4N92A

Crystal structure of beta-lactamse penp_e166s
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
256
structure length
256
Chain Sequence
DDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFSPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Perturbing the General Base Residue Glu166 in the Active Site of Class A beta-Lactamase Leads to Enhanced Carbapenem Binding and Acylation
pubmed doi rcsb
molecule keywords Beta-lactamase
molecule tags Hydrolase
source organism Bacillus licheniformis
total genus 90
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4n92A00
1FCOA 3BFEA 4MLLA 3AGDA 3FWLA 3BEBA 3IWIA 5CTMA 2WGIA 1YMXA 4WELA 5TR7A 2Z2MB 3SS3A 3CZDA 1BLPA 4KZ4A 1YLWA 4FH4A 3V50A 2DCFA 3M2KA 2OLUA 1I2WA 1RP5A 4HEFA 3FV7A 1PI5A 3AGEA 5EOOA 5GHXA 1ES3A 4EBPA 2BG1A 1EWZA 4E3NA 4X55A 1IYOA 3C7UA 2WGWB 3Q7VB 1ERQA 3Q7ZA 5FQMA 1FSYA 1K55C 2XQZA 3MZFA 1WYCA 3WWXA 3A3JA 1IKGA 2HP5A 1ONHA 3NBLA 3ZGAB 3LY3A 3W4PA 2Q9NA 3BECA 1LLBA 1MWSA 2ZQDA 1NXYA 3IH9A 3M6HA 5FAPA 3HLWA 5E2HA 5CRFA 1NYYA 3BRMA 2QMIA 4IVKA 3PBQA 4OPYA 1YLPA 5CTNA 5GLAA 2C5WB 1ALQA 1DJAA 3CJMA 3O3VA 3CMZA 4JXSA 2ZC3B 3OCNA 1GA0A 2Y55A 1K25A 1GHMA 4BD0A 3PAGA 1JWZA 2Y2NA 2Y2IA 2ZLYA 4PM9A 3M2JA 3G35A 4QB8A 3VSKA 2EX6A 1K4EA 4JKTA 3SS5A 5BOHA 4OPRA 3WS0A 1HZOA 4FH2A 3UE1A 2V2FF 3N6IA 4L0LA 3HLCA 3C4OA 4HBUA 3VP4A 3ZCZA 3ZG5A 3HLDA 4X68A 4DXBA 3GR2A 1DY6A 5CERA 4C3QA 1W79A 1KGGA 1NYMA 4HBTA 2Y2JA 2Y2GA 4R3BA 5DTKA 4F94A 5F1FA 3BM6A 2E8IA 5M19A 2DNSA 3FKWA 1K56A 5I94A 4DDSA 3IXBA 4R3JA 1ESIA 1K38A 5EUAA 2ZQ9A 1MWUA 3IF6C 1KDWA 3PBNA 4LCMA 3MXRA 4N9LA 4S2NA 3ZHHA 2Y91A 5DTSA 2A49A 3N8SA 3P09A 4EBNA 1S0WA 3IWOA 5E43A 1LL9A 4E3IA 4DE1A 1GCEA 2XGNA 1CK3A 1JTDA 5FI7A 1DJCA 1LI0A 3OPLA 4KG6A 2OV5A 2ZC7A 2HDUA 4FCFA 3V3RA 2B5RA 2X01A 3D4FA 2PBYA 1K57C 2HDQA 2ZC4B 4A5RA 3VMAA 1XXMA 3MZDA 5U47A 3WRZA 3ZG9B 5FA7A 4UA9A 1YT4A 3GRJA 3PBTA 4P87A 1FR6A 1SHVA 1W8QA 2ZQCA 1PWDA 3OPPA 1LHYA 3NIAA 1TEMA 5HL1A 1SCWA 4PM8A 3ITAA 4DE0A 1VM1A 2ZC6B 5EOEA 5KMWA 3FKVA 4DXCA 1SDEA 2ZQAA 3NY4A 3HBRA 3IXGA 4DE3A 4JF4A 2FFFB 2J9OA 4P6BA 1Z6FA 3UE3A 5FAQA 4ZDXA 3RXWA 1KGEA 2EX8A 5FI6A 3E2LA 4E3KA 1E25A 4E3JA 2X71A 1S6RA 4O7DA 1QMEA 3ZG0A 4GOGA 4RVAA 4R4RA 4IEDA 2WKHA 4MBHA 2H0TA 2ZM8A 4B88A 1MKIA 3OPRA 4Y0OA 3ITBA 5EVID 3LY4A 5CHJA 1FSWA 2XFSA 1G68A 2HDRA 4QY6A 1XKZA 2XFTA 1MWTA 3TOIA 2WYXA 1E3UD 3BFGA 5CHUA 2DRWA 5FSRA 2IWCA 3ZVWA 5KZHA 1N4OA 1MWRA 4X69A 3ZDJA 4WYYA 2ZQ8A 2EX2A 3V39A 3ZFZA 2JE5A 4YFMA 4PM5A 2XDMA 1L0GA 3G2ZA 2CC1A 3C4PA 4MBFA 4GDBA 3IF5A 5EECA 4NETA 1LL5A 2G2WA 3C5AA 1ES2A 4LV3A 3BFCA 4QHCA 3RJUA 5GHYA 4K0WA 4KG5A 4XXRA 4PM7A 2G2UA 4ZJ1A 2VGJA 3G32A 1RGYA 1N9BA 4YINA 3EQVA 2V20A 1L0DA 3M6BA 4ZBEA 3IT9A 2WAFA 2P9VA 5CGWA 1M40A 2XEPA 3WS2A 1U60A 3B3XA 3W4QA 5KSHA 1OMEA 4OPQA 5DF8A 4JPMA 1JVJA 4ZJ2A 1XA1A 5CGSA 4JF5A 4D2OA 1ERMA 1WYBA 1CEFA 1CI9A 4WMCA 4WM9A 1MY8A 1O07A 2A3UA 4OOLA 4OKPA 3IWQA 2EXBA 4CPKA 1PZPA 3QNCA 4GB7A 2Y59A 2WZZA 3UDXA 5CEBA 3UN7A 4UHUA 3PBOA 4R1GA 1FCNA 4OP5A 3PAEA 4JBFA 4GZBA 4Y0UA 3UPPA 4MEZA 1JTGA 3MFDA 3I7JA 1YLJA 1K4FA 4HESA 4XUXA 1K57A 3W8KA 4GD6A 4X53A 2RL3A 5D3OA 4R23A 3O88A 3S4XA 3PTEA 3OCLA 2ZD8A 5FI2A 3VP0A 2R9WA 5EPHA 1K54C 1RCJA 4Y0TA 2WKIA 2Q9MA 1O7EA 1JWVA 2J7VA 1HD8A 3BLSA 3GV9A 2WGWA 5EVIA 5FQQA 5E2FA 4N92A 4S2PA 2IWBA 3Q07A 3FZCA 1HVBA 3V5MA 4UA7A 5E2GA 4LV0A 3GQZA 5FQKA 3RXXA 3Q1FA 3GVBA 4IBXA 4C6YA 4GD8A 5FDHA 3G2YA 3UDFA 1BLCA 4MNRA 3G34A 5HAIA 4DKIA 3A3EA 4LV2A 2HDSA 4PPRA 1ES4A 4OQ0A 3JYIA 5GLBA 3WS5A 1QMFA 3HVFA 3VFFA 3W4OA 1C3BA 1MBLA 3WS4A 4DRTA 5IHVA 1H8YA 1M6KA 2PU4A 2Y2QA 1YLZA 2OLVA 4KZ5A 1BTLA 1FCMA 3S22A 2WK0A 1ZKJA 1PI4A 5FQJA 3A3IA 3NDGA 1KDSA 1ES5A 2WKEA 4LENA 4OLDA 3GTCA 4KQQA 1YLYA 4KG2A 3VP1A 3VFHA 4H8RA 5M18A 1Q2PA 1IKIA 3NDEA 1SDNA 1VQQA 2HP6A 3N7WA 3WS1A 4DDYA 5F1GA 3IHBA 3UE0A 3G4PA 5AQBA 4RYEA 4EUZA 1TDGA 3FYZA 4GNUA 4BJPA 5F83A 1IELA 1H8ZA 1XGJA 4U0XA 4P85A 3UDIA 4EV4A 1KVLA 1IYQA 1BSGA 2P9VB 1K55A 4WZ5C 4JLFA 1PZOA 4FSFA 4KZ7A 2EFUA 3HLBA 2V1ZA 3VP2A 1XA7A 4S2NC 4WEKA 3SH8A 3N8RA 5KSCA 3G31A 4C75A 3DWZA 2WADA 4RX3A 1JWPA 4OH0A 2GDNA 4BL2A 2XK1A 4JXWA 4S2JA 3OPHA 3ZNYA 1YQSA 5HARA 1IYPA 4OOMA 4K0XA 4OPZA 3NCKA 1CEGA 5EE8A 1XPBA 1GHPA 5A90A 4KZAA 1FQGA 2Y4AA 2EXAA 3PBRA 5HX9A 2Y2LA 1MXOA 1NJ4A 3VSLA 2ZM2A 3MZEA 4BL3A 3BFFA 5CECA 4UA6A 1KGFA 1XGIA 4BQMA 2Y2HA 5A93A 4P0MA 1ZG6A 4B4ZA 1XP4A 1L2SA 1ZG4A 1NY0A 3Q81A 2XH9A 4OP8A 1TDLA 1GA9A 2Y2OA 1K54A 4LV1A 5GLCA 4QD4A 1Q2QA 4KQRA 1FR1A 5FQ9A 1K6SA 1NZOA 1H5XA 1SKFA 2QPNA 3HUNA 4DF6A 3DTMA 1MPLA 1I5QA 1IYSA 3GMWA 5JYPA 2HP9A 5DVAA 2WAEA 3WRTA 3LEZA 4PMAA 3IF6A 2HPBA 5EVIB 1AXBA 2JBFA 5A91A 4DE2A 1PIOA 5FQIA 5AQAA 1BULA 3Q82A 3UO9A 3OC2A 3QHYA 1EI5A 3MXSA 5CGXA 3VP3A 5DF7A 5FASA 2XD1A 4KENB 4N9KA 4BLMA 4MBKA 4E6XA 5GHZA 5L2FA 1KE4A 4KZBA 4EBLA 4S2MA 2C6WB 3HLGA 3LCEA 4XUZA 4M3KA 5TFQA 4KZ3A 4X6TA 2PU2A 4N1HA 2XF3A 1RGZA 5JYOA 4NK3A 4IVIA 1W8YA 3GSGA 5CXWA 4Z9QA 2P74A 4PM6A 1XX2A 3BFDA 3ZVTA 3AGFA 4Y7PA 2WGVA 5GL9A 3Q7VA 3HL9A 1LI9A 1PWGA 1L0FA 1YLTA 2ZC5B 3O87A 3SS4A 4E6WA 3N8LA 3G30A 3UY6A 4ID4A 2XLNA 1BLHA 2Y2MA 4EWFA 3O86A 1E3UA 3ZG7B 2FFYA 3HLEA 5TGFA 2Y2PA 4JF6A 2ZMAA 3A3FA 4KZ9A 2BLSA 1PW1A 5E2EA 5HFOA 5CEDA 2Z2LB 3MKEA 3LO7A 3ISGA 3QNBA 4OQHA 4B4XA 4S2OA 4IBRA 4WEJA 4S2LA 3V3SA 4QJGA 5HW3A 3E2KA 3PBSA 4LCLA 4WZ5A 4BD1A 4OLGA 4GDNA 1J9MA 4WBGA 2XR0A 5J8XA 2EFXA 1I2SA 4X56A 1WE4A 4WMCD 5A92A 4OVDA 2I72A 3UPNA 1BUEA 4R4SA 5EVLA 3TSGA 3IXDA 3VOZA 1DJBA 2H10A 2UWXA 5HAPA 4CJNA 1G6AA 5FAOA 3A3DA 4K91A 2WZXA 4GKUA 4ZJ3A 4S2KA 3VOYA 1BZAA 2XD5A 4JXGA 1ZC2A 3ZG8B 4S2IA 3MKFA 4UAAA 2ZJ9A 4E3OA 1NRFA 2ZM0A 1W5DA 4OONA 4ZAMA 1KE0A 1YMSA 3HREA 5AQ7A 2OSUA 4OQGA 2EX9A 2H5SA 4KQOA 4OQIA 5GLDA 3HUMA 3IH8A 1ESUA 5CHMA 4U3TA 3SOIA 5DTTA 5EVIC 1PW8A 5M1AA 3NC8A 4GN2A 5HAQA 2H0YA 1CI8A 4QU3A 2J8YA 3S1YA 3DWKA 4E3LA 2JC7A 3SH7A 1TVFA 2J9PA 3HLFA 3UNWA 3OZHA 4KZ8A 1KE3A 4RX2A 1HTZA 1ONGA 1BLSA 1KVMA 3MBZA 3DW0A 4N1XA 1PWCA 2JCHA 5G18A 3TG9A 1W7FA 2WUQA 3HUOA 4KZ6A 1NZUA 1K56D 4ZTKA 2QZ6A 2RCXA 3CG5A 4BENA 1EROA 1L0EA 3C7VA 3P98A 1FOFA 1BT5A 5AQ9A 2ZQ7A 4RA7A 4Q8IA 4U0TA 2IWDA 4QY5A 3SH9A 4EQIA 3IF6B 1PYYA 1K6RA 4R0QA 1Y54A 1IEMA 3EQUA 4OOYA 3BYDA 3UPOA 5FATA 1E4DA 3N4IA 2Y2KA 2VGKA 4JXVA 1YM1A 5DF9A 4WZ4A 3IHAA 4FD8A 3BLMA 3IQAA 1GHIA 5F82A 2X02A 3NI9A 3ZNTA 3IXHA 4E3MA 2R9XA
chains in the Genus database with same CATH superfamily
4HHDA 1V9ZA 5CTMA 2J3WA 2GZAA 3V50A 4FH4A 4PHTA 3M2KA 4CLCE 2OLUA 1I2WA 4HEFA 4X55A 3Q7VB 3ICYA 2Z6DA 3A3JA 1Y28A 3LY3A 5E2HA 5AVEA 5CRFA 4IVKA 5GLAA 5CTNA 4LFUA 2C5WB 3T1SA 1ALQA 1DJAA 4HP9A 3KYEA 3O3VA 3CUEA 3LICA 1K25A 1GHMA 4GLQA 1NRJA 4PM9A 3G35A 4QB8A 4JKTA 3UE1A 4L0LA 3GR2A 1S4SA 3BM6A 4G3KA 5I94A 2GJ3A 3QP4A 3IXBA 5EUAA 2ZL1A 3MXRA 3PR6A 4Y15A 3ZHHA 3P7NA 3IWOA 1LL9A 4E3IA 2XGNA 1JTDA 4M4XA 1DJCA 3OPLA 4NG2A 1DRMA 3LIBA 2X01A 2PBYA 2HDQA 2ZC4B 3VMAA 3WRZA 5U47A 4UA9A 3PBTA 1W8QA 3OPPA 1SCWA 3ITAA 5EOEA 1YSQA 2W27A 1SDEA 2ZQAA 3IX3A 4DXCA 3IXGA 3MF0A 2J9OA 4NKPA 4P6BA 1Z6FA 3UE3A 3V67A 4E3KA 4O7DA 4GCZA 4IEDA 2WKHA 4MBHA 2ZM8A 1F2KA 1MKIA 3OPRA 5EVID 3LY4A 2XFSA 4BWIA 1G68A 2ZMFA 3T4TA 3KSFA 5FDSA 3TOIA 2W3HA 1AWIA 3G6OA 3UB7A 1S66L 2EWWA 3ZFZA 3T4SA 3KSHA 2XDMA 1L0GA 2KX6A 2V9AA 2QJ5A 3TW8A 3G32A 3CPTB 3IT9A 2P9VA 5CGWA 2HJEA 5KSHA 1OMEA 4EERA 1CI9A 3F1PB 5HWVA 2Y59A 3UN7A 4UHUA 3PBOA 1D1JA 4JBFA 4Y0UA 1PRQA 3QP1A 1YLJA 1K57A 3W8KA 2O9AA 5EM1A 4R23A 3T1QB 2ZD8A 3BLSA 3KSGA 2WGWA 5J4EA 4N92A 2JN7A 3FZCA 4UA7A 3VE4A 4UQIS 5FQKA 4Y3IA 3GVBA 2KLIA 3UDFA 5HPFA 4EEPA 5TBMB 3HJKA 1XJ2A 4PPRA 2O99A 3DBAA 3JYIA 4H6JA 4MN5A 2A24B 2IA2A 3W4OA 1MBLA 3UB6A 3F1OB 4DRTA 1H8YA 2XROA 2Y2QA 3IS2A 1FCMA 1VETA 3T1RA 1ZKJA 2WKEA 4OLDA 2FZ0A 3GTCA 3VOLA 3UB5P 4KQQA 4KG2A 3NDEA 5AQBA 2W3EA 5AVFA 3K3DA 1H3QA 4GW9A 1K55A 4JGQA 4KZ7A 3HLBA 2V1ZA 3B33A 1XA7A 4RX3A 1JWPA 2GDNA 2AVXA 2PR5A 3IBRA 4OOMA 4OPZA 3NCKA 1GSVA 2PD8A 2VX8A 2EWVA 1FQGA 4R70A 2Y4AA 2Y2LA 4G3VA 2WKQA 1NJ4A 3VSLA 2W3GA 3BFFA 4UA6A 1KGFA 3QP6A 3TJZC 4P0MA 1ZG4A 1NY0A 2V1AA 5FQ9A 1H5XA 3DTEA 2WAEA 3MQ0A 3IF6A 2HPBA 4NXGA 3TRCA 2P7JA 1PIOA 5AQAA 2ZL1B 3UO9A 3QHYA 1NLZA 5FASA 4FTXA 2XD1A 4Y13A 4X1MA 4BLMA 4E6XA 4KUOA 5L2FA 2KDKA 1KE4A 4EBLA 3LCEA 4N1HA 2ZOIA 4IVIA 5CXWA 4EESA 1XX2A 3ZVTA 4L9EA 3Q7VA 1PWGA 1L0FA 2ZC5B 3GECA 2J3TD 2NUTC 2W3DA 2Y2MA 4EWFA 3O86A 3K3CA 3ZG7B 3U4LP 4KZ9A 2FH5A 3LGOA 3QNBA 3ISGA 4S2OA 4WZ5A 3PBSA 4LCLA 3QP5A 2INWA 4OLGA 4WBGA 4L9FA 2XR0A 5J8XA 2VKSA 3UMEA 4WLAA 4WMCD 4OVDA 5EVLA 3IXDA 5HD3A 2WZXA 4ZJ3A 3VOYA 2HF6A 3BQAA 3ZG8B 2ZJ9A 4P6ZM 1ZTUA 2H5SA 4HP4A 4BBVA 3IH8A 4CQHA 3DAVA 5EVIC 3A0RA 1PW8A 5M1AA 5HAQA 4GN2A 3S1YA 3DWKA 5KIZA 3UNWA 1KE3A 3C30A 3OBFA 4N1XA 3DW0A 3C38A 2JCHA 1W7FA 4KZ6A 4ZTKA 1EROA 3P98A 5IU1A 2ZQ7A 3LR5A 3PYPA 3MMHA 4EQIA 1PYYA 2VZWA 1TS7A 3UPOA 2O0YA 1E4DA 4JGRA 2JKRI 5DF9A 4BBUA 1MZUA 3NJAA 4E3MA 1FCOA 4LPZA 3BEBA 4EQ1A 2WGIA 1YMXA 5CX7A 3D9YA 1H8MA 1RP5A 1PI5A 5EOOA 2ACGA 2BG1A 1EWZA 4E3NA 1IYOA 1NLYA 2WGWB 1ERQA 2XQZA 3WWXA 3D3OA 2YKHA 1UWNX 3EEAA 5HPIA 3KSIA 2Q9NA 3BECA 2OWJA 2ZQDA 3IH9A 3M6HA 4OPYA 3MJQA 3CJMA 4JXSA 1JWZA 2Y2IA 1FIKA 1T18A 3WS0A 1HZOA 4FH2A 4QWOA 3IX4A 2V2FF 3F1PA 4HBUA 3ZCZA 3HLDA 4C3QA 5IT5A 2Y2JA 4NEED 2ZQ9A 1D7EA 3PBNA 4N9LA 4R3AA 3LUQA 2Y91A 2A49A 4ETZA 5E43A 1GSXA 1GCEA 1LI0A 4QPRA 2HDUA 4WN5A 3D4FA 3EEHA 4A5RA 1ACFA 1XXMA 3ZG9B 1F5MA 1UWPX 1OTAA 2ZQCA 4MDZA 5HL1A 1TEMA 4PM8A 4DE0A 1VM1A 1P9RA 1OPXA 2K2NA 1DP9A 4ZDXA 5TBMA 1E25A 2X71A 1QMEA 4GOGA 4R4RA 2H0TA 2A24A 3F1OA 4Q0JA 2VV8A 4QY6A 2XFTA 3S7QA 1N4OA 1MWRA 4X69A 3V39A 2JE5A 1OT6A 4PM5A 2QHKA 4GDBA 5EECA 2Z6CA 2PDRA 5HZHA 2V0UA 2LB9A 4XXRA 3S7OA 3LEQA 4YINA 1G28A 3R7WB 1L0DA 2XA7S 4ZBEA 2WAFA 1M40A 3WS2A 1U60A 3B3XA 3W4QA 5DF8A 1OTDA 2WKRA 2A2LA 2PBDP 1WYBA 4WMCA 2QJ7A 4OKPA 3QNCA 4MN7A 4OP5A 4CLCC 2YKFA 3QP2A 2VEAA 4P6ZS 5J3WA 1K4FA 4XUXA 4X53A 2RL3A 5D3OA 4Y17A 3O88A 3S4XA 3PTEA 3BW6A 4YNRA 5FI2A 2R9WA 5EPHA 1K54C 2J7VA 1JWVA 5FQQA 2GX5A 2IWBA 3Q07A 3V5MA 5E2GA 3GQZA 3Q1FA 4C6YA 1P9WA 3G34A 4DKIA 3CWFA 4LV2A 2I9VA 4LRXC 1ES4A 4OQ0A 2M7VA 3GDIA 2PR6A 3HVFA 3B42A 5HDDA 1STZA 1C3BA 5IHVA 4O0PA 3E4OA 1BTLA 3E98A 1PI4A 1ES5A 4LENA 3CUEC 2W0NA 4Y5FA 3L7HA 2PYRA 4H8RA 3N7WA 1MKMA 3WS1A 3IHBA 3IX8A 2PT7A 4EUZA 4GNUA 1H8ZA 1XGJA 4EV4A 1KVLA 3RH8B 5HDCA 1PZOA 4FSFA 3A0SA 3EOIA 3VP2A 3U2AA 4WEKA 3G31A 3BWLA 4C75A 3DWZA 4OH0A 3OOVA 3BY8A 2XK1A 3S7PA 4S2JA 3ZNYA 1YQSA 4IUKA 1CEGA 4KZAA 5I5LA 2QKPA 3PBRA 1W63Q 5CECA 3MS6A 5HDSA 1YSPA 1XGIA 2Y2HA 5A93A 1TF1A 3DTKA 4B4ZA 1XP4A 3EWKA 2XH9A 4OP8A 1TDLA 4LV1A 1Y4OA 3E4PA 2QPNA 4HJ3A 1IYSA 4PMAA 3NECA 4YWZA 1AXBA 5A91A 5HWTA 1BULA 4EETB 5A8BA 3MXSA 3VP3A 5DF7A 4KENB 4N9KA 4MBKA 3HLGA 5TFQA 2MJ6A 4NK3A 3TE8A 3GSGA 4Z9QA 2P74A 3AGFA 3O87A 3SS4A 3N8LA 3UY6A 1FILA 3T4JA 1BLHA 3P01A 1VEUB 3HLEA 5TGFA 2XRNA 2ZMAA 3SZTA 3JVVA 4NXBA 2BLSA 3UB8A 5CEDA 2Z2LB 4B4XA 4S2LA 3E2KA 4I3IA 4GDNA 3E4QA 1I2SA 4X56A 4R4SA 4CJNA 4K91A 4GKUA 4S2KA 2XD5A 4JXGA 1ZC2A 2V8CA 3MKFA 4UAAA 4MCWA 2PAVP 1KE0A 2OSUA 5FEFA 3HUMA 1T19A 5CHMA 4U3TA 1LL8A 4ZRRA 1IOUA 1S1YA 4QU3A 4HI4A 2J8YA 3SH7A 2J9PA 3HLFA 2R78A 2V1BA 1MC0A 5G18A 2QZ6A 1L0EA 4PKYA 1BT5A 5AQ9A 4Q8IA 2WKPA 3SH9A 4R0QA 3L9KA 3LIAA 2Y2KA 4B93A 3LFVA 3IHAA 1K0KA 3BLMA 1GHIA 3HJIA 4HY8A 5DTSA 3FWLA 2Z2MB 1BLPA 3B47A 2JKTM 2DCFA 1CJFA 3FV7A 5GHXA 3RFBA 5FQMA 1FSYA 1K55C 3MZFA 3IBJA 3EGXC 1WYCA 5HSQA 3MXQA 2HP5A 1ONHA 3ZGAB 3W4PA 5DFXA 1MWSA 1NXYA 3MQOA 5EFWA 3F1NA 3R7WA 1DP8A 2QWSA 1UGUA 3LI9A 2OOLA 3CMZA 2ZC3B 3OCNA 2Y55A 2PYPA 2XA7M 3H82B 3PAGA 2Y2NA 5DJUA 2ZLYA 3M2JA 2EX6A 3SS5A 5BOHA 3NOUC 5F5YA 3HLCA 4X68A 1DY6A 4LRZE 5CERA 4K08A 1NYMA 2Y2GA 4F94A 5F1FA 3QP8A 3FPWA 5HL6A 3BY9A 3CITA 5M19A 2E8IA 4I3JA 2DNSA 1K56A 4DDSA 4L9GA 1ESIA 1MWUA 3IF6C 4LCMA 5F69A 4S2NA 5J7EA 1ZHHB 1TD5A 4AFIA 4E04A 5DJTA 4EBNA 4DE1A 1CK3A 4IUHA 4EW7A 4FCFA 3V3RA 1P97A 3MZDA 1YT4A 3GRJA 4P87A 1FR6A 1SHVA 1PWDA 5EV0A 5KMWA 2ZC6B 3FKVA 1YAXA 1W63M 3NY4A 3HBRA 4JF4A 2FFFB 5FAQA 1KGEA 2V8FA 5MC7A 5FI6A 3LIEA 3KYQA 4E3JA 1S6RA 3ZG0A 4RVAA 1L3LA 4Y0OA 3W2ZA 5CHJA 1FSWA 2H28A 4R38A 2HDRA 1CF0A 1P0ZA 1XKZA 1OJ5A 1E3UD 5CHUA 3ULFA 2IWCA 5KZHA 5HWWA 5L8MA 2ZQ8A 3SW1A 1EW0A 4YFMA 4I3AA 2CC1A 4MBFA 1T1AA 3IF5A 1N9NA 4NETA 1ES2A 4QHCA 4ME4A 5GHYA 4K0WA 3UB9A 4KG5A 2DMWA 3C2WA 4ZJ1A 1RGYA 3JPUA 2V20A 2HZ5A 3T50A 3E0YA 4DN0A 4JPMA 5CGSA 2PRFA 4D2OA 1CEFA 3CLOA 5EM0A 1MY8A 4X25A 2W1TA 5TJJA 1O07A 1Z09A 1ODVA 4OOLA 3IWQA 2EXBA 1F98A 4IJGA 3LR3A 1F9IA 3LIFA 4NXFA 3PAEA 4KUKA 4GHIB 4GZBA 4MEZA 1S4RA 3I7JA 4HESA 4GD6A 4Q0HA 3OCLA 1RCJA 3GV9A 2PHYA 1TS0A 4S2PA 1CQAA 4EU0A 5L10A 5FDHA 3LIDA 1BLCA 5HAIA 2JKRM 3A3EA 2VLGA 3HCYA 2M7UA 2XSSA 3WS5A 2O9BA 2B18A 3VFFA 2L1MA 2OLVA 3FC7A 2WK0A 3A3IA 3NDGA 1VEUA 1YLYA 3T1XA 3VFHA 1SDNA 2HP6A 1WA9A 5F1GA 3G4PA 4RYEA 1LSXA 3FYZA 4BJPA 5F83A 1IELA 4U0XA 1IYQA 2LB5A 4O01A 3VV4A 4FUWA 2M1CA 3SH8A 5KSCA 1G5UA 1SKOB 2WADA 4Q0IA 4JXWA 4WUJA 5HARA 1IYPA 4K0XA 2VJWA 5EE8A 1GHPA 3F1NB 4CLCA 5A90A 2EXAA 2P08A 4GJ4A 1MXOA 4BL3A 4WL9A 4BQMA 3T12B 3Q81A 4ESPA 1GA9A 2Y2OA 1K54A 5GLCA 4KQRA 1FR1A 1K6SA 1SKFA 3HUNA 4DF6A 3DTMA 1MPLA 1I5QA 3GMWA 5JYPA 4IHQA 4Y2FA 3WRTA 3LEZA 5EVIB 4DE2A 3Q82A 1EI5A 4R6LA 5F68A 4Z1WA 3D72A 2K7SA 2C6WB 4KZ3A 2J3TC 5JYOA 1W8YA 3BFDA 5GL9A 4GS9B 4E6WA 1D06A 4D60A 2GNXA 1E3UA 4JF6A 3PXPA 1J3WA 4HIAA 2B95A 5HFOA 4OQHA 4IBRA 4BD1A 5C5KA 5G4ZA 1J9MA 2EFXA 1WE4A 3H82A 5FEGA 4XT2A 5A92A 3UPNA 1X0OA 3VOZA 2H10A 3NULA 1IFQA 2L0WA 3T4QA 4I38A 4BMWA 1NRFA 3KX0X 4YOFA 4ZAMA 1YMSA 3HREA 5AQ7A 4HJ4A 2EX9A 4KQOA 5LBRA 2NUPC 3SOIA 5DTTA 1CI8A 2JC7A 4LGWA 5DFYA 3OZHA 4RX2A 3K2NA 3R4KA 1BLSA 1KVMA 3MBZA 2D01A 3TG9A 2WUQA 5F6AA 1JNUA 1K56D 2W1TB 3CG5A 3FPVA 1FOFA 4I5SA 4U0TA 2IWDA 1Y54A 3BYDA 5FATA 3OLOA 2ZOHA 3IQAA 4RQ9A 2X02A 4ARZA 3ZNTA 2R9XA 3BFEA 4MLLA 2JKFA 3AGDA 1PNEA 4BBTA 3IWIA 1N9LA 4WELA 5TR7A 3SS3A 3CZDA 3PHYA 4KZ4A 1YLWA 4EUVA 2ZBBA 3AGEA 4EBPA 1ES3A 3C7UA 3Q7ZA 1IKGA 3NBLA 1TS6A 1LLBA 2J80A 3H9WA 3BJNA 5FAPA 3HLWA 3T4KA 1NYYA 1XJ6A 3BRMA 3LI8A 2QMIA 3PBQA 1YLPA 3RTYA 4PAUA 5K5BA 1GA0A 3JVUA 4BD0A 4KQDA 3VSKA 1K4EA 4OPRA 2VV7A 3N6IA 3LYXA 3VP4A 3C4OA 3ZG5A 4DXBA 4B9OA 3H7WA 1W79A 1KGGA 4HBTA 4R3BA 5DTKA 2VV6A 3FKWA 4R3JA 1K38A 2QYBA 1KDWA 3NOTC 2Y8HA 4GHIA 1S67L 4FOFA 1TS8A 3N8SA 3P09A 1S0WA 1OTEA 1LT0A 5FI7A 2CMNA 4PKYG 4KG6A 2OV5A 2ZC7A 2JKTI 2B5RA 1K57C 5FA7A 1N9OA 4G3WA 1LHYA 3NIAA 4CLCB 4DE3A 2W1RA 4F3LA 3UE6A 2OWHA 3RXWA 2EX8A 3E2LA 2UV0E 4B88A 3ITBA 1VHMA 1MWTA 2WYXA 3BFGA 3ZVWA 2DRWA 5FSRA 3CHWP 3MQQA 3ZDJA 4HH3A 4WYYA 2E8JA 2EX2A 5FL3A 5HD5A 4I39A 3G2ZA 3C4PA 1LL5A 2G2WA 3C5AA 2EA9A 3BFCA 4LV3A 3RJUA 4II7A 1A0KA 3LR4A 5DKLA 4PM7A 2G2UA 2VGJA 2HJ9C 1N9BA 3EQVA 3M6BA 2VGLM 1OJGA 2XEPA 4JGOA 3MR0A 4OPQA 1JVJA 4ZJ2A 1XA1A 1SKOA 4JF5A 3BQ8A 1ERMA 4WM9A 2JKGA 3ZYTA 2A3UA 4NXEA 3KO6A 4CPKA 2VA0A 1PZPA 4GB7A 2WZZA 3UDXA 4HNBA 5CEBA 4R1GA 1FCNA 3UPPA 3KYZA 4XT2B 4HJ6A 1JTGA 5AJGA 1OTBA 3MFDA 2Y79A 3S7NA 3ZQ5A 4CLCD 4HQAA 3VP0A 4Y0TA 2WKIA 2Q9MA 1O7EA 5EVIA 1HD8A 5E2FA 1HVBA 4LV0A 4EEUA 2G7UA 1OTIA 3RXXA 1OT9A 4IBXA 1SZVA 4GD8A 5G4YA 3CAXA 3G2YA 1XJ3A 2VK3A 4MNRA 2HDSA 1NWZA 5GLBA 3C8CA 1XJ4A 1QMFA 3T4OA 3WS4A 1M6KA 2PU4A 1YLZA 4O8GA 4GS9A 4KZ5A 3S22A 5FQJA 1KDSA 4HOIA 1BYWA 5DKKA 4DJ3A 3VP1A 2ZMVA 4ARZB 5M18A 1Q2PA 3NHQA 1IKIA 2KOIA 1VQQA 4DDYA 3MFXA 3UE0A 2W3FA 3MSHA 1TDGA 3CI6A 3UDIA 4P85A 1BSGA 2P9VB 4WZ5C 4JLFA 3EGDC 4LRYC 2BTFP 2EFUA 4S2NC 3N8RA 2HGVA 4BL2A 4JGPA 3OPHA 2Q0OA 2K31A 1XPBA 4EXOA 4LLOB 5HX9A 3NOPC 2ZM2A 3MZEA 1ZG6A 4DJ2A 2PD7A 1L2SA 2BASA 3H7WB 1Q2QA 4QD4A 1NZOA 2HP9A 5DVAA 4WF0A 3DTIA 2JBFA 5FQIA 1VB6A 5IS1A 3OC2A 1XFNA 5CGXA 3UMDA 2V0WA 5EVEA 5GHZA 4KZBA 4S2MA 2L4RA 4XUZA 4M3KA 4X6TA 3VE3A 4ETXA 2PU2A 4H6JB 2XF3A 3CPTA 1RGZA 4PM6A 3FG8A 4Y7PA 2WGVA 1S1ZA 3IS2B 1YPRA 3HL9A 1LI9A 1YLTA 1VETB 4MMNA 3G30A 3T4LA 4ID4A 2XLNA 4F3LB 2FFYA 2Y2PA 4DMZA 3A3FA 1PW1A 5E2EA 4MN6A 3MKEA 3LO7A 3A0VA 4WEJA 3V3SA 4QJGA 5HW3A 1T1BA 4UEYA 2D02A 2OAP1 2I72A 1BUEA 3TSGA 4X1LA 1DJBA 2UWXA 5HAPA 1G6AA 5FAOA 3A3DA 1DP6A 1BZAA 2O9CA 4S2IA 4HH2A 1LSWA 4E3OA 1GSWA 1PFLA 2ZM0A 1W5DA 4OONA 2VGLS 1HLUP 4OQGA 2P04A 1XFQA 4OQIA 5GLDA 1ESUA 1LSVA 1V9YA 3NC8A 2B02A 2H0YA 4E3LA 1TVFA 2OAQ1 4KZ8A 1HTZA 1ONGA 3LR0A 4UQIM 1T1CA 1PWCA 1KOUA 1H0MA 3HUOA 1NZUA 2RCXA 4BENA 3C7VA 4RA7A 2HV1A 3O5YA 4QY5A 3IF6B 1K6RA 1G6OA 1IEMA 1YKDA 3EQUA 2JHEA 4OOYA 5L07A 3N4IA 2VGKA 4JXVA 1YM1A 4WZ4A 4FD8A 5F82A 5L09A 3NI9A 3IXHA
chains in the Genus database with same CATH topology
1FCOA 3BFEA 4MLLA 3AGDA 3FWLA 3BEBA 3IWIA 5CTMA 2WGIA 1YMXA 4WELA 5TR7A 2Z2MB 3SS3A 3CZDA 1BLPA 4KZ4A 1YLWA 4FH4A 3V50A 2DCFA 3M2KA 2OLUA 1I2WA 1RP5A 4HEFA 3FV7A 1PI5A 3AGEA 5EOOA 5GHXA 1ES3A 4EBPA 2BG1A 1EWZA 4E3NA 4X55A 1IYOA 3C7UA 2WGWB 3Q7VB 1ERQA 3Q7ZA 5FQMA 1FSYA 1K55C 2XQZA 3MZFA 1WYCA 3WWXA 3A3JA 1IKGA 2HP5A 1ONHA 3NBLA 3ZGAB 3LY3A 3W4PA 2Q9NA 3BECA 1LLBA 1MWSA 2ZQDA 1NXYA 3IH9A 3M6HA 5FAPA 3HLWA 5E2HA 5CRFA 1NYYA 3BRMA 2QMIA 4IVKA 3PBQA 4OPYA 1YLPA 5CTNA 5GLAA 2C5WB 1ALQA 1DJAA 3CJMA 3O3VA 3CMZA 4JXSA 2ZC3B 3OCNA 1GA0A 2Y55A 1K25A 1GHMA 4BD0A 3PAGA 1JWZA 2Y2NA 2Y2IA 2ZLYA 4PM9A 3M2JA 3G35A 4QB8A 3VSKA 2EX6A 1K4EA 4JKTA 3SS5A 5BOHA 4OPRA 3WS0A 1HZOA 4FH2A 3UE1A 2V2FF 3N6IA 4L0LA 3HLCA 3C4OA 4HBUA 3VP4A 3ZCZA 3ZG5A 3HLDA 4X68A 4DXBA 3GR2A 1DY6A 5CERA 4C3QA 1W79A 1KGGA 1NYMA 4HBTA 2Y2JA 2Y2GA 4R3BA 5DTKA 4F94A 5F1FA 3BM6A 2E8IA 5M19A 2DNSA 3FKWA 1K56A 5I94A 4DDSA 3IXBA 4R3JA 1ESIA 1K38A 5EUAA 2ZQ9A 1MWUA 3IF6C 1KDWA 3PBNA 4LCMA 3MXRA 4N9LA 4S2NA 3ZHHA 2Y91A 5DTSA 2A49A 3N8SA 3P09A 4EBNA 1S0WA 3IWOA 5E43A 1LL9A 4E3IA 4DE1A 1GCEA 2XGNA 1CK3A 1JTDA 5FI7A 1DJCA 1LI0A 3OPLA 4KG6A 2OV5A 2ZC7A 2HDUA 4FCFA 3V3RA 2B5RA 2X01A 3D4FA 2PBYA 1K57C 2HDQA 2ZC4B 4A5RA 3VMAA 1XXMA 3MZDA 5U47A 3WRZA 3ZG9B 5FA7A 4UA9A 1YT4A 3GRJA 3PBTA 4P87A 1FR6A 1SHVA 1W8QA 2ZQCA 1PWDA 3OPPA 1LHYA 3NIAA 1TEMA 5HL1A 1SCWA 4PM8A 3ITAA 4DE0A 1VM1A 2ZC6B 5EOEA 5KMWA 3FKVA 4DXCA 1SDEA 2ZQAA 3NY4A 3HBRA 3IXGA 4DE3A 4JF4A 2FFFB 2J9OA 4P6BA 1Z6FA 3UE3A 5FAQA 4ZDXA 3RXWA 1KGEA 2EX8A 5FI6A 3E2LA 4E3KA 1E25A 4E3JA 2X71A 1S6RA 4O7DA 1QMEA 3ZG0A 4GOGA 4RVAA 4R4RA 4IEDA 2WKHA 4MBHA 2H0TA 2ZM8A 4B88A 1MKIA 3OPRA 4Y0OA 3ITBA 5EVID 3LY4A 5CHJA 1FSWA 2XFSA 1G68A 2HDRA 4QY6A 1XKZA 2XFTA 1MWTA 3TOIA 2WYXA 1E3UD 3BFGA 5CHUA 2DRWA 5FSRA 2IWCA 3ZVWA 5KZHA 1N4OA 1MWRA 4X69A 3ZDJA 4WYYA 2ZQ8A 2EX2A 3V39A 3ZFZA 2JE5A 4YFMA 4PM5A 2XDMA 1L0GA 3G2ZA 2CC1A 3C4PA 4MBFA 4GDBA 3IF5A 5EECA 4NETA 1LL5A 2G2WA 3C5AA 1ES2A 4LV3A 3BFCA 4QHCA 3RJUA 5GHYA 4K0WA 4KG5A 4XXRA 4PM7A 2G2UA 4ZJ1A 2VGJA 3G32A 1RGYA 1N9BA 4YINA 3EQVA 2V20A 1L0DA 3M6BA 4ZBEA 3IT9A 2WAFA 2P9VA 5CGWA 1M40A 2XEPA 3WS2A 1U60A 3B3XA 3W4QA 5KSHA 1OMEA 4OPQA 5DF8A 4JPMA 1JVJA 4ZJ2A 1XA1A 5CGSA 4JF5A 4D2OA 1ERMA 1WYBA 1CEFA 1CI9A 4WMCA 4WM9A 1MY8A 1O07A 2A3UA 4OOLA 4OKPA 3IWQA 2EXBA 4CPKA 1PZPA 3QNCA 4GB7A 2Y59A 2WZZA 3UDXA 5CEBA 3UN7A 4UHUA 3PBOA 4R1GA 1FCNA 4OP5A 3PAEA 4JBFA 4GZBA 4Y0UA 3UPPA 4MEZA 1JTGA 3MFDA 3I7JA 1YLJA 1K4FA 4HESA 4XUXA 1K57A 3W8KA 4GD6A 4X53A 2RL3A 5D3OA 4R23A 3O88A 3S4XA 3PTEA 3OCLA 2ZD8A 5FI2A 3VP0A 2R9WA 5EPHA 1K54C 1RCJA 4Y0TA 2WKIA 2Q9MA 1O7EA 1JWVA 2J7VA 1HD8A 3BLSA 3GV9A 2WGWA 5EVIA 5FQQA 5E2FA 4N92A 4S2PA 2IWBA 3Q07A 3FZCA 1HVBA 3V5MA 4UA7A 5E2GA 4LV0A 3GQZA 5FQKA 3RXXA 3Q1FA 3GVBA 4IBXA 4C6YA 4GD8A 5FDHA 3G2YA 3UDFA 1BLCA 4MNRA 3G34A 5HAIA 4DKIA 3A3EA 4LV2A 2HDSA 4PPRA 1ES4A 4OQ0A 3JYIA 5GLBA 3WS5A 1QMFA 3HVFA 3VFFA 3W4OA 1C3BA 1MBLA 3WS4A 4DRTA 5IHVA 1H8YA 1M6KA 2PU4A 2Y2QA 1YLZA 2OLVA 4KZ5A 1BTLA 1FCMA 3S22A 2WK0A 1ZKJA 1PI4A 5FQJA 3A3IA 3NDGA 1KDSA 1ES5A 2WKEA 4LENA 4OLDA 3GTCA 4KQQA 1YLYA 4KG2A 3VP1A 3VFHA 4H8RA 5M18A 1Q2PA 1IKIA 3NDEA 1SDNA 1VQQA 2HP6A 3N7WA 3WS1A 4DDYA 5F1GA 3IHBA 3UE0A 3G4PA 5AQBA 4RYEA 4EUZA 1TDGA 3FYZA 4GNUA 4BJPA 5F83A 1IELA 1H8ZA 1XGJA 4U0XA 4P85A 3UDIA 4EV4A 1KVLA 1IYQA 1BSGA 2P9VB 1K55A 4WZ5C 4JLFA 1PZOA 4FSFA 4KZ7A 2EFUA 3HLBA 2V1ZA 3VP2A 1XA7A 4S2NC 4WEKA 3SH8A 3N8RA 5KSCA 3G31A 4C75A 3DWZA 2WADA 4RX3A 1JWPA 4OH0A 2GDNA 4BL2A 2XK1A 4JXWA 4S2JA 3OPHA 3ZNYA 1YQSA 5HARA 1IYPA 4OOMA 4K0XA 4OPZA 3NCKA 1CEGA 5EE8A 1XPBA 1GHPA 5A90A 4KZAA 1FQGA 2Y4AA 2EXAA 3PBRA 5HX9A 2Y2LA 1MXOA 1NJ4A 3VSLA 2ZM2A 3MZEA 4BL3A 3BFFA 5CECA 4UA6A 1KGFA 1XGIA 4BQMA 2Y2HA 5A93A 4P0MA 1ZG6A 4B4ZA 1XP4A 1L2SA 1ZG4A 1NY0A 3Q81A 2XH9A 4OP8A 1TDLA 1GA9A 2Y2OA 1K54A 4LV1A 5GLCA 4QD4A 1Q2QA 4KQRA 1FR1A 5FQ9A 1K6SA 1NZOA 1H5XA 1SKFA 2QPNA 3HUNA 4DF6A 3DTMA 1MPLA 1I5QA 1IYSA 3GMWA 5JYPA 2HP9A 5DVAA 2WAEA 3WRTA 3LEZA 4PMAA 3IF6A 2HPBA 5EVIB 1AXBA 2JBFA 5A91A 4DE2A 1PIOA 5FQIA 5AQAA 1BULA 3Q82A 3UO9A 3OC2A 3QHYA 1EI5A 3MXSA 5CGXA 3VP3A 5DF7A 5FASA 2XD1A 4KENB 4N9KA 4BLMA 4MBKA 4E6XA 5GHZA 5L2FA 1KE4A 4KZBA 4EBLA 4S2MA 2C6WB 3HLGA 3LCEA 4XUZA 4M3KA 5TFQA 4KZ3A 4X6TA 2PU2A 4N1HA 2XF3A 1RGZA 5JYOA 4NK3A 4IVIA 1W8YA 3GSGA 5CXWA 4Z9QA 2P74A 4PM6A 1XX2A 3BFDA 3ZVTA 3AGFA 4Y7PA 2WGVA 5GL9A 3Q7VA 3HL9A 1LI9A 1PWGA 1L0FA 1YLTA 2ZC5B 3O87A 3SS4A 4E6WA 3N8LA 3G30A 3UY6A 4ID4A 2XLNA 1BLHA 2Y2MA 4EWFA 3O86A 1E3UA 3ZG7B 2FFYA 3HLEA 5TGFA 2Y2PA 4JF6A 2ZMAA 3A3FA 4KZ9A 2BLSA 1PW1A 5E2EA 5HFOA 5CEDA 2Z2LB 3MKEA 3LO7A 3ISGA 3QNBA 4OQHA 4B4XA 4S2OA 4IBRA 4WEJA 4S2LA 3V3SA 4QJGA 5HW3A 3E2KA 3PBSA 4LCLA 4WZ5A 4BD1A 4OLGA 4GDNA 1J9MA 4WBGA 2XR0A 5J8XA 2EFXA 1I2SA 4X56A 1WE4A 4WMCD 5A92A 4OVDA 2I72A 3UPNA 1BUEA 4R4SA 5EVLA 3TSGA 3IXDA 3VOZA 1DJBA 2H10A 2UWXA 5HAPA 4CJNA 1G6AA 5FAOA 3A3DA 4K91A 2WZXA 4GKUA 4ZJ3A 4S2KA 3VOYA 1BZAA 2XD5A 4JXGA 1ZC2A 3ZG8B 4S2IA 3MKFA 4UAAA 2ZJ9A 4E3OA 1NRFA 2ZM0A 1W5DA 4OONA 4ZAMA 1KE0A 1YMSA 3HREA 5AQ7A 2OSUA 4OQGA 2EX9A 2H5SA 4KQOA 4OQIA 5GLDA 3HUMA 3IH8A 1ESUA 5CHMA 4U3TA 3SOIA 5DTTA 5EVIC 1PW8A 5M1AA 3NC8A 4GN2A 5HAQA 2H0YA 1CI8A 4QU3A 2J8YA 3S1YA 3DWKA 4E3LA 2JC7A 3SH7A 1TVFA 2J9PA 3HLFA 3UNWA 3OZHA 4KZ8A 1KE3A 4RX2A 1HTZA 1ONGA 1BLSA 1KVMA 3MBZA 3DW0A 4N1XA 1PWCA 2JCHA 5G18A 3TG9A 1W7FA 2WUQA 3HUOA 4KZ6A 1NZUA 1K56D 4ZTKA 2QZ6A 2RCXA 3CG5A 4BENA 1EROA 1L0EA 3C7VA 3P98A 1FOFA 1BT5A 5AQ9A 2ZQ7A 4RA7A 4Q8IA 4U0TA 2IWDA 4QY5A 3SH9A 4EQIA 3IF6B 1PYYA 1K6RA 4R0QA 1Y54A 1IEMA 3EQUA 4OOYA 3BYDA 3UPOA 5FATA 1E4DA 3N4IA 2Y2KA 2VGKA 4JXVA 1YM1A 5DF9A 4WZ4A 3IHAA 4FD8A 3BLMA 3IQAA 1GHIA 5F82A 2X02A 3NI9A 3ZNTA 3IXHA 4E3MA 2R9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FCO A;  3BFE A;  4MLL A;  3AGD A;  3FWL A;  3BEB A;  3IWI A;  5CTM A;  2WGI A;  1YMX A;  4WEL A;  5TR7 A;  2Z2M B;  3SS3 A;  3CZD A;  1BLP A;  4KZ4 A;  1YLW A;  4FH4 A;  3V50 A;  2DCF A;  3M2K A;  2OLU A;  1I2W A;  1RP5 A;  4HEF A;  3FV7 A;  1PI5 A;  3AGE A;  5EOO A;  5GHX A;  1ES3 A;  4EBP A;  2BG1 A;  1EWZ A;  4E3N A;  4X55 A;  1IYO A;  3C7U A;  2WGW B;  3Q7V B;  1ERQ A;  3Q7Z A;  5FQM A;  1FSY A;  1K55 C;  2XQZ A;  3MZF A;  1WYC A;  3WWX A;  3A3J A;  1IKG A;  2HP5 A;  1ONH A;  3NBL A;  3ZGA B;  3LY3 A;  3W4P A;  2Q9N A;  3BEC A;  1LLB A;  1MWS A;  2ZQD A;  1NXY A;  3IH9 A;  3M6H A;  5FAP A;  3HLW A;  5E2H A;  5CRF A;  1NYY A;  3BRM A;  2QMI A;  4IVK A;  3PBQ A;  4OPY A;  1YLP A;  5CTN A;  5GLA A;  2C5W B;  1ALQ A;  1DJA A;  3CJM A;  3O3V A;  3CMZ A;  4JXS A;  2ZC3 B;  3OCN A;  1GA0 A;  2Y55 A;  1K25 A;  1GHM A;  4BD0 A;  3PAG A;  1JWZ A;  2Y2N A;  2Y2I A;  2ZLY A;  4PM9 A;  3M2J A;  3G35 A;  4QB8 A;  3VSK A;  2EX6 A;  1K4E A;  4JKT A;  3SS5 A;  5BOH A;  4OPR A;  3WS0 A;  1HZO A;  4FH2 A;  3UE1 A;  2V2F F;  3N6I A;  4L0L A;  3HLC A;  3C4O A;  4HBU A;  3VP4 A;  3ZCZ A;  3ZG5 A;  3HLD A;  4X68 A;  4DXB A;  3GR2 A;  1DY6 A;  5CER A;  4C3Q A;  1W79 A;  1KGG A;  1NYM A;  4HBT A;  2Y2J A;  2Y2G A;  4R3B A;  5DTK A;  4F94 A;  5F1F A;  3BM6 A;  2E8I A;  5M19 A;  2DNS A;  3FKW A;  1K56 A;  5I94 A;  4DDS A;  3IXB A;  4R3J A;  1ESI A;  1K38 A;  5EUA A;  2ZQ9 A;  1MWU A;  3IF6 C;  1KDW A;  3PBN A;  4LCM A;  3MXR A;  4N9L A;  4S2N A;  3ZHH A;  2Y91 A;  5DTS A;  2A49 A;  3N8S A;  3P09 A;  4EBN A;  1S0W A;  3IWO A;  5E43 A;  1LL9 A;  4E3I A;  4DE1 A;  1GCE A;  2XGN A;  1CK3 A;  1JTD A;  5FI7 A;  1DJC A;  1LI0 A;  3OPL A;  4KG6 A;  2OV5 A;  2ZC7 A;  2HDU A;  4FCF A;  3V3R A;  2B5R A;  2X01 A;  3D4F A;  2PBY A;  1K57 C;  2HDQ A;  2ZC4 B;  4A5R A;  3VMA A;  1XXM A;  3MZD A;  5U47 A;  3WRZ A;  3ZG9 B;  5FA7 A;  4UA9 A;  1YT4 A;  3GRJ A;  3PBT A;  4P87 A;  1FR6 A;  1SHV A;  1W8Q A;  2ZQC A;  1PWD A;  3OPP A;  1LHY A;  3NIA A;  1TEM A;  5HL1 A;  1SCW A;  4PM8 A;  3ITA A;  4DE0 A;  1VM1 A;  2ZC6 B;  5EOE A;  5KMW A;  3FKV A;  4DXC A;  1SDE A;  2ZQA A;  3NY4 A;  3HBR A;  3IXG A;  4DE3 A;  4JF4 A;  2FFF B;  2J9O A;  4P6B A;  1Z6F A;  3UE3 A;  5FAQ A;  4ZDX A;  3RXW A;  1KGE A;  2EX8 A;  5FI6 A;  3E2L A;  4E3K A;  1E25 A;  4E3J A;  2X71 A;  1S6R A;  4O7D A;  1QME A;  3ZG0 A;  4GOG A;  4RVA A;  4R4R A;  4IED A;  2WKH A;  4MBH A;  2H0T A;  2ZM8 A;  4B88 A;  1MKI A;  3OPR A;  4Y0O A;  3ITB A;  5EVI D;  3LY4 A;  5CHJ A;  1FSW A;  2XFS A;  1G68 A;  2HDR A;  4QY6 A;  1XKZ A;  2XFT A;  1MWT A;  3TOI A;  2WYX A;  1E3U D;  3BFG A;  5CHU A;  2DRW A;  5FSR A;  2IWC A;  3ZVW A;  5KZH A;  1N4O A;  1MWR A;  4X69 A;  3ZDJ A;  4WYY A;  2ZQ8 A;  2EX2 A;  3V39 A;  3ZFZ A;  2JE5 A;  4YFM A;  4PM5 A;  2XDM A;  1L0G A;  3G2Z A;  2CC1 A;  3C4P A;  4MBF A;  4GDB A;  3IF5 A;  5EEC A;  4NET A;  1LL5 A;  2G2W A;  3C5A A;  1ES2 A;  4LV3 A;  3BFC A;  4QHC A;  3RJU A;  5GHY A;  4K0W A;  4KG5 A;  4XXR A;  4PM7 A;  2G2U A;  4ZJ1 A;  2VGJ A;  3G32 A;  1RGY A;  1N9B A;  4YIN A;  3EQV A;  2V20 A;  1L0D A;  3M6B A;  4ZBE A;  3IT9 A;  2WAF A;  2P9V A;  5CGW A;  1M40 A;  2XEP A;  3WS2 A;  1U60 A;  3B3X A;  3W4Q A;  5KSH A;  1OME A;  4OPQ A;  5DF8 A;  4JPM A;  1JVJ A;  4ZJ2 A;  1XA1 A;  5CGS A;  4JF5 A;  4D2O A;  1ERM A;  1WYB A;  1CEF A;  1CI9 A;  4WMC A;  4WM9 A;  1MY8 A;  1O07 A;  2A3U A;  4OOL A;  4OKP A;  3IWQ A;  2EXB A;  4CPK A;  1PZP A;  3QNC A;  4GB7 A;  2Y59 A;  2WZZ A;  3UDX A;  5CEB A;  3UN7 A;  4UHU A;  3PBO A;  4R1G A;  1FCN A;  4OP5 A;  3PAE A;  4JBF A;  4GZB A;  4Y0U A;  3UPP A;  4MEZ A;  1JTG A;  3MFD A;  3I7J A;  1YLJ A;  1K4F A;  4HES A;  4XUX A;  1K57 A;  3W8K A;  4GD6 A;  4X53 A;  2RL3 A;  5D3O A;  4R23 A;  3O88 A;  3S4X A;  3PTE A;  3OCL A;  2ZD8 A;  5FI2 A;  3VP0 A;  2R9W A;  5EPH A;  1K54 C;  1RCJ A;  4Y0T A;  2WKI A;  2Q9M A;  1O7E A;  1JWV A;  2J7V A;  1HD8 A;  3BLS A;  3GV9 A;  2WGW A;  5EVI A;  5FQQ A;  5E2F A;  4N92 A;  4S2P A;  2IWB A;  3Q07 A;  3FZC A;  1HVB A;  3V5M A;  4UA7 A;  5E2G A;  4LV0 A;  3GQZ A;  5FQK A;  3RXX A;  3Q1F A;  3GVB A;  4IBX A;  4C6Y A;  4GD8 A;  5FDH A;  3G2Y A;  3UDF A;  1BLC A;  4MNR A;  3G34 A;  5HAI A;  4DKI A;  3A3E A;  4LV2 A;  2HDS A;  4PPR A;  1ES4 A;  4OQ0 A;  3JYI A;  5GLB A;  3WS5 A;  1QMF A;  3HVF A;  3VFF A;  3W4O A;  1C3B A;  1MBL A;  3WS4 A;  4DRT A;  5IHV A;  1H8Y A;  1M6K A;  2PU4 A;  2Y2Q A;  1YLZ A;  2OLV A;  4KZ5 A;  1BTL A;  1FCM A;  3S22 A;  2WK0 A;  1ZKJ A;  1PI4 A;  5FQJ A;  3A3I A;  3NDG A;  1KDS A;  1ES5 A;  2WKE A;  4LEN A;  4OLD A;  3GTC A;  4KQQ A;  1YLY A;  4KG2 A;  3VP1 A;  3VFH A;  4H8R A;  5M18 A;  1Q2P A;  1IKI A;  3NDE A;  1SDN A;  1VQQ A;  2HP6 A;  3N7W A;  3WS1 A;  4DDY A;  5F1G A;  3IHB A;  3UE0 A;  3G4P A;  5AQB A;  4RYE A;  4EUZ A;  1TDG A;  3FYZ A;  4GNU A;  4BJP A;  5F83 A;  1IEL A;  1H8Z A;  1XGJ A;  4U0X A;  4P85 A;  3UDI A;  4EV4 A;  1KVL A;  1IYQ A;  1BSG A;  2P9V B;  1K55 A;  4WZ5 C;  4JLF A;  1PZO A;  4FSF A;  4KZ7 A;  2EFU A;  3HLB A;  2V1Z A;  3VP2 A;  1XA7 A;  4S2N C;  4WEK A;  3SH8 A;  3N8R A;  5KSC A;  3G31 A;  4C75 A;  3DWZ A;  2WAD A;  4RX3 A;  1JWP A;  4OH0 A;  2GDN A;  4BL2 A;  2XK1 A;  4JXW A;  4S2J A;  3OPH A;  3ZNY A;  1YQS A;  5HAR A;  1IYP A;  4OOM A;  4K0X A;  4OPZ A;  3NCK A;  1CEG A;  5EE8 A;  1XPB A;  1GHP A;  5A90 A;  4KZA A;  1FQG A;  2Y4A A;  2EXA A;  3PBR A;  5HX9 A;  2Y2L A;  1MXO A;  1NJ4 A;  3VSL A;  2ZM2 A;  3MZE A;  4BL3 A;  3BFF A;  5CEC A;  4UA6 A;  1KGF A;  1XGI A;  4BQM A;  2Y2H A;  5A93 A;  4P0M A;  1ZG6 A;  4B4Z A;  1XP4 A;  1L2S A;  1ZG4 A;  1NY0 A;  3Q81 A;  2XH9 A;  4OP8 A;  1TDL A;  1GA9 A;  2Y2O A;  1K54 A;  4LV1 A;  5GLC A;  4QD4 A;  1Q2Q A;  4KQR A;  1FR1 A;  5FQ9 A;  1K6S A;  1NZO A;  1H5X A;  1SKF A;  2QPN A;  3HUN A;  4DF6 A;  3DTM A;  1MPL A;  1I5Q A;  1IYS A;  3GMW A;  5JYP A;  2HP9 A;  5DVA A;  2WAE A;  3WRT A;  3LEZ A;  4PMA A;  3IF6 A;  2HPB A;  5EVI B;  1AXB A;  2JBF A;  5A91 A;  4DE2 A;  1PIO A;  5FQI A;  5AQA A;  1BUL A;  3Q82 A;  3UO9 A;  3OC2 A;  3QHY A;  1EI5 A;  3MXS A;  5CGX A;  3VP3 A;  5DF7 A;  5FAS A;  2XD1 A;  4KEN B;  4N9K A;  4BLM A;  4MBK A;  4E6X A;  5GHZ A;  5L2F A;  1KE4 A;  4KZB A;  4EBL A;  4S2M A;  2C6W B;  3HLG A;  3LCE A;  4XUZ A;  4M3K A;  5TFQ A;  4KZ3 A;  4X6T A;  2PU2 A;  4N1H A;  2XF3 A;  1RGZ A;  5JYO A;  4NK3 A;  4IVI A;  1W8Y A;  3GSG A;  5CXW A;  4Z9Q A;  2P74 A;  4PM6 A;  1XX2 A;  3BFD A;  3ZVT A;  3AGF A;  4Y7P A;  2WGV A;  5GL9 A;  3Q7V A;  3HL9 A;  1LI9 A;  1PWG A;  1L0F A;  1YLT A;  2ZC5 B;  3O87 A;  3SS4 A;  4E6W A;  3N8L A;  3G30 A;  3UY6 A;  4ID4 A;  2XLN A;  1BLH A;  2Y2M A;  4EWF A;  3O86 A;  1E3U A;  3ZG7 B;  2FFY A;  3HLE A;  5TGF A;  2Y2P A;  4JF6 A;  2ZMA A;  3A3F A;  4KZ9 A;  2BLS A;  1PW1 A;  5E2E A;  5HFO A;  5CED A;  2Z2L B;  3MKE A;  3LO7 A;  3ISG A;  3QNB A;  4OQH A;  4B4X A;  4S2O A;  4IBR A;  4WEJ A;  4S2L A;  3V3S A;  4QJG A;  5HW3 A;  3E2K A;  3PBS A;  4LCL A;  4WZ5 A;  4BD1 A;  4OLG A;  4GDN A;  1J9M A;  4WBG A;  2XR0 A;  5J8X A;  2EFX A;  1I2S A;  4X56 A;  1WE4 A;  4WMC D;  5A92 A;  4OVD A;  2I72 A;  3UPN A;  1BUE A;  4R4S A;  5EVL A;  3TSG A;  3IXD A;  3VOZ A;  1DJB A;  2H10 A;  2UWX A;  5HAP A;  4CJN A;  1G6A A;  5FAO A;  3A3D A;  4K91 A;  2WZX A;  4GKU A;  4ZJ3 A;  4S2K A;  3VOY A;  1BZA A;  2XD5 A;  4JXG A;  1ZC2 A;  3ZG8 B;  4S2I A;  3MKF A;  4UAA A;  2ZJ9 A;  4E3O A;  1NRF A;  2ZM0 A;  1W5D A;  4OON A;  4ZAM A;  1KE0 A;  1YMS A;  3HRE A;  5AQ7 A;  2OSU A;  4OQG A;  2EX9 A;  2H5S A;  4KQO A;  4OQI A;  5GLD A;  3HUM A;  3IH8 A;  1ESU A;  5CHM A;  4U3T A;  3SOI A;  5DTT A;  5EVI C;  1PW8 A;  5M1A A;  3NC8 A;  4GN2 A;  5HAQ A;  2H0Y A;  1CI8 A;  4QU3 A;  2J8Y A;  3S1Y A;  3DWK A;  4E3L A;  2JC7 A;  3SH7 A;  1TVF A;  2J9P A;  3HLF A;  3UNW A;  3OZH A;  4KZ8 A;  1KE3 A;  4RX2 A;  1HTZ A;  1ONG A;  1BLS A;  1KVM A;  3MBZ A;  3DW0 A;  4N1X A;  1PWC A;  2JCH A;  5G18 A;  3TG9 A;  1W7F A;  2WUQ A;  3HUO A;  4KZ6 A;  1NZU A;  1K56 D;  4ZTK A;  2QZ6 A;  2RCX A;  3CG5 A;  4BEN A;  1ERO A;  1L0E A;  3C7V A;  3P98 A;  1FOF A;  1BT5 A;  5AQ9 A;  2ZQ7 A;  4RA7 A;  4Q8I A;  4U0T A;  2IWD A;  4QY5 A;  3SH9 A;  4EQI A;  3IF6 B;  1PYY A;  1K6R A;  4R0Q A;  1Y54 A;  1IEM A;  3EQU A;  4OOY A;  3BYD A;  3UPO A;  5FAT A;  1E4D A;  3N4I A;  2Y2K A;  2VGK A;  4JXV A;  1YM1 A;  5DF9 A;  4WZ4 A;  3IHA A;  4FD8 A;  3BLM A;  3IQA A;  1GHI A;  5F82 A;  2X02 A;  3NI9 A;  3ZNT A;  3IXH A;  4E3M A;  2R9X A; 
#chains in the Genus database with same CATH topology
 4HHD A;  1V9Z A;  5CTM A;  2J3W A;  2GZA A;  3V50 A;  4FH4 A;  4PHT A;  3M2K A;  4CLC E;  2OLU A;  1I2W A;  4HEF A;  4X55 A;  3Q7V B;  3ICY A;  2Z6D A;  3A3J A;  1Y28 A;  3LY3 A;  5E2H A;  5AVE A;  5CRF A;  4IVK A;  5GLA A;  5CTN A;  4LFU A;  2C5W B;  3T1S A;  1ALQ A;  1DJA A;  4HP9 A;  3KYE A;  3O3V A;  3CUE A;  3LIC A;  1K25 A;  1GHM A;  4GLQ A;  1NRJ A;  4PM9 A;  3G35 A;  4QB8 A;  4JKT A;  3UE1 A;  4L0L A;  3GR2 A;  1S4S A;  3BM6 A;  4G3K A;  5I94 A;  2GJ3 A;  3QP4 A;  3IXB A;  5EUA A;  2ZL1 A;  3MXR A;  3PR6 A;  4Y15 A;  3ZHH A;  3P7N A;  3IWO A;  1LL9 A;  4E3I A;  2XGN A;  1JTD A;  4M4X A;  1DJC A;  3OPL A;  4NG2 A;  1DRM A;  3LIB A;  2X01 A;  2PBY A;  2HDQ A;  2ZC4 B;  3VMA A;  3WRZ A;  5U47 A;  4UA9 A;  3PBT A;  1W8Q A;  3OPP A;  1SCW A;  3ITA A;  5EOE A;  1YSQ A;  2W27 A;  1SDE A;  2ZQA A;  3IX3 A;  4DXC A;  3IXG A;  3MF0 A;  2J9O A;  4NKP A;  4P6B A;  1Z6F A;  3UE3 A;  3V67 A;  4E3K A;  4O7D A;  4GCZ A;  4IED A;  2WKH A;  4MBH A;  2ZM8 A;  1F2K A;  1MKI A;  3OPR A;  5EVI D;  3LY4 A;  2XFS A;  4BWI A;  1G68 A;  2ZMF A;  3T4T A;  3KSF A;  5FDS A;  3TOI A;  2W3H A;  1AWI A;  3G6O A;  3UB7 A;  1S66 L;  2EWW A;  3ZFZ A;  3T4S A;  3KSH A;  2XDM A;  1L0G A;  2KX6 A;  2V9A A;  2QJ5 A;  3TW8 A;  3G32 A;  3CPT B;  3IT9 A;  2P9V A;  5CGW A;  2HJE A;  5KSH A;  1OME A;  4EER A;  1CI9 A;  3F1P B;  5HWV A;  2Y59 A;  3UN7 A;  4UHU A;  3PBO A;  1D1J A;  4JBF A;  4Y0U A;  1PRQ A;  3QP1 A;  1YLJ A;  1K57 A;  3W8K A;  2O9A A;  5EM1 A;  4R23 A;  3T1Q B;  2ZD8 A;  3BLS A;  3KSG A;  2WGW A;  5J4E A;  4N92 A;  2JN7 A;  3FZC A;  4UA7 A;  3VE4 A;  4UQI S;  5FQK A;  4Y3I A;  3GVB A;  2KLI A;  3UDF A;  5HPF A;  4EEP A;  5TBM B;  3HJK A;  1XJ2 A;  4PPR A;  2O99 A;  3DBA A;  3JYI A;  4H6J A;  4MN5 A;  2A24 B;  2IA2 A;  3W4O A;  1MBL A;  3UB6 A;  3F1O B;  4DRT A;  1H8Y A;  2XRO A;  2Y2Q A;  3IS2 A;  1FCM A;  1VET A;  3T1R A;  1ZKJ A;  2WKE A;  4OLD A;  2FZ0 A;  3GTC A;  3VOL A;  3UB5 P;  4KQQ A;  4KG2 A;  3NDE A;  5AQB A;  2W3E A;  5AVF A;  3K3D A;  1H3Q A;  4GW9 A;  1K55 A;  4JGQ A;  4KZ7 A;  3HLB A;  2V1Z A;  3B33 A;  1XA7 A;  4RX3 A;  1JWP A;  2GDN A;  2AVX A;  2PR5 A;  3IBR A;  4OOM A;  4OPZ A;  3NCK A;  1GSV A;  2PD8 A;  2VX8 A;  2EWV A;  1FQG A;  4R70 A;  2Y4A A;  2Y2L A;  4G3V A;  2WKQ A;  1NJ4 A;  3VSL A;  2W3G A;  3BFF A;  4UA6 A;  1KGF A;  3QP6 A;  3TJZ C;  4P0M A;  1ZG4 A;  1NY0 A;  2V1A A;  5FQ9 A;  1H5X A;  3DTE A;  2WAE A;  3MQ0 A;  3IF6 A;  2HPB A;  4NXG A;  3TRC A;  2P7J A;  1PIO A;  5AQA A;  2ZL1 B;  3UO9 A;  3QHY A;  1NLZ A;  5FAS A;  4FTX A;  2XD1 A;  4Y13 A;  4X1M A;  4BLM A;  4E6X A;  4KUO A;  5L2F A;  2KDK A;  1KE4 A;  4EBL A;  3LCE A;  4N1H A;  2ZOI A;  4IVI A;  5CXW A;  4EES A;  1XX2 A;  3ZVT A;  4L9E A;  3Q7V A;  1PWG A;  1L0F A;  2ZC5 B;  3GEC A;  2J3T D;  2NUT C;  2W3D A;  2Y2M A;  4EWF A;  3O86 A;  3K3C A;  3ZG7 B;  3U4L P;  4KZ9 A;  2FH5 A;  3LGO A;  3QNB A;  3ISG A;  4S2O A;  4WZ5 A;  3PBS A;  4LCL A;  3QP5 A;  2INW A;  4OLG A;  4WBG A;  4L9F A;  2XR0 A;  5J8X A;  2VKS A;  3UME A;  4WLA A;  4WMC D;  4OVD A;  5EVL A;  3IXD A;  5HD3 A;  2WZX A;  4ZJ3 A;  3VOY A;  2HF6 A;  3BQA A;  3ZG8 B;  2ZJ9 A;  4P6Z M;  1ZTU A;  2H5S A;  4HP4 A;  4BBV A;  3IH8 A;  4CQH A;  3DAV A;  5EVI C;  3A0R A;  1PW8 A;  5M1A A;  5HAQ A;  4GN2 A;  3S1Y A;  3DWK A;  5KIZ A;  3UNW A;  1KE3 A;  3C30 A;  3OBF A;  4N1X A;  3DW0 A;  3C38 A;  2JCH A;  1W7F A;  4KZ6 A;  4ZTK A;  1ERO A;  3P98 A;  5IU1 A;  2ZQ7 A;  3LR5 A;  3PYP A;  3MMH A;  4EQI A;  1PYY A;  2VZW A;  1TS7 A;  3UPO A;  2O0Y A;  1E4D A;  4JGR A;  2JKR I;  5DF9 A;  4BBU A;  1MZU A;  3NJA A;  4E3M A;  1FCO A;  4LPZ A;  3BEB A;  4EQ1 A;  2WGI A;  1YMX A;  5CX7 A;  3D9Y A;  1H8M A;  1RP5 A;  1PI5 A;  5EOO A;  2ACG A;  2BG1 A;  1EWZ A;  4E3N A;  1IYO A;  1NLY A;  2WGW B;  1ERQ A;  2XQZ A;  3WWX A;  3D3O A;  2YKH A;  1UWN X;  3EEA A;  5HPI A;  3KSI A;  2Q9N A;  3BEC A;  2OWJ A;  2ZQD A;  3IH9 A;  3M6H A;  4OPY A;  3MJQ A;  3CJM A;  4JXS A;  1JWZ A;  2Y2I A;  1FIK A;  1T18 A;  3WS0 A;  1HZO A;  4FH2 A;  4QWO A;  3IX4 A;  2V2F F;  3F1P A;  4HBU A;  3ZCZ A;  3HLD A;  4C3Q A;  5IT5 A;  2Y2J A;  4NEE D;  2ZQ9 A;  1D7E A;  3PBN A;  4N9L A;  4R3A A;  3LUQ A;  2Y91 A;  2A49 A;  4ETZ A;  5E43 A;  1GSX A;  1GCE A;  1LI0 A;  4QPR A;  2HDU A;  4WN5 A;  3D4F A;  3EEH A;  4A5R A;  1ACF A;  1XXM A;  3ZG9 B;  1F5M A;  1UWP X;  1OTA A;  2ZQC A;  4MDZ A;  5HL1 A;  1TEM A;  4PM8 A;  4DE0 A;  1VM1 A;  1P9R A;  1OPX A;  2K2N A;  1DP9 A;  4ZDX A;  5TBM A;  1E25 A;  2X71 A;  1QME A;  4GOG A;  4R4R A;  2H0T A;  2A24 A;  3F1O A;  4Q0J A;  2VV8 A;  4QY6 A;  2XFT A;  3S7Q A;  1N4O A;  1MWR A;  4X69 A;  3V39 A;  2JE5 A;  1OT6 A;  4PM5 A;  2QHK A;  4GDB A;  5EEC A;  2Z6C A;  2PDR A;  5HZH A;  2V0U A;  2LB9 A;  4XXR A;  3S7O A;  3LEQ A;  4YIN A;  1G28 A;  3R7W B;  1L0D A;  2XA7 S;  4ZBE A;  2WAF A;  1M40 A;  3WS2 A;  1U60 A;  3B3X A;  3W4Q A;  5DF8 A;  1OTD A;  2WKR A;  2A2L A;  2PBD P;  1WYB A;  4WMC A;  2QJ7 A;  4OKP A;  3QNC A;  4MN7 A;  4OP5 A;  4CLC C;  2YKF A;  3QP2 A;  2VEA A;  4P6Z S;  5J3W A;  1K4F A;  4XUX A;  4X53 A;  2RL3 A;  5D3O A;  4Y17 A;  3O88 A;  3S4X A;  3PTE A;  3BW6 A;  4YNR A;  5FI2 A;  2R9W A;  5EPH A;  1K54 C;  2J7V A;  1JWV A;  5FQQ A;  2GX5 A;  2IWB A;  3Q07 A;  3V5M A;  5E2G A;  3GQZ A;  3Q1F A;  4C6Y A;  1P9W A;  3G34 A;  4DKI A;  3CWF A;  4LV2 A;  2I9V A;  4LRX C;  1ES4 A;  4OQ0 A;  2M7V A;  3GDI A;  2PR6 A;  3HVF A;  3B42 A;  5HDD A;  1STZ A;  1C3B A;  5IHV A;  4O0P A;  3E4O A;  1BTL A;  3E98 A;  1PI4 A;  1ES5 A;  4LEN A;  3CUE C;  2W0N A;  4Y5F A;  3L7H A;  2PYR A;  4H8R A;  3N7W A;  1MKM A;  3WS1 A;  3IHB A;  3IX8 A;  2PT7 A;  4EUZ A;  4GNU A;  1H8Z A;  1XGJ A;  4EV4 A;  1KVL A;  3RH8 B;  5HDC A;  1PZO A;  4FSF A;  3A0S A;  3EOI A;  3VP2 A;  3U2A A;  4WEK A;  3G31 A;  3BWL A;  4C75 A;  3DWZ A;  4OH0 A;  3OOV A;  3BY8 A;  2XK1 A;  3S7P A;  4S2J A;  3ZNY A;  1YQS A;  4IUK A;  1CEG A;  4KZA A;  5I5L A;  2QKP A;  3PBR A;  1W63 Q;  5CEC A;  3MS6 A;  5HDS A;  1YSP A;  1XGI A;  2Y2H A;  5A93 A;  1TF1 A;  3DTK A;  4B4Z A;  1XP4 A;  3EWK A;  2XH9 A;  4OP8 A;  1TDL A;  4LV1 A;  1Y4O A;  3E4P A;  2QPN A;  4HJ3 A;  1IYS A;  4PMA A;  3NEC A;  4YWZ A;  1AXB A;  5A91 A;  5HWT A;  1BUL A;  4EET B;  5A8B A;  3MXS A;  3VP3 A;  5DF7 A;  4KEN B;  4N9K A;  4MBK A;  3HLG A;  5TFQ A;  2MJ6 A;  4NK3 A;  3TE8 A;  3GSG A;  4Z9Q A;  2P74 A;  3AGF A;  3O87 A;  3SS4 A;  3N8L A;  3UY6 A;  1FIL A;  3T4J A;  1BLH A;  3P01 A;  1VEU B;  3HLE A;  5TGF A;  2XRN A;  2ZMA A;  3SZT A;  3JVV A;  4NXB A;  2BLS A;  3UB8 A;  5CED A;  2Z2L B;  4B4X A;  4S2L A;  3E2K A;  4I3I A;  4GDN A;  3E4Q A;  1I2S A;  4X56 A;  4R4S A;  4CJN A;  4K91 A;  4GKU A;  4S2K A;  2XD5 A;  4JXG A;  1ZC2 A;  2V8C A;  3MKF A;  4UAA A;  4MCW A;  2PAV P;  1KE0 A;  2OSU A;  5FEF A;  3HUM A;  1T19 A;  5CHM A;  4U3T A;  1LL8 A;  4ZRR A;  1IOU A;  1S1Y A;  4QU3 A;  4HI4 A;  2J8Y A;  3SH7 A;  2J9P A;  3HLF A;  2R78 A;  2V1B A;  1MC0 A;  5G18 A;  2QZ6 A;  1L0E A;  4PKY A;  1BT5 A;  5AQ9 A;  4Q8I A;  2WKP A;  3SH9 A;  4R0Q A;  3L9K A;  3LIA A;  2Y2K A;  4B93 A;  3LFV A;  3IHA A;  1K0K A;  3BLM A;  1GHI A;  3HJI A;  4HY8 A;  5DTS A;  3FWL A;  2Z2M B;  1BLP A;  3B47 A;  2JKT M;  2DCF A;  1CJF A;  3FV7 A;  5GHX A;  3RFB A;  5FQM A;  1FSY A;  1K55 C;  3MZF A;  3IBJ A;  3EGX C;  1WYC A;  5HSQ A;  3MXQ A;  2HP5 A;  1ONH A;  3ZGA B;  3W4P A;  5DFX A;  1MWS A;  1NXY A;  3MQO A;  5EFW A;  3F1N A;  3R7W A;  1DP8 A;  2QWS A;  1UGU A;  3LI9 A;  2OOL A;  3CMZ A;  2ZC3 B;  3OCN A;  2Y55 A;  2PYP A;  2XA7 M;  3H82 B;  3PAG A;  2Y2N A;  5DJU A;  2ZLY A;  3M2J A;  2EX6 A;  3SS5 A;  5BOH A;  3NOU C;  5F5Y A;  3HLC A;  4X68 A;  1DY6 A;  4LRZ E;  5CER A;  4K08 A;  1NYM A;  2Y2G A;  4F94 A;  5F1F A;  3QP8 A;  3FPW A;  5HL6 A;  3BY9 A;  3CIT A;  5M19 A;  2E8I A;  4I3J A;  2DNS A;  1K56 A;  4DDS A;  4L9G A;  1ESI A;  1MWU A;  3IF6 C;  4LCM A;  5F69 A;  4S2N A;  5J7E A;  1ZHH B;  1TD5 A;  4AFI A;  4E04 A;  5DJT A;  4EBN A;  4DE1 A;  1CK3 A;  4IUH A;  4EW7 A;  4FCF A;  3V3R A;  1P97 A;  3MZD A;  1YT4 A;  3GRJ A;  4P87 A;  1FR6 A;  1SHV A;  1PWD A;  5EV0 A;  5KMW A;  2ZC6 B;  3FKV A;  1YAX A;  1W63 M;  3NY4 A;  3HBR A;  4JF4 A;  2FFF B;  5FAQ A;  1KGE A;  2V8F A;  5MC7 A;  5FI6 A;  3LIE A;  3KYQ A;  4E3J A;  1S6R A;  3ZG0 A;  4RVA A;  1L3L A;  4Y0O A;  3W2Z A;  5CHJ A;  1FSW A;  2H28 A;  4R38 A;  2HDR A;  1CF0 A;  1P0Z A;  1XKZ A;  1OJ5 A;  1E3U D;  5CHU A;  3ULF A;  2IWC A;  5KZH A;  5HWW A;  5L8M A;  2ZQ8 A;  3SW1 A;  1EW0 A;  4YFM A;  4I3A A;  2CC1 A;  4MBF A;  1T1A A;  3IF5 A;  1N9N A;  4NET A;  1ES2 A;  4QHC A;  4ME4 A;  5GHY A;  4K0W A;  3UB9 A;  4KG5 A;  2DMW A;  3C2W A;  4ZJ1 A;  1RGY A;  3JPU A;  2V20 A;  2HZ5 A;  3T50 A;  3E0Y A;  4DN0 A;  4JPM A;  5CGS A;  2PRF A;  4D2O A;  1CEF A;  3CLO A;  5EM0 A;  1MY8 A;  4X25 A;  2W1T A;  5TJJ A;  1O07 A;  1Z09 A;  1ODV A;  4OOL A;  3IWQ A;  2EXB A;  1F98 A;  4IJG A;  3LR3 A;  1F9I A;  3LIF A;  4NXF A;  3PAE A;  4KUK A;  4GHI B;  4GZB A;  4MEZ A;  1S4R A;  3I7J A;  4HES A;  4GD6 A;  4Q0H A;  3OCL A;  1RCJ A;  3GV9 A;  2PHY A;  1TS0 A;  4S2P A;  1CQA A;  4EU0 A;  5L10 A;  5FDH A;  3LID A;  1BLC A;  5HAI A;  2JKR M;  3A3E A;  2VLG A;  3HCY A;  2M7U A;  2XSS A;  3WS5 A;  2O9B A;  2B18 A;  3VFF A;  2L1M A;  2OLV A;  3FC7 A;  2WK0 A;  3A3I A;  3NDG A;  1VEU A;  1YLY A;  3T1X A;  3VFH A;  1SDN A;  2HP6 A;  1WA9 A;  5F1G A;  3G4P A;  4RYE A;  1LSX A;  3FYZ A;  4BJP A;  5F83 A;  1IEL A;  4U0X A;  1IYQ A;  2LB5 A;  4O01 A;  3VV4 A;  4FUW A;  2M1C A;  3SH8 A;  5KSC A;  1G5U A;  1SKO B;  2WAD A;  4Q0I A;  4JXW A;  4WUJ A;  5HAR A;  1IYP A;  4K0X A;  2VJW A;  5EE8 A;  1GHP A;  3F1N B;  4CLC A;  5A90 A;  2EXA A;  2P08 A;  4GJ4 A;  1MXO A;  4BL3 A;  4WL9 A;  4BQM A;  3T12 B;  3Q81 A;  4ESP A;  1GA9 A;  2Y2O A;  1K54 A;  5GLC A;  4KQR A;  1FR1 A;  1K6S A;  1SKF A;  3HUN A;  4DF6 A;  3DTM A;  1MPL A;  1I5Q A;  3GMW A;  5JYP A;  4IHQ A;  4Y2F A;  3WRT A;  3LEZ A;  5EVI B;  4DE2 A;  3Q82 A;  1EI5 A;  4R6L A;  5F68 A;  4Z1W A;  3D72 A;  2K7S A;  2C6W B;  4KZ3 A;  2J3T C;  5JYO A;  1W8Y A;  3BFD A;  5GL9 A;  4GS9 B;  4E6W A;  1D06 A;  4D60 A;  2GNX A;  1E3U A;  4JF6 A;  3PXP A;  1J3W A;  4HIA A;  2B95 A;  5HFO A;  4OQH A;  4IBR A;  4BD1 A;  5C5K A;  5G4Z A;  1J9M A;  2EFX A;  1WE4 A;  3H82 A;  5FEG A;  4XT2 A;  5A92 A;  3UPN A;  1X0O A;  3VOZ A;  2H10 A;  3NUL A;  1IFQ A;  2L0W A;  3T4Q A;  4I38 A;  4BMW A;  1NRF A;  3KX0 X;  4YOF A;  4ZAM A;  1YMS A;  3HRE A;  5AQ7 A;  4HJ4 A;  2EX9 A;  4KQO A;  5LBR A;  2NUP C;  3SOI A;  5DTT A;  1CI8 A;  2JC7 A;  4LGW A;  5DFY A;  3OZH A;  4RX2 A;  3K2N A;  3R4K A;  1BLS A;  1KVM A;  3MBZ A;  2D01 A;  3TG9 A;  2WUQ A;  5F6A A;  1JNU A;  1K56 D;  2W1T B;  3CG5 A;  3FPV A;  1FOF A;  4I5S A;  4U0T A;  2IWD A;  1Y54 A;  3BYD A;  5FAT A;  3OLO A;  2ZOH A;  3IQA A;  4RQ9 A;  2X02 A;  4ARZ A;  3ZNT A;  2R9X A;  3BFE A;  4MLL A;  2JKF A;  3AGD A;  1PNE A;  4BBT A;  3IWI A;  1N9L A;  4WEL A;  5TR7 A;  3SS3 A;  3CZD A;  3PHY A;  4KZ4 A;  1YLW A;  4EUV A;  2ZBB A;  3AGE A;  4EBP A;  1ES3 A;  3C7U A;  3Q7Z A;  1IKG A;  3NBL A;  1TS6 A;  1LLB A;  2J80 A;  3H9W A;  3BJN A;  5FAP A;  3HLW A;  3T4K A;  1NYY A;  1XJ6 A;  3BRM A;  3LI8 A;  2QMI A;  3PBQ A;  1YLP A;  3RTY A;  4PAU A;  5K5B A;  1GA0 A;  3JVU A;  4BD0 A;  4KQD A;  3VSK A;  1K4E A;  4OPR A;  2VV7 A;  3N6I A;  3LYX A;  3VP4 A;  3C4O A;  3ZG5 A;  4DXB A;  4B9O A;  3H7W A;  1W79 A;  1KGG A;  4HBT A;  4R3B A;  5DTK A;  2VV6 A;  3FKW A;  4R3J A;  1K38 A;  2QYB A;  1KDW A;  3NOT C;  2Y8H A;  4GHI A;  1S67 L;  4FOF A;  1TS8 A;  3N8S A;  3P09 A;  1S0W A;  1OTE A;  1LT0 A;  5FI7 A;  2CMN A;  4PKY G;  4KG6 A;  2OV5 A;  2ZC7 A;  2JKT I;  2B5R A;  1K57 C;  5FA7 A;  1N9O A;  4G3W A;  1LHY A;  3NIA A;  4CLC B;  4DE3 A;  2W1R A;  4F3L A;  3UE6 A;  2OWH A;  3RXW A;  2EX8 A;  3E2L A;  2UV0 E;  4B88 A;  3ITB A;  1VHM A;  1MWT A;  2WYX A;  3BFG A;  3ZVW A;  2DRW A;  5FSR A;  3CHW P;  3MQQ A;  3ZDJ A;  4HH3 A;  4WYY A;  2E8J A;  2EX2 A;  5FL3 A;  5HD5 A;  4I39 A;  3G2Z A;  3C4P A;  1LL5 A;  2G2W A;  3C5A A;  2EA9 A;  3BFC A;  4LV3 A;  3RJU A;  4II7 A;  1A0K A;  3LR4 A;  5DKL A;  4PM7 A;  2G2U A;  2VGJ A;  2HJ9 C;  1N9B A;  3EQV A;  3M6B A;  2VGL M;  1OJG A;  2XEP A;  4JGO A;  3MR0 A;  4OPQ A;  1JVJ A;  4ZJ2 A;  1XA1 A;  1SKO A;  4JF5 A;  3BQ8 A;  1ERM A;  4WM9 A;  2JKG A;  3ZYT A;  2A3U A;  4NXE A;  3KO6 A;  4CPK A;  2VA0 A;  1PZP A;  4GB7 A;  2WZZ A;  3UDX A;  4HNB A;  5CEB A;  4R1G A;  1FCN A;  3UPP A;  3KYZ A;  4XT2 B;  4HJ6 A;  1JTG A;  5AJG A;  1OTB A;  3MFD A;  2Y79 A;  3S7N A;  3ZQ5 A;  4CLC D;  4HQA A;  3VP0 A;  4Y0T A;  2WKI A;  2Q9M A;  1O7E A;  5EVI A;  1HD8 A;  5E2F A;  1HVB A;  4LV0 A;  4EEU A;  2G7U A;  1OTI A;  3RXX A;  1OT9 A;  4IBX A;  1SZV A;  4GD8 A;  5G4Y A;  3CAX A;  3G2Y A;  1XJ3 A;  2VK3 A;  4MNR A;  2HDS A;  1NWZ A;  5GLB A;  3C8C A;  1XJ4 A;  1QMF A;  3T4O A;  3WS4 A;  1M6K A;  2PU4 A;  1YLZ A;  4O8G A;  4GS9 A;  4KZ5 A;  3S22 A;  5FQJ A;  1KDS A;  4HOI A;  1BYW A;  5DKK A;  4DJ3 A;  3VP1 A;  2ZMV A;  4ARZ B;  5M18 A;  1Q2P A;  3NHQ A;  1IKI A;  2KOI A;  1VQQ A;  4DDY A;  3MFX A;  3UE0 A;  2W3F A;  3MSH A;  1TDG A;  3CI6 A;  3UDI A;  4P85 A;  1BSG A;  2P9V B;  4WZ5 C;  4JLF A;  3EGD C;  4LRY C;  2BTF P;  2EFU A;  4S2N C;  3N8R A;  2HGV A;  4BL2 A;  4JGP A;  3OPH A;  2Q0O A;  2K31 A;  1XPB A;  4EXO A;  4LLO B;  5HX9 A;  3NOP C;  2ZM2 A;  3MZE A;  1ZG6 A;  4DJ2 A;  2PD7 A;  1L2S A;  2BAS A;  3H7W B;  1Q2Q A;  4QD4 A;  1NZO A;  2HP9 A;  5DVA A;  4WF0 A;  3DTI A;  2JBF A;  5FQI A;  1VB6 A;  5IS1 A;  3OC2 A;  1XFN A;  5CGX A;  3UMD A;  2V0W A;  5EVE A;  5GHZ A;  4KZB A;  4S2M A;  2L4R A;  4XUZ A;  4M3K A;  4X6T A;  3VE3 A;  4ETX A;  2PU2 A;  4H6J B;  2XF3 A;  3CPT A;  1RGZ A;  4PM6 A;  3FG8 A;  4Y7P A;  2WGV A;  1S1Z A;  3IS2 B;  1YPR A;  3HL9 A;  1LI9 A;  1YLT A;  1VET B;  4MMN A;  3G30 A;  3T4L A;  4ID4 A;  2XLN A;  4F3L B;  2FFY A;  2Y2P A;  4DMZ A;  3A3F A;  1PW1 A;  5E2E A;  4MN6 A;  3MKE A;  3LO7 A;  3A0V A;  4WEJ A;  3V3S A;  4QJG A;  5HW3 A;  1T1B A;  4UEY A;  2D02 A;  2OAP 1;  2I72 A;  1BUE A;  3TSG A;  4X1L A;  1DJB A;  2UWX A;  5HAP A;  1G6A A;  5FAO A;  3A3D A;  1DP6 A;  1BZA A;  2O9C A;  4S2I A;  4HH2 A;  1LSW A;  4E3O A;  1GSW A;  1PFL A;  2ZM0 A;  1W5D A;  4OON A;  2VGL S;  1HLU P;  4OQG A;  2P04 A;  1XFQ A;  4OQI A;  5GLD A;  1ESU A;  1LSV A;  1V9Y A;  3NC8 A;  2B02 A;  2H0Y A;  4E3L A;  1TVF A;  2OAQ 1;  4KZ8 A;  1HTZ A;  1ONG A;  3LR0 A;  4UQI M;  1T1C A;  1PWC A;  1KOU A;  1H0M A;  3HUO A;  1NZU A;  2RCX A;  4BEN A;  3C7V A;  4RA7 A;  2HV1 A;  3O5Y A;  4QY5 A;  3IF6 B;  1K6R A;  1G6O A;  1IEM A;  1YKD A;  3EQU A;  2JHE A;  4OOY A;  5L07 A;  3N4I A;  2VGK A;  4JXV A;  1YM1 A;  4WZ4 A;  4FD8 A;  5F82 A;  5L09 A;  3NI9 A;  3IXH A; 
#chains in the Genus database with same CATH homology
 1FCO A;  3BFE A;  4MLL A;  3AGD A;  3FWL A;  3BEB A;  3IWI A;  5CTM A;  2WGI A;  1YMX A;  4WEL A;  5TR7 A;  2Z2M B;  3SS3 A;  3CZD A;  1BLP A;  4KZ4 A;  1YLW A;  4FH4 A;  3V50 A;  2DCF A;  3M2K A;  2OLU A;  1I2W A;  1RP5 A;  4HEF A;  3FV7 A;  1PI5 A;  3AGE A;  5EOO A;  5GHX A;  1ES3 A;  4EBP A;  2BG1 A;  1EWZ A;  4E3N A;  4X55 A;  1IYO A;  3C7U A;  2WGW B;  3Q7V B;  1ERQ A;  3Q7Z A;  5FQM A;  1FSY A;  1K55 C;  2XQZ A;  3MZF A;  1WYC A;  3WWX A;  3A3J A;  1IKG A;  2HP5 A;  1ONH A;  3NBL A;  3ZGA B;  3LY3 A;  3W4P A;  2Q9N A;  3BEC A;  1LLB A;  1MWS A;  2ZQD A;  1NXY A;  3IH9 A;  3M6H A;  5FAP A;  3HLW A;  5E2H A;  5CRF A;  1NYY A;  3BRM A;  2QMI A;  4IVK A;  3PBQ A;  4OPY A;  1YLP A;  5CTN A;  5GLA A;  2C5W B;  1ALQ A;  1DJA A;  3CJM A;  3O3V A;  3CMZ A;  4JXS A;  2ZC3 B;  3OCN A;  1GA0 A;  2Y55 A;  1K25 A;  1GHM A;  4BD0 A;  3PAG A;  1JWZ A;  2Y2N A;  2Y2I A;  2ZLY A;  4PM9 A;  3M2J A;  3G35 A;  4QB8 A;  3VSK A;  2EX6 A;  1K4E A;  4JKT A;  3SS5 A;  5BOH A;  4OPR A;  3WS0 A;  1HZO A;  4FH2 A;  3UE1 A;  2V2F F;  3N6I A;  4L0L A;  3HLC A;  3C4O A;  4HBU A;  3VP4 A;  3ZCZ A;  3ZG5 A;  3HLD A;  4X68 A;  4DXB A;  3GR2 A;  1DY6 A;  5CER A;  4C3Q A;  1W79 A;  1KGG A;  1NYM A;  4HBT A;  2Y2J A;  2Y2G A;  4R3B A;  5DTK A;  4F94 A;  5F1F A;  3BM6 A;  2E8I A;  5M19 A;  2DNS A;  3FKW A;  1K56 A;  5I94 A;  4DDS A;  3IXB A;  4R3J A;  1ESI A;  1K38 A;  5EUA A;  2ZQ9 A;  1MWU A;  3IF6 C;  1KDW A;  3PBN A;  4LCM A;  3MXR A;  4N9L A;  4S2N A;  3ZHH A;  2Y91 A;  5DTS A;  2A49 A;  3N8S A;  3P09 A;  4EBN A;  1S0W A;  3IWO A;  5E43 A;  1LL9 A;  4E3I A;  4DE1 A;  1GCE A;  2XGN A;  1CK3 A;  1JTD A;  5FI7 A;  1DJC A;  1LI0 A;  3OPL A;  4KG6 A;  2OV5 A;  2ZC7 A;  2HDU A;  4FCF A;  3V3R A;  2B5R A;  2X01 A;  3D4F A;  2PBY A;  1K57 C;  2HDQ A;  2ZC4 B;  4A5R A;  3VMA A;  1XXM A;  3MZD A;  5U47 A;  3WRZ A;  3ZG9 B;  5FA7 A;  4UA9 A;  1YT4 A;  3GRJ A;  3PBT A;  4P87 A;  1FR6 A;  1SHV A;  1W8Q A;  2ZQC A;  1PWD A;  3OPP A;  1LHY A;  3NIA A;  1TEM A;  5HL1 A;  1SCW A;  4PM8 A;  3ITA A;  4DE0 A;  1VM1 A;  2ZC6 B;  5EOE A;  5KMW A;  3FKV A;  4DXC A;  1SDE A;  2ZQA A;  3NY4 A;  3HBR A;  3IXG A;  4DE3 A;  4JF4 A;  2FFF B;  2J9O A;  4P6B A;  1Z6F A;  3UE3 A;  5FAQ A;  4ZDX A;  3RXW A;  1KGE A;  2EX8 A;  5FI6 A;  3E2L A;  4E3K A;  1E25 A;  4E3J A;  2X71 A;  1S6R A;  4O7D A;  1QME A;  3ZG0 A;  4GOG A;  4RVA A;  4R4R A;  4IED A;  2WKH A;  4MBH A;  2H0T A;  2ZM8 A;  4B88 A;  1MKI A;  3OPR A;  4Y0O A;  3ITB A;  5EVI D;  3LY4 A;  5CHJ A;  1FSW A;  2XFS A;  1G68 A;  2HDR A;  4QY6 A;  1XKZ A;  2XFT A;  1MWT A;  3TOI A;  2WYX A;  1E3U D;  3BFG A;  5CHU A;  2DRW A;  5FSR A;  2IWC A;  3ZVW A;  5KZH A;  1N4O A;  1MWR A;  4X69 A;  3ZDJ A;  4WYY A;  2ZQ8 A;  2EX2 A;  3V39 A;  3ZFZ A;  2JE5 A;  4YFM A;  4PM5 A;  2XDM A;  1L0G A;  3G2Z A;  2CC1 A;  3C4P A;  4MBF A;  4GDB A;  3IF5 A;  5EEC A;  4NET A;  1LL5 A;  2G2W A;  3C5A A;  1ES2 A;  4LV3 A;  3BFC A;  4QHC A;  3RJU A;  5GHY A;  4K0W A;  4KG5 A;  4XXR A;  4PM7 A;  2G2U A;  4ZJ1 A;  2VGJ A;  3G32 A;  1RGY A;  1N9B A;  4YIN A;  3EQV A;  2V20 A;  1L0D A;  3M6B A;  4ZBE A;  3IT9 A;  2WAF A;  2P9V A;  5CGW A;  1M40 A;  2XEP A;  3WS2 A;  1U60 A;  3B3X A;  3W4Q A;  5KSH A;  1OME A;  4OPQ A;  5DF8 A;  4JPM A;  1JVJ A;  4ZJ2 A;  1XA1 A;  5CGS A;  4JF5 A;  4D2O A;  1ERM A;  1WYB A;  1CEF A;  1CI9 A;  4WMC A;  4WM9 A;  1MY8 A;  1O07 A;  2A3U A;  4OOL A;  4OKP A;  3IWQ A;  2EXB A;  4CPK A;  1PZP A;  3QNC A;  4GB7 A;  2Y59 A;  2WZZ A;  3UDX A;  5CEB A;  3UN7 A;  4UHU A;  3PBO A;  4R1G A;  1FCN A;  4OP5 A;  3PAE A;  4JBF A;  4GZB A;  4Y0U A;  3UPP A;  4MEZ A;  1JTG A;  3MFD A;  3I7J A;  1YLJ A;  1K4F A;  4HES A;  4XUX A;  1K57 A;  3W8K A;  4GD6 A;  4X53 A;  2RL3 A;  5D3O A;  4R23 A;  3O88 A;  3S4X A;  3PTE A;  3OCL A;  2ZD8 A;  5FI2 A;  3VP0 A;  2R9W A;  5EPH A;  1K54 C;  1RCJ A;  4Y0T A;  2WKI A;  2Q9M A;  1O7E A;  1JWV A;  2J7V A;  1HD8 A;  3BLS A;  3GV9 A;  2WGW A;  5EVI A;  5FQQ A;  5E2F A;  4N92 A;  4S2P A;  2IWB A;  3Q07 A;  3FZC A;  1HVB A;  3V5M A;  4UA7 A;  5E2G A;  4LV0 A;  3GQZ A;  5FQK A;  3RXX A;  3Q1F A;  3GVB A;  4IBX A;  4C6Y A;  4GD8 A;  5FDH A;  3G2Y A;  3UDF A;  1BLC A;  4MNR A;  3G34 A;  5HAI A;  4DKI A;  3A3E A;  4LV2 A;  2HDS A;  4PPR A;  1ES4 A;  4OQ0 A;  3JYI A;  5GLB A;  3WS5 A;  1QMF A;  3HVF A;  3VFF A;  3W4O A;  1C3B A;  1MBL A;  3WS4 A;  4DRT A;  5IHV A;  1H8Y A;  1M6K A;  2PU4 A;  2Y2Q A;  1YLZ A;  2OLV A;  4KZ5 A;  1BTL A;  1FCM A;  3S22 A;  2WK0 A;  1ZKJ A;  1PI4 A;  5FQJ A;  3A3I A;  3NDG A;  1KDS A;  1ES5 A;  2WKE A;  4LEN A;  4OLD A;  3GTC A;  4KQQ A;  1YLY A;  4KG2 A;  3VP1 A;  3VFH A;  4H8R A;  5M18 A;  1Q2P A;  1IKI A;  3NDE A;  1SDN A;  1VQQ A;  2HP6 A;  3N7W A;  3WS1 A;  4DDY A;  5F1G A;  3IHB A;  3UE0 A;  3G4P A;  5AQB A;  4RYE A;  4EUZ A;  1TDG A;  3FYZ A;  4GNU A;  4BJP A;  5F83 A;  1IEL A;  1H8Z A;  1XGJ A;  4U0X A;  4P85 A;  3UDI A;  4EV4 A;  1KVL A;  1IYQ A;  1BSG A;  2P9V B;  1K55 A;  4WZ5 C;  4JLF A;  1PZO A;  4FSF A;  4KZ7 A;  2EFU A;  3HLB A;  2V1Z A;  3VP2 A;  1XA7 A;  4S2N C;  4WEK A;  3SH8 A;  3N8R A;  5KSC A;  3G31 A;  4C75 A;  3DWZ A;  2WAD A;  4RX3 A;  1JWP A;  4OH0 A;  2GDN A;  4BL2 A;  2XK1 A;  4JXW A;  4S2J A;  3OPH A;  3ZNY A;  1YQS A;  5HAR A;  1IYP A;  4OOM A;  4K0X A;  4OPZ A;  3NCK A;  1CEG A;  5EE8 A;  1XPB A;  1GHP A;  5A90 A;  4KZA A;  1FQG A;  2Y4A A;  2EXA A;  3PBR A;  5HX9 A;  2Y2L A;  1MXO A;  1NJ4 A;  3VSL A;  2ZM2 A;  3MZE A;  4BL3 A;  3BFF A;  5CEC A;  4UA6 A;  1KGF A;  1XGI A;  4BQM A;  2Y2H A;  5A93 A;  4P0M A;  1ZG6 A;  4B4Z A;  1XP4 A;  1L2S A;  1ZG4 A;  1NY0 A;  3Q81 A;  2XH9 A;  4OP8 A;  1TDL A;  1GA9 A;  2Y2O A;  1K54 A;  4LV1 A;  5GLC A;  4QD4 A;  1Q2Q A;  4KQR A;  1FR1 A;  5FQ9 A;  1K6S A;  1NZO A;  1H5X A;  1SKF A;  2QPN A;  3HUN A;  4DF6 A;  3DTM A;  1MPL A;  1I5Q A;  1IYS A;  3GMW A;  5JYP A;  2HP9 A;  5DVA A;  2WAE A;  3WRT A;  3LEZ A;  4PMA A;  3IF6 A;  2HPB A;  5EVI B;  1AXB A;  2JBF A;  5A91 A;  4DE2 A;  1PIO A;  5FQI A;  5AQA A;  1BUL A;  3Q82 A;  3UO9 A;  3OC2 A;  3QHY A;  1EI5 A;  3MXS A;  5CGX A;  3VP3 A;  5DF7 A;  5FAS A;  2XD1 A;  4KEN B;  4N9K A;  4BLM A;  4MBK A;  4E6X A;  5GHZ A;  5L2F A;  1KE4 A;  4KZB A;  4EBL A;  4S2M A;  2C6W B;  3HLG A;  3LCE A;  4XUZ A;  4M3K A;  5TFQ A;  4KZ3 A;  4X6T A;  2PU2 A;  4N1H A;  2XF3 A;  1RGZ A;  5JYO A;  4NK3 A;  4IVI A;  1W8Y A;  3GSG A;  5CXW A;  4Z9Q A;  2P74 A;  4PM6 A;  1XX2 A;  3BFD A;  3ZVT A;  3AGF A;  4Y7P A;  2WGV A;  5GL9 A;  3Q7V A;  3HL9 A;  1LI9 A;  1PWG A;  1L0F A;  1YLT A;  2ZC5 B;  3O87 A;  3SS4 A;  4E6W A;  3N8L A;  3G30 A;  3UY6 A;  4ID4 A;  2XLN A;  1BLH A;  2Y2M A;  4EWF A;  3O86 A;  1E3U A;  3ZG7 B;  2FFY A;  3HLE A;  5TGF A;  2Y2P A;  4JF6 A;  2ZMA A;  3A3F A;  4KZ9 A;  2BLS A;  1PW1 A;  5E2E A;  5HFO A;  5CED A;  2Z2L B;  3MKE A;  3LO7 A;  3ISG A;  3QNB A;  4OQH A;  4B4X A;  4S2O A;  4IBR A;  4WEJ A;  4S2L A;  3V3S A;  4QJG A;  5HW3 A;  3E2K A;  3PBS A;  4LCL A;  4WZ5 A;  4BD1 A;  4OLG A;  4GDN A;  1J9M A;  4WBG A;  2XR0 A;  5J8X A;  2EFX A;  1I2S A;  4X56 A;  1WE4 A;  4WMC D;  5A92 A;  4OVD A;  2I72 A;  3UPN A;  1BUE A;  4R4S A;  5EVL A;  3TSG A;  3IXD A;  3VOZ A;  1DJB A;  2H10 A;  2UWX A;  5HAP A;  4CJN A;  1G6A A;  5FAO A;  3A3D A;  4K91 A;  2WZX A;  4GKU A;  4ZJ3 A;  4S2K A;  3VOY A;  1BZA A;  2XD5 A;  4JXG A;  1ZC2 A;  3ZG8 B;  4S2I A;  3MKF A;  4UAA A;  2ZJ9 A;  4E3O A;  1NRF A;  2ZM0 A;  1W5D A;  4OON A;  4ZAM A;  1KE0 A;  1YMS A;  3HRE A;  5AQ7 A;  2OSU A;  4OQG A;  2EX9 A;  2H5S A;  4KQO A;  4OQI A;  5GLD A;  3HUM A;  3IH8 A;  1ESU A;  5CHM A;  4U3T A;  3SOI A;  5DTT A;  5EVI C;  1PW8 A;  5M1A A;  3NC8 A;  4GN2 A;  5HAQ A;  2H0Y A;  1CI8 A;  4QU3 A;  2J8Y A;  3S1Y A;  3DWK A;  4E3L A;  2JC7 A;  3SH7 A;  1TVF A;  2J9P A;  3HLF A;  3UNW A;  3OZH A;  4KZ8 A;  1KE3 A;  4RX2 A;  1HTZ A;  1ONG A;  1BLS A;  1KVM A;  3MBZ A;  3DW0 A;  4N1X A;  1PWC A;  2JCH A;  5G18 A;  3TG9 A;  1W7F A;  2WUQ A;  3HUO A;  4KZ6 A;  1NZU A;  1K56 D;  4ZTK A;  2QZ6 A;  2RCX A;  3CG5 A;  4BEN A;  1ERO A;  1L0E A;  3C7V A;  3P98 A;  1FOF A;  1BT5 A;  5AQ9 A;  2ZQ7 A;  4RA7 A;  4Q8I A;  4U0T A;  2IWD A;  4QY5 A;  3SH9 A;  4EQI A;  3IF6 B;  1PYY A;  1K6R A;  4R0Q A;  1Y54 A;  1IEM A;  3EQU A;  4OOY A;  3BYD A;  3UPO A;  5FAT A;  1E4D A;  3N4I A;  2Y2K A;  2VGK A;  4JXV A;  1YM1 A;  5DF9 A;  4WZ4 A;  3IHA A;  4FD8 A;  3BLM A;  3IQA A;  1GHI A;  5F82 A;  2X02 A;  3NI9 A;  3ZNT A;  3IXH A;  4E3M A;  2R9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...