A;  4JF4 A;  1SDN A;  5FA7 A;  1SHV A;  4PKY G;  1F98 A;  4I5S A;  2FZ0 A;  1L0E A;  1VET B;  1EWZ A;  4Y2F A;  4HJ3 A;  3LEZ A;  4D2O A;  2WKE A;  2X01 A;  1KVL A;  1PI5 A;  2W3G A;  4GHI B;  4BWI A;  2H5S A;  1GHI A;  4NXB A;  4JGO A;  3UO9 A;  2OOL A;  1L0F A;  5DJT A;  2P7J A;  3PBO A;  3ICY A;  3W4P A;  4HP4 A;  5IT5 A;  5K5B A;  3ZCZ A;  1ES3 A;  3P09 A;  1PW1 A;  1MC0 A;  4WN5 A;  3SS5 A;  3QP2 A;  1MPL A;  1PWG A;  1Y28 A;  4H6J A;  3UPO A;  2ZC4 B;  4RQ9 A;  3L9K A;  4X53 A;  4WBG A;  3ZDJ A;  1PNE A;  2PHY A;  3P98 A;  1LHY A;  3MBZ A;  3Q7V A;  1G5U A;  1DP9 A;  1VEU B;  4N9L A;  4EXO A;  1HD8 A;  1S1Z A;  2Q0O A;  1CK3 A;  4KZ6 A;  4PM7 A;  3Q1F A;  3OPL A;  4S2L A;  4GLQ A;  3S7N A;  3ZG9 B;  3OBF A;  2OWH A;  2PBD P;  2Y8H A;  3D4F A;  1E3U D;  4EWF A;  3FYZ A;  4HY8 A;  4S2M A;  1MWS A;  5HW3 A;  3AGE A;  4EET B;  4KZ3 A;  2VV8 A;  4AFI A;  2WZX A;  3T4J A;  4BBT A;  4WEL A;  1HVB A;  1RP5 A;  3IH9 A;  4NEE D;  5DFX A;  1VM1 A;  3A0V A;  4EUV A;  4M3K A;  3VE3 A;  1ES4 A;  4BL3 A;  5FQ9 A;  2GZA A;  4B88 A;  3TSG A;  1WE4 A;  3IF6 C;  3ZVW A;  1IKG A;  2Y91 A;  4Y3I A;  1CEF A;  1XA1 A;  3VFF A;  5GLA A;  5FEG A;  1TS8 A;  4Y0O A;  4EES A;  3N6I A;  2G2W A;  1DRM A;  3LO7 A;  1LSX A;  4PMA A;  3NEC A;  1TVF A;  2WKP A;  3K3D A;  1PWC A;  1NY0 A;  5CHM A;  4FD8 A;  2WKR A;  5HX9 A;  1P9R A;  4PPR A;  4CLC B;  4ETX A;  4RA7 A;  4BLM A;  1V9Z A;  4I3I A;  3AGD A;  2XRN A;  4S2K A;  4E3O A;  3V3S A;  4YOF A;  1FIK A;  3ZG0 A;  1BYW A;  4R38 A;  2FH5 A;  4EEP A;  5DTT A;  4FCF A;  5CED A;  4LEN A;  3LGO A;  2WAF A;  5EVL A;  5EOE A;  3MZF A;  5F82 A;  4UA7 A;  2ZM2 A;  2RCX A;  3ZG7 B;  3VMA A;  2WAD A;  1UWP X;  3EGX C;  5KMW A;  4DRT A;  4I3J A;  4NXF A;  1W63 M;  4ARZ A;  5DF8 A;  2QPN A;  1YKD A;  5F83 A;  5F1F A;  2EX8 A;  3QNB A;  3IF6 B;  2XFT A;  2ZC7 A;  5A8B A;  3BRM A;  3BLM A;  5HPF A;  2PAV P;  1G6A A;  2HPB A;  2L0W A;  3MZE A;  4U0X A;  1XKZ A;  2W3D A;  3F1O A;  3UE0 A;  3KX0 X;  1HTZ A;  2VGL S;  1N9O A;  4BD0 A;  4K91 A;  3UB6 A;  1STZ A;  4DMZ A;  4UQI M;  2XK1 A;  3C5A A;  3T4K A;  2UV0 E;  2PD8 A;  2J9O A;  3BFG A;  4E3M A;  5A90 A;  3S4X A;  5E43 A;  3LIC A;  3HBR A;  3VP1 A;  2ZQ8 A;  3A3D A;  2D01 A;  4BMW A;  1Q2P A;  3RJU A;  3JVV A;  4DF6 A;  1S67 L;  1BLC A;  3H82 B;  3LID A;  3T4L A;  4GZB A;  5FAO A;  3ITA A;  3WS4 A;  4LV3 A;  2XLN A;  3GDI A;  3HUM A;  3TOI A;  3ZGA B; 
#chains in the Genus database with same CATH homology
 3V50 A;  1Q2Q A;  4KEN B;  4UA9 A;  1JWV A;  5EPH A;  2ZLY A;  2ZQA A;  3W4O A;  5A92 A;  2QMI A;  1MXO A;  4O7D A;  3GV9 A;  5TFQ A;  3ISG A;  3ITB A;  3BEB A;  3WS2 A;  4PM9 A;  5CEB A;  2HDU A;  3G31 A;  2WGV A;  3G34 A;  2EX9 A;  2DNS A;  4GB7 A;  4WYY A;  1KE4 A;  2J9P A;  5EVI B;  2J8Y A;  1ESI A;  4R3B A;  1L0D A;  5HL1 A;  1BT5 A;  4OON A;  1BZA A;  2V20 A;  1K54 A;  4BL2 A;  4E3J A;  4K0W A;  3WS0 A;  1XP4 A;  1BTL A;  1ES5 A;  1YLZ A;  4GOG A;  4BQM A;  1DY6 A;  3SH7 A;  3CMZ A;  1N9B A;  5CRF A;  5HAQ A;  2QZ6 A;  1ALQ A;  1MBL A;  3PTE A;  4WEJ A;  5CGW A;  4RX3 A;  2Y2P A;  1ZG4 A;  1NXY A;  4OQI A;  1IKI A;  3CJM A;  4LCM A;  2C6W B;  4RVA A;  4N92 A;  4GKU A;  4GDN A;  5GLD A;  3NDE A;  4KG6 A;  1MWT A;  1YLY A;  1ONG A;  4OQH A;  4WZ4 A;  1K56 D;  1NJ4 A;  4MBF A;  4EBP A;  4P85 A;  5FQI A;  4E3L A;  3PBT A;  4R1G A;  2ZMA A;  3UPP A;  4KZB A;  5GHZ A;  4DXB A;  4QD4 A;  4MLL A;  4HBU A;  4C6Y A;  2WGW B;  4OPR A;  3UY6 A;  2HDQ A;  1MWR A;  5FQQ A;  4UAA A;  3QHY A;  4ZAM A;  3C4O A;  5M19 A;  5EVI D;  5DTS A;  1FQG A;  4EBL A;  1XA7 A;  1MWU A;  1K25 A;  3ZFZ A;  4U3T A;  3HLD A;  5I94 A;  2XDM A;  2HP5 A;  3V39 A;  2ZQC A;  1WYC A;  4CJN A;  2G2U A;  1KDW A;  2ZC5 B;  3HLE A;  4OOL A;  1O7E A;  1PI4 A;  4OP8 A;  4GD8 A;  1W8Y A;  3NC8 A;  4RX2 A;  2WKI A;  2RL3 A;  1M40 A;  1RGY A;  4KZ5 A;  5EEC A;  3OCL A;  1HZO A;  4OP5 A;  4WZ5 A;  2A49 A;  3WS5 A;  1S6R A;  3BFC A;  2ZC3 B;  3EQV A;  1ESU A;  2WK0 A;  4R4S A;  3V3R A;  2Q9M A;  2XF3 A;  3OC2 A;  4OPQ A;  4FH4 A;  1E4D A;  2WAE A;  2EFX A;  3C4P A;  4E6W A;  1E3U A;  4EQI A;  1H8Y A;  5EUA A;  3IXG A;  1K4F A;  5AQ7 A;  4X56 A;  3HLB A;  5D3O A;  5TGF A;  4KZ8 A;  3GR2 A;  1S0W A;  3IF6 A;  4OLG A;  5A93 A;  1H8Z A;  2PU4 A;  3DTM A;  4S2J A;  2ZC6 B;  2BG1 A;  5E2H A;  3BM6 A;  3DWZ A;  1K57 A;  1PZP A;  1G68 A;  2Z2L B;  2Y2N A;  4IBX A;  4QHC A;  2ZJ9 A;  1MY8 A;  2Z2M B;  3MXR A;  1IEL A;  5KZH A;  4LV2 A;  1M6K A;  4H8R A;  3VSK A;  5EOO A;  5M1A A;  4R23 A;  4E3K A;  1NZO A;  4Z9Q A;  5KSC A;  4KG2 A;  3O3V A;  5CHJ A;  1XGI A;  3G32 A;  1KGG A;  1JWZ A;  1C3B A;  5FI2 A;  4Y0U A;  3EQU A;  4OQ0 A;  1GCE A;  5FQJ A;  4DKI A;  5JYP A;  1ZKJ A;  2IWD A;  3DW0 A;  2FFY A;  1JVJ A;  4KZ4 A;  4L0L A;  2XD1 A;  2XH9 A;  4MBK A;  5DF7 A;  1SCW A;  3WWX A;  3UPN A;  1SDE A;  3HLF A;  4QB8 A;  5E2F A;  1JWP A;  3N4I A;  1YLP A;  4DDY A;  1YQS A;  1CEG A;  2XR0 A;  3VP0 A;  1QMF A;  4HES A;  4DE0 A;  4U0T A;  5F1G A;  3WRT A;  3NBL A;  3PBR A;  1K55 C;  1I2S A;  1LL5 A;  4JF5 A;  4R0Q A;  5CTM A;  5FDH A;  4E6X A;  4WM9 A;  3G2Y A;  3OPP A;  5CGS A;  3WS1 A;  1LL9 A;  4E3I A;  5CGX A;  3VP3 A;  5DVA A;  3V5M A;  3HLG A;  4DE2 A;  2H0T A;  2EXB A;  3BFD A;  2OSU A;  3G2Z A;  3G30 A;  2EX2 A;  1K6S A;  3HLC A;  4ZDX A;  1PIO A;  1J9M A;  1GHM A;  3OPR A;  1W8Q A;  3M6B A;  3MKE A;  1NYY A;  2Y55 A;  1CI9 A;  1KGE A;  3LY3 A;  3M2J A;  1BLS A;  1ES2 A;  3E2K A;  3NDG A;  4JF4 A;  1NZU A;  4JXS A;  1K38 A;  1SDN A;  2Y2L A;  2Y2J A;  4YFM A;  4S2O A;  5FA7 A;  2WGI A;  3IXD A;  1SHV A;  4ZJ2 A;  3O88 A;  4B4Z A;  4DE1 A;  4N1H A;  3UDX A;  4ID4 A;  1L2S A;  1TDG A;  5CHU A;  5HAR A;  2EXA A;  1KE3 A;  1FCN A;  1L0E A;  1EWZ A;  3C7V A;  3FWL A;  5GHY A;  1XGJ A;  3LEZ A;  1L0G A;  4D2O A;  2WKE A;  1WYB A;  2X01 A;  2A3U A;  1IYQ A;  1K4E A;  1KVL A;  5FQK A;  4KQR A;  1PI5 A;  2Y4A A;  3TG9 A;  4IVI A;  4OVD A;  2H5S A;  1JTG A;  1GHI A;  3HRE A;  4ZTK A;  5J8X A;  4YIN A;  3UO9 A;  1U60 A;  5FQM A;  1NRF A;  1L0F A;  4C3Q A;  1KVM A;  4OH0 A;  3PBN A;  3HUO A;  2GDN A;  3PBS A;  3WRZ A;  3PBO A;  3M6H A;  4IBR A;  4GN2 A;  1KE0 A;  4MBH A;  3UN7 A;  3A3E A;  3IWQ A;  3W4P A;  2ZQ9 A;  3ZVT A;  4JXW A;  3UDI A;  4F94 A;  2IWC A;  5FAP A;  5HAP A;  3M2K A;  3ZCZ A;  2EFU A;  1LI9 A;  1ES3 A;  3P09 A;  3Q7Z A;  2E8I A;  4NET A;  4C75 A;  3IT9 A;  4OLD A;  2Y2I A;  1LI0 A;  1PW1 A;  3QNC A;  1K54 C;  3GQZ A;  2CC1 A;  3SS5 A;  4X69 A;  1MPL A;  5CEC A;  1MKI A;  3A3J A;  3UE3 A;  1PWG A;  1XXM A;  3UPO A;  2OLU A;  1JTD A;  1E25 A;  4HBT A;  2Y2G A;  4BEN A;  1FSW A;  5DTK A;  1YMX A;  4E3N A;  2ZC4 B;  4OPZ A;  4X53 A;  5E2G A;  4WBG A;  3ZDJ A;  4RYE A;  3MFD A;  3N7W A;  5IHV A;  3P98 A;  4PM5 A;  1LHY A;  4R3J A;  3MBZ A;  3Q7V A;  2ZD8 A;  4LCL A;  4K0X A;  3A3I A;  4X6T A;  1H5X A;  4N9L A;  4IED A;  4S2I A;  1YLW A;  2X71 A;  5FI7 A;  3VP4 A;  5M18 A;  3IWO A;  5JYO A;  1HD8 A;  3SOI A;  3VOZ A;  4KQO A;  1CK3 A;  4KZ6 A;  5GHX A;  1XPB A;  2XEP A;  3Q1F A;  3OPL A;  4PM7 A;  4OKP A;  3IXB A;  3RXX A;  3MXS A;  4S2L A;  4E3O A;  1ONH A;  5CTN A;  2OLV A;  3ZG9 B;  2FFF B;  2XFS A;  4Y7P A;  2HP6 A;  3CG5 A;  1BLP A;  1GA0 A;  4QJG A;  4CPK A;  3D4F A;  3S1Y A;  5HAI A;  1E3U D;  4EWF A;  3FYZ A;  1YM1 A;  3BFF A;  5EVI A;  3N8L A;  4S2M A;  3NY4 A;  1MWS A;  5HW3 A;  3AGE A;  3S22 A;  4QY6 A;  2VGJ A;  4KZ3 A;  4Y0T A;  2WZX A;  3RXW A;  1W5D A;  4WEL A;  1YT4 A;  2PBY A;  4WZ5 C;  1HVB A;  3ZNT A;  3GMW A;  3FKW A;  4KZA A;  1RP5 A;  3SH9 A;  1DJB A;  3IH9 A;  4DE3 A;  4LV1 A;  1VM1 A;  4WMC A;  4QY5 A;  4M3K A;  1ES4 A;  3FZC A;  3DWK A;  5AQA A;  4BL3 A;  3VP2 A;  1K57 C;  1IYS A;  4KZ9 A;  3PBQ A;  5FQ9 A;  3SH8 A;  3IHB A;  4B88 A;  4KZ7 A;  1QME A;  3TSG A;  3I7J A;  1BUL A;  1WE4 A;  3IF6 C;  3ZVW A;  1GA9 A;  1IKG A;  3LY4 A;  5CER A;  2HP9 A;  2Y91 A;  1SKF A;  2Y59 A;  4XUX A;  3JYI A;  4P6B A;  3HL9 A;  4DXC A;  1CEF A;  1XA1 A;  1I2W A;  4GD6 A;  3VFF A;  5GLA A;  3NCK A;  5EVI C;  1N4O A;  2PU2 A;  1DJC A;  4Y0O A;  1FSY A;  1PWD A;  3G35 A;  2G2W A;  3BYD A;  3LO7 A;  3N6I A;  4PMA A;  3UE1 A;  2OV5 A;  5FAS A;  4UHU A;  1TVF A;  3B3X A;  4HEF A;  1PWC A;  3MKF A;  4S2P A;  1NY0 A;  5CHM A;  2VGK A;  4OOY A;  5GLC A;  3Q07 A;  4FD8 A;  4GNU A;  2B5R A;  5HX9 A;  3MZD A;  4PPR A;  5FAT A;  5G18 A;  4R4R A;  3W4Q A;  3G4P A;  2R9W A;  4RA7 A;  4BLM A;  2XD5 A;  1VQQ A;  3IF5 A;  4ZJ3 A;  3OPH A;  3AGD A;  4PM8 A;  4A5R A;  3HVF A;  3FV7 A;  1ERQ A;  2WUQ A;  2JC7 A;  1PZO A;  4S2K A;  1Y54 A;  2HDS A;  4X68 A;  5CXW A;  5DF9 A;  5FSR A;  3V3S A;  4JXG A;  5E2E A;  3ZG8 B;  3N8S A;  1TDL A;  2P9V A;  3ZG0 A;  1W7F A;  4P87 A;  3ZG5 A;  3SS4 A;  3CZD A;  2P74 A;  2I72 A;  2IWB A;  3OCN A;  4KQQ A;  5BOH A;  4B4X A;  1FOF A;  1PYY A;  5DTT A;  4FCF A;  5CED A;  5HFO A;  2Y2M A;  4LEN A;  3BFE A;  1RCJ A;  2WAF A;  5KSH A;  5EVL A;  1GHP A;  5EOE A;  3GSG A;  3MZF A;  2DRW A;  4BJP A;  5F82 A;  1FCO A;  4N1X A;  4UA7 A;  4KG5 A;  2ZM0 A;  3FKV A;  1ERO A;  2ZM2 A;  4NK3 A;  2RCX A;  3ZG7 B;  3VMA A;  2WAD A;  1CI8 A;  3IWI A;  4PM6 A;  4JXV A;  3UNW A;  1KDS A;  3W8K A;  1FR6 A;  2JCH A;  5KMW A;  4DRT A;  3E2L A;  1KGF A;  3IH8 A;  2XQZ A;  1XX2 A;  2X02 A;  4JF6 A;  2P9V B;  4JPM A;  1K56 A;  1BUE A;  5DF8 A;  2QPN A;  1YLJ A;  5F83 A;  5F1F A;  2EX8 A;  3QNB A;  3LCE A;  5FAQ A;  4EUZ A;  1PW8 A;  2JBF A;  4FH2 A;  3IF6 B;  4MNR A;  2XFT A;  2ZQ7 A;  3IHA A;  5GLB A;  2ZC7 A;  4EBN A;  3BRM A;  3BLS A;  3BLM A;  4S2N C;  1EI5 A;  1W79 A;  1K6R A;  4IVK A;  3A3F A;  3BEC A;  3C7U A;  3IQA A;  1YLT A;  4ZBE A;  4XXR A;  2ZM8 A;  1G6A A;  2V2F F;  4N9K A;  2HPB A;  3MZE A;  2EX6 A;  4U0X A;  4XUZ A;  1XKZ A;  3GRJ A;  2HDR A;  4OPY A;  1AXB A;  5A91 A;  2DCF A;  3GVB A;  4X55 A;  2V1Z A;  3ZNY A;  2J7V A;  5TR7 A;  3UE0 A;  1RGZ A;  1IEM A;  2UWX A;  4DDS A;  2ZQD A;  3UDF A;  1HTZ A;  3HLW A;  4FSF A;  3IXH A;  3AGF A;  4ZJ1 A;  4OQG A;  1LLB A;  4OOM A;  1IYO A;  2XGN A;  2Y2H A;  2H10 A;  1BSG A;  3VSL A;  4WEK A;  4BD0 A;  4K91 A;  1Z6F A;  4JKT A;  1O07 A;  2JE5 A;  5FI6 A;  2XK1 A;  3C5A A;  4UA6 A;  3Q81 A;  3O86 A;  1TEM A;  3HUN A;  4GDB A;  5U47 A;  4S2N A;  4WMC D;  2J9O A;  3BFG A;  1ERM A;  4E3M A;  3Q7V B;  5A90 A;  1NYM A;  2Y2K A;  3Q82 A;  1ZG6 A;  5E43 A;  3S4X A;  1K55 A;  5AQB A;  5L2F A;  2C5W B;  3HBR A;  1IYP A;  3O87 A;  1ZC2 A;  2Y2O A;  4JBF A;  1DJA A;  1BLH A;  4MEZ A;  5EE8 A;  5AQ9 A;  5GL9 A;  4BD1 A;  4EV4 A;  1FCM A;  3NI9 A;  3VP1 A;  3PAE A;  1FR1 A;  2WYX A;  2ZQ8 A;  2H0Y A;  3A3D A;  4P0M A;  3N8R A;  3VFH A;  2WKH A;  1Q2P A;  3RJU A;  2Y2Q A;  4JLF A;  3OZH A;  4DF6 A;  2WZZ A;  1BLC A;  2WGW A;  4GZB A;  4QU3 A;  5FAO A;  1OME A;  3ZHH A;  3VOY A;  1YMS A;  3ITA A;  3PAG A;  4LV3 A;  3WS4 A;  4LV0 A;  3GTC A;  2XLN A;  2BLS A;  3SS3 A;  2Q9N A;  3HUM A;  1I5Q A;  3NIA A;  3TOI A;  2R9X A;  3ZGA B;  4Q8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...