4N92A

Crystal structure of beta-lactamse penp_e166s
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
256
structure length
256
Chain Sequence
DDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFSPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Perturbing the General Base Residue Glu166 in the Active Site of Class A beta-Lactamase Leads to Enhanced Carbapenem Binding and Acylation
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
molecule keywords Beta-lactamase
total genus 90
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4n92A00
2HP5A 4OPRA 1FCNA 5E2EA 5E2GA 4ZJ2A 3WS1A 3N6IA 2ZQAA 4GKUA 1LI0A 2EX9A 2HP6A 1RGZA 3Q7ZA 1RGYA 3VOYA 4U3TA 4OOMA 3VOZA 4EWFA 1WYBA 4UA7A 3ZG8B 1YQSA 3TG9A 5AQ7A 4D2OA 1DY6A 3OPLA 1K4FA 1L2SA 3MZFA 1IYOA 3PBOA 4EQIA 5A92A 1CEFA 5CECA 4LENA 4WELA 1N9BA 1PZPA 5CHMA 3VP3A 1BZAA 3GRJA 4MBHA 3LY3A 1HZOA 2J7VA 4P87A 3WRTA 4CPKA 2ZM2A 2PBYA 5CRFA 1BLHA 1W8YA 2OLUA 1L0DA 3PBTA 2WKIA 5F82A 3ZHHA 1ES4A 5HAQA 1FSYA 2C5WB 3CZDA 3IF5A 3NIAA 3W4QA 3BFCA 4N92A 3SH9A 2BLSA 1TDGA 2XR0A 1E3UA 3GQZA 3OC2A 4OP8A 3IH9A 3UDIA 1IYSA 4QY6A 1WE4A 3IT9A 3BLSA 4MBFA 1PI4A 1DJCA 1ONGA 3IQAA 5TGFA 1G6AA 5FQ9A 3DTMA 2VGJA 3IF6C 4OLDA 3ZVTA 4E6XA 4RX3A 1ESIA 1YLTA 1M6KA 5FAQA 3BEBA 2QPNA 3ZVWA 3M6HA 2Y2QA 5DVAA 4OVDA 1PI5A 4KG6A 1YMSA 3A3JA 3Q07A 4S2MA 3ZNYA 1I2SA 2V2FF 2ZC4B 4X68A 1LLBA 2Y59A 3IXHA 3N7WA 5CTNA 3Q7VA 5FATA 1K55A 4JF5A 3IHBA 3MKEA 5CEDA 2Y2HA 3RXXA 4GOGA 4EBNA 4OLGA 4DDYA 1RP5A 2VGKA 4XUXA 3AGFA 3UPPA 2Y55A 3BM6A 4P6BA 1KVLA 2R9WA 4OPZA 2QMIA 4Z9QA 2HDSA 4QJGA 1ALQA 3NY4A 4GD8A 4LV1A 4EV4A 1BLSA 4QU3A 4KZ7A 4X55A 2OV5A 1MWTA 5F83A 1DJAA 1QMEA 5HFOA 3WS4A 3FZCA 5CGWA 1YLYA 4XXRA 3BLMA 1EROA 4OH0A 5CERA 1NYYA 1H5XA 1CI8A 2XK1A 1GHMA 4YFMA 3IHAA 1PYYA 2XDMA 2EFUA 2HDRA 3SH8A 2ZD8A 1ERQA 4MNRA 1MKIA 5AQ9A 4KQQA 1GHPA 5GHZA 4X56A 5GLCA 5E2FA 3DWZA 1KDSA 4WBGA 5FQIA 1PW8A 3BFDA 3GR2A 3HUMA 3Q1FA 4A5RA 3HLFA 4WMCD 5DTSA 1LL5A 3E2LA 4P0MA 3ZNTA 2H0YA 2WGWB 4Y7PA 2XD1A 1E3UD 2Y2NA 4OP5A 2PU4A 2V20A 5FQQA 4RA7A 5AQAA 1K6RA 4S2NC 2J9OA 2XLNA 2J9PA 4JXGA 3LEZA 3HUOA 2Y2LA 1ZKJA 3LY4A 4E6WA 3N8SA 3PBRA 3OCLA 4WZ5A 3W4OA 2WAEA 4BENA 1Z6FA 3V39A 3N8LA 5DF7A 5CEBA 3WWXA 5JYPA 1FSWA 1LHYA 3TOIA 2ZQDA 3ZG7B 3MXSA 1U60A 1XA7A 2ZC3B 4F94A 1G68A 1YLPA 3EQUA 1XX2A 4R23A 3SOIA 2EX6A 1SCWA 4WZ5C 3VFHA 4KG5A 4OPQA 5FDHA 2A3UA 4QB8A 4R4RA 5M19A 5HX9A 3DWKA 4HBTA 3Q7VB 1M40A 3G4PA 5A93A 3HVFA 3A3FA 4E3JA 2ZQ9A 5FASA 1W79A 3PTEA 3GTCA 4WM9A 4GZBA 1VQQA 1KVMA 4OOYA 2H10A 3M2JA 1YT4A 4OQ0A 1NZOA 1VM1A 2XD5A 4JKTA 2Z2MB 3SS4A 3HLCA 4Y0OA 3ZDJA 1YMXA 1JWZA 1IEMA 2IWDA 4E3IA 4P85A 2Y91A 3OPPA 4JXVA 3HL9A 1BULA 3W8KA 3BFEA 4KZ4A 5HL1A 5DF9A 4BD1A 4KENB 5FAPA 1S6RA 4BQMA 3DW0A 3Q81A 4RVAA 5BOHA 5GL9A 3MKFA 4S2PA 1MWRA 4HESA 2ZC6B 1ZG4A 2ZQ7A 5D3OA 4HBUA 2WZZA 4WEKA 2Y4AA 2P9VB 2WK0A 2WGWA 2Z2LB 1PWGA 4N9LA 1L0FA 1YLZA 3IXGA 5HARA 2ZC7A 1O07A 1XGJA 3CMZA 1LI9A 4K0XA 4L0LA 4CJNA 4OPYA 4FH2A 4E3MA 1EWZA 1W5DA 4DE2A 4UHUA 3FV7A 3PAEA 2RL3A 4GDNA 4R1GA 3UDFA 1JWPA 4JF4A 1ES5A 2WUQA 3GMWA 5FAOA 2WKHA 2V1ZA 5A90A 3IXDA 2XFSA 3UPOA 1SDNA 3GSGA 4WEJA 1K56D 1N4OA 3D4FA 3HLDA 3ITBA 4S2OA 4EBPA 5FA7A 4IBXA 1NZUA 1K25A 1NJ4A 3NDGA 1MWSA 2Y2GA 4PM8A 4QHCA 3VMAA 4E3LA 1MBLA 1NXYA 3A3IA 1ZG6A 2Y2IA 2X71A 4EBLA 4JPMA 4KG2A 3IXBA 5EE8A 2FFYA 2WKEA 2J8YA 2WADA 1PWDA 3G31A 1QMFA 3G2YA 1FR1A 1JWVA 5EVLA 4OQGA 3JYIA 3I7JA 2ZC5B 1WYCA 4R0QA 4DDSA 3NC8A 4WZ4A 5FSRA 3V3SA 1KGFA 2G2UA 3HREA 4LCLA 5HW3A 3PBNA 1GCEA 2JC7A 1ES2A 2XH9A 5JYOA 1Q2PA 3WS0A 1MPLA 4NETA 5EUAA 4QY5A 1MXOA 2HPBA 4LCMA 4IVKA 1XA1A 2G2WA 3WRZA 4HEFA 1GHIA 2DCFA 4S2LA 4JXWA 5U47A 4K91A 2ZJ9A 4UAAA 1PZOA 4N1HA 5EVIB 4ZDXA 2DRWA 4DKIA 2ZM0A 3S4XA 1Y54A 2ZMAA 1BLPA 3OZHA 3VP2A 3N8RA 4S2KA 1MWUA 3RJUA 2Q9MA 5TFQA 4KZAA 4N9KA 3WS5A 1TEMA 4X6TA 5EOOA 3MBZA 4Y0UA 4OOLA 1TVFA 4BD0A 3IF6B 2JCHA 4NK3A 4E3KA 2EXAA 2WGVA 4R3BA 3VSLA 3G30A 5EVIC 1XGIA 3EQVA 4KZBA 1LL9A 5KSCA 4ZJ1A 3MXRA 5HAPA 3HBRA 3VP4A 3V50A 4JBFA 3IWQA 3C5AA 1OMEA 1XKZA 4C3QA 3UY6A 1ONHA 2HP9A 5E43A 4KZ3A 5GLDA 1JTGA 2XQZA 1BSGA 4B4XA 3A3EA 1S0WA 4PM9A 3UN7A 3HLBA 3QNCA 2A49A 4R3JA 1K56A 2XEPA 4DXCA 4QD4A 4B88A 2ZM8A 4MLLA 1KGGA 1NY0A 2WYXA 4E3NA 3IWOA 4PM5A 3OCNA 4DE1A 1KGEA 4K0WA 1JVJA 3BECA 3NCKA 4ZJ3A 1JTDA 2ZQ8A 4LV3A 2WAFA 3V5MA 1ERMA 5IHVA 1HVBA 2BG1A 5J8XA 4PPRA 4DRTA 3HUNA 3M2KA 3LO7A 5FQKA 3UE3A 4Y0TA 2JE5A 4WYYA 1O7EA 4PMAA 2EFXA 4DF6A 5EOEA 1SKFA 3ISGA 4YINA 5FI2A 2HDUA 3HLWA 3ZCZA 4MEZA 1E4DA 1K6SA 3UDXA 1MY8A 1K54C 4FH4A 2X02A 4PM7A 2WGIA 3V3RA 1C3BA 4U0XA 4GNUA 3UO9A 3VFFA 1IYPA 3FKVA 2R9XA 4JF6A 3G34A 3VP0A 5KSHA 1PIOA 4ZTKA 3SS3A 5CHUA 3ZFZA 2EX2A 5E2HA 2Y2JA 3S1YA 1YLJA 2WZXA 4FSFA 3GV9A 1TDLA 3OPRA 3O3VA 4OQIA 3ZGAB 4DE3A 3IF6A 4LV0A 4PM6A 4UA9A 3O88A 5G18A 2H5SA 3M6BA 4OONA 1FCMA 5FI7A 2Y2KA 5GLBA 2H0TA 1BLCA 5DF8A 3UNWA 2C6WB 1H8YA 4KZ8A 4Q8IA 5FQMA 2Y2PA 1AXBA 2IWCA 4X69A 3QNBA 4KQRA 1W8QA 3N4IA 2XGNA 4RYEA 2XFTA 4H8RA 4IBRA 4S2IA 4XUZA 3WS2A 3ZG5A 3FKWA 2ZLYA 4GDBA 1IKIA 5CXWA 1K57A 4LV2A 2Y2OA 4S2NA 2XF3A 1KE3A 3HLEA 3NI9A 4WMCA 2CC1A 1IELA 2PU2A 4GB7A 3G32A 3IWIA 3UPNA 4C6YA 4FCFA 3HLGA 5CGXA 2OLVA 1IYQA 5F1FA 1K57C 1FR6A 2JBFA 1KE4A 4ZBEA 1I5QA 1XP4A 4JXSA 4OKPA 5CTMA 4S2JA 3BRMA 1HTZA 3P98A 3PBQA 3S22A 4IEDA 3CJMA 4BLMA 4U0TA 5EECA 3B3XA 3O87A 3MFDA 2E8IA 3ITAA 4UA6A 2Q9NA 3LCEA 1I2WA 4R4SA 2DNSA 2RCXA 4EUZA 3FWLA 5GLAA 5AQBA 3RXWA 3UE1A 4MBKA 2Y2MA 4KZ6A 5A91A 2ZQCA 1L0GA 4OQHA 5FQJA 1PW1A 5TR7A 1NYMA 4DE0A 2P9VA 1HD8A 5DTKA 5KMWA 1K55C 2B5RA 1YLWA 3O86A 3C7VA 3ZG0A 5CGSA 3TSGA 1E25A 1NRFA 3C4PA 4KZ9A 5GHYA 4C75A 3SS5A 1CEGA 5KZHA 2FFFB 5F1GA 4BJPA 1EI5A 1H8ZA 2P74A 3CG5A 3QHYA 4GN2A 5GHXA 3VSKA 1W7FA 3BFFA 1SHVA 3A3DA 1BTLA 5M18A 5EVID 1K54A 1PWCA 2X01A 4N1XA 1J9MA 1XPBA 3NDEA 3IH8A 4ZAMA 3W4PA 2OSUA 1IKGA 4DXBA 4GD6A 1ZC2A 5L2FA 1FOFA 2UWXA 4RX2A 5HAIA 2QZ6A 1FQGA 2IWBA 1KE0A 1K4EA 1YM1A 1XXMA 3ZG9B 4BL3A 1Q2QA 1DJBA 3C4OA 3NBLA 1L0EA 3C7UA 4FD8A 1K38A 4BL2A 4ID4A 4KQOA 1CI9A 4E3OA 4O7DA 5I94A 1KDWA 4JLFA 1ESUA 5DTTA 3E2KA 4KZ5A 5FI6A 3OPHA 1BUEA 3Q82A 3MZDA 5CHJA 3AGDA 2EX8A 3UE0A 1FCOA 4X53A 1RCJA 3G2ZA 2GDNA 3P09A 3GVBA 3FYZA 3G35A 4B4ZA 1BT5A 5EPHA 3MZEA 3PAGA 1GA9A 3BFGA 3PBSA 1CK3A 2EXBA 4IVIA 2I72A 3BYDA 1GA0A 3AGEA 4M3KA 3SH7A 5M1AA 5EVIA 3VP1A 1ES3A 1SDEA 2HDQA
chains in the Genus database with same CATH superfamily
3R7WA 5E2EA 3WS1A 2ZQAA 2EX9A 4OOMA 4MN6A 1J3WA 3TG9A 1K4FA 4EQIA 4LENA 1N9BA 1T19A 3PHYA 4CPKA 2ZM2A 2PBYA 4HOIA 4GCZA 2WKIA 5DFXA 5HAQA 3CZDA 3IF5A 3W4QA 3BFCA 2BLSA 3GQZA 3OC2A 3UDIA 4M4XA 4EERA 1IYSA 4MBFA 1PI4A 2L1MA 3IF6C 5FAQA 3ZVWA 2P7JA 2Y2QA 3ZNYA 4S2MA 5IU1A 2V2FF 2XA7M 3IXHA 5CTNA 2XA7S 4JF5A 3K2NA 4OLGA 3H7WB 1G5UA 2Q0OA 1ZHHB 4P6BA 1DRMA 2K31A 2R9WA 3PXPA 2Y79A 1ALQA 3NY4A 4GD8A 4EV4A 4KZ7A 2OV5A 1EW0A 1MWTA 3F1NB 5F83A 1QMEA 3FZCA 5CGWA 1YLYA 4XXRA 5TBMB 3BLMA 1CI8A 1H5XA 3V67A 2XDMA 3D72A 1ERQA 4NXEA 1Y28A 1OTAA 2JKRM 5E2FA 2VA0A 3Q1FA 5DTSA 2J80A 2WGWB 4Y7PA 5MC7A 1XJ3A 1VEUA 2J9PA 3LEZA 3HUOA 1S4SA 2Y2LA 3DTKA 3KYQA 1TS0A 3W4OA 5CEBA 5DF7A 3TOIA 1U60A 4F94A 1YLPA 3ZYTA 1XX2A 4JGOA 4R23A 2PDRA 4R4RA 5HX9A 3DWKA 4HBTA 1OT9A 3MR0A 5FASA 1W79A 3PTEA 3GTCA 4OOYA 1KVMA 3CUEA 2W27A 2Y91A 4JXVA 1BULA 3CAXA 4HQAA 4KZ4A 4BD1A 2L4RA 4AFIA 2JKRI 4HESA 5EM1A 2ZC6B 4HP9A 3H82A 4HY8A 1L0FA 1O07A 4L0LA 4CJNA 1LI9A 4E3MA 1EWZA 1W5DA 4UHUA 3FV7A 2RL3A 2WUQA 1L3LA 2WKHA 2V1ZA 2VV7A 2HGVA 1YSPA 1SDNA 4WEJA 5EV0A 3D4FA 4LLOB 2B18A 4IBXA 1NZUA 2EA9A 1MWSA 4PM8A 3VMAA 1ZG6A 2Y2IA 2X71A 3TE8A 1YSQA 4KG2A 3IXBA 1PWDA 1TS6A 3G2YA 4PKYG 1FR1A 3F1OA 4R0QA 4HH2A 3V3SA 4EEPA 1KGFA 1F2KA 1LL8A 3PBNA 4R70A 4NETA 5EUAA 4Y15A 4P6ZM 4QY5A 1MXOA 3P01A 2G2WA 3E0YA 1GHIA 2K2NA 4YNRA 2A2LA 2DRWA 2ZM0A 4Y5FA 4S2KA 5TFQA 4KZAA 4X6TA 5EOOA 3RH8B 3MBZA 5HWVA 4Y0UA 2BASA 2OOLA 3T4OA 1TVFA 4E3KA 2WGVA 2M7UA 4KZBA 1LL9A 5HAPA 4Y17A 3L9KA 1ONHA 3U4LP 5GLDA 3ULFA 3A3EA 1S0WA 5F68A 2HF6A 1XJ2A 4QD4A 1P9WA 4HI4A 4E3NA 2WYXA 2YKFA 5A8BA 1JVJA 3NCKA 5TBMA 3MS6A 2WKRA 3LO7A 3HJKA 4WYYA 4PMAA 2EFXA 3T12B 3MMHA 4BBTA 3ISGA 2PR6A 2V1AA 5FI2A 3UDXA 3V3RA 3UO9A 1IYPA 2OWJA 3FKVA 5DJTA 3G34A 2Y2JA 3S1YA 1YLJA 3OPRA 4IJGA 4PM6A 2H5SA 1FCMA 2VGLM 2Y2KA 3MQQA 5IT5A 1BLCA 5DF8A 1K0KA 3D3OA 1H8YA 1NLZA 1PNEA 2Y2PA 5FQMA 1AXBA 4X69A 4KQRA 4RYEA 2XFTA 3K3DA 1IKIA 5CXWA 1K57A 2Y2OA 3NI9A 4WMCA 4GB7A 3G32A 3UPNA 5HDSA 4ZRRA 5F1FA 1IYQA 1K57C 5CTMA 1OTEA 2GNXA 3CJMA 3MFDA 3ITAA 3O5YA 1LT0A 4P6ZS 5GLAA 3RXWA 4MBKA 5A91A 2ZQCA 2HZ5A 1L0GA 5FQJA 1NYMA 5KMWA 5GHYA 3C4PA 2PRFA 1CEGA 3IS2B 4IHQA 2FFFB 4KUKA 3QHYA 3CUEC 3A3DA 2X01A 1PWCA 1XPBA 3BJNA 3IH8A 2PT7A 3F1OB 4RX2A 4BL3A 4UQIM 1Q2QA 2M1CA 1KDWA 3LGOA 4KZ5A 5C5KA 5FI6A 1BUEA 4CLCA 3LR3A 1F5MA 1RCJA 3G2ZA 3GVBA 5CX7A 4B4ZA 4WL9A 1GA9A 2EXBA 2I72A 1GA0A 3AGEA 3BY8A 3SH7A 2VKSA 3HJIA 4BMWA 2ZL1A 3N6IA 4XT2B 1LI0A 1RGZA 3VOYA 4ETXA 1DY6A 1NLYA 3MZFA 4CQHA 4WELA 3DBAA 1ODVA 2JKFA 1BZAA 1DP8A 3LUQA 2O99A 2M7VA 5CRFA 4EUVA 2OLUA 3S7NA 5F82A 3ZHHA 3LR4A 4N92A 3SH9A 1TDGA 3E4PA 4OP8A 1WE4A 3IT9A 3BLSA 1G6AA 1LSVA 3DTMA 4L9FA 3VOLA 3EWKA 1PI5A 4WUJA 3Q07A 2ZC4B 2VJWA 3CPTA 1LLBA 1K55A 3MKEA 4Y3IA 2Y2HA 3DAVA 4IUHA 1RP5A 2W3EA 1CF0A 3A0VA 4CLCE 1D1JA 2VGKA 4XUXA 3AGFA 3BM6A 4OPZA 4QJGA 4QU3A 1DJAA 1EROA 4GJ4A 5CERA 4CLCC 2JKGA 1F9IA 4HNBA 2HDRA 2EWVA 4MNRA 4RQ9A 1VETB 1GHPA 4X56A 1KDSA 4LGWA 4WMCD 2H28A 1OJGA 4P0MA 3ZNTA 2H0YA 3LIEA 4OP5A 5FQQA 4RA7A 1NWZA 4S2NC 2J9OA 2XLNA 2KDKA 3LY4A 1YAXA 3N8SA 3OCLA 3IS2A 3N8LA 1LHYA 2KOIA 2ZQDA 3ZG7B 3T4LA 3EQUA 2EX6A 1SCWA 3VFHA 4OPQA 3H7WA 4LRZE 5M19A 3Q7VB 2HJEA 4NXGA 5A93A 2NUTC 1YT4A 4OQ0A 4GW9A 1VM1A 2XSSA 2Z2MB 3HLCA 3ZDJA 4E3IA 3QP5A 3LR0A 5FAPA 5BOHA 5GL9A 4S2PA 1OJ5A 1H8MA 4D60A 1ZG4A 4HBUA 5DFYA 4I39A 2W3GA 2Y4AA 2QHKA 2WK0A 5LBRA 5HARA 2ZC7A 1XGJA 4K0XA 4FH2A 4NXBA 3PAEA 1JWPA 4NXFA 3R7WB 5DJUA 1ES5A 3GMWA 2AVXA 5FAOA 4NEED 2E8JA 4B93A 1K56D 1SZVA 3HLDA 3ITBA 4S2OA 1N9LA 5HDCA 1NJ4A 4L9EA 3A3IA 2V0UA 5EE8A 2FFYA 2J8YA 3G31A 1QMFA 5EVLA 3I7JA 4WZ4A 2GX5A 4LCLA 4BBUA 4DMZA 2XH9A 5DKKA 3VE3A 3WS0A 1A0KA 1MPLA 3OLOA 3EGXC 3JVUA 4LCMA 4PAUA 3F1PA 4HEFA 5J3WA 4CLCB 5U47A 1PZOA 3LIDA 1Y4OA 3S4XA 2VX8A 2ZMAA 2XRNA 1BLPA 3OZHA 5G4YA 2QJ7A 3RJUA 5FDSA 2Q9MA 1CJFA 4FUWA 4L9GA 4Y13A 4GHIB 1D06A 3G30A 1D7EA 4G3WA 4BWIA 2ZOIA 2DMWA 4ME4A 3C5AA 1OMEA 1XKZA 1X0OA 2HP9A 1V9ZA 2O9BA 4KZ3A 1BSGA 5DKLA 2GJ3A 1JNUA 2P04A 2A49A 1K56A 2XEPA 4DXCA 5FEFA 1PFLA 2ZM8A 4MLLA 4PM5A 1AWIA 2LB5A 2V1BA 3V5MA 5IHVA 3FC7A 4PPRA 2Y8HA 3HUNA 3UE3A 4Y0TA 4QPRA 1GSWA 4I3JA 1SKFA 5L09A 2V8FA 3L7HA 2X02A 1T1CA 2WGIA 2FZ0A 1OTDA 1P97A 3KYEA 3VP0A 3P7NA 3ZFZA 2EX2A 2ZBBA 5E2HA 2WZXA 5K5BA 3LFVA 4DE3A 4OQIA 2BTFP 5GLBA 2H0TA 3KYZA 4Q8IA 3C30A 2V8CA 1S67L 3N4IA 4XUZA 4IBRA 4S2IA 3WS2A 4LV2A 4FTXA 3CLOA 3CHWP 2ZL1B 3LIFA 1F98A 3IWIA 3T1SA 4EU0A 1KE4A 3QP1A 4S2JA 4X1LA 5EECA 4UQIS 3EEAA 3LIBA 3BW6A 3LCEA 1I2WA 2RCXA 1XFQA 4DN0A 1PW1A 3C38A 4HH3A 2P08A 5J7EA 4DE0A 2P9VA 4GHIA 2B5RA 3O86A 3TSGA 1E25A 1NRFA 2B02A 1XJ6A 4C75A 1S1YA 4EEUA 1T1AA 5FL3A 1UGUA 4GN2A 5GHXA 3CITA 3VSKA 2PD7A 3LI8A 3IX4A 1S4RA 2I9VA 4N1XA 1J9MA 4Y2FA 1MKMA 4ZAMA 2OSUA 3KO6A 4GD6A 3E98A 1FQGA 5HD5A 1YM1A 3ZG9B 1XXMA 3IX3A 3C7UA 4G3VA 4KQOA 3NOUC 1ESUA 4DJ2A 4R3AA 3MZDA 3ICYA 3AGDA 5CHJA 3P09A 3G35A 1BT5A 3DTEA 3PBSA 1CK3A 1W63M 3BY9A 3NHQA 4M3KA 5EVIA 5E2GA 4ZJ2A 4GKUA 3S7QA 3Q7ZA 1RGYA 4KQDA 3T4JA 3VOZA 4EWFA 1WYBA 4G3KA 1OTIA 4D2OA 3OPLA 1IYOA 1YPRA 3PBOA 5A92A 1CEFA 5CECA 4O8GA 3LYXA 5HWWA 1PZPA 5CHMA 3GRJA 1SKOB 3LY3A 1HZOA 4P87A 3W2ZA 1BLHA 1W8YA 1P0ZA 1L0DA 3PBTA 2C5WB 2A24A 2W0NA 1VHMA 3D9YA 2XR0A 3MXQA 4QY6A 5TGFA 1ONGA 4HP4A 4OLDA 2VGJA 4E6XA 4RX3A 2QPNA 3M6HA 2R78A 5DVAA 4OVDA 1YMSA 3C8CA 4JGRA 4X68A 2Y59A 3Q7VA 5FATA 5CEDA 3IHBA 5IS1A 4ARZB 2Y55A 4B9OA 3FPWA 2QMIA 4Z9QA 2VZWA 4LV1A 4X55A 3WS4A 5HFOA 5HPIA 1PYYA 5EVEA 3SH8A 5AQ9A 4EXOA 2ACGA 5GHZA 5GLCA 3UB7A 5FQIA 2QWSA 3GR2A 4A5RA 1LL5A 3E2LA 4Q0HA 1WA9A 2XD1A 2YKHA 2Y2NA 2QYBA 2V20A 5AQAA 1K6RA 4JXGA 1G6OA 3RFBA 1ZKJA 3PBRA 2WAEA 4NG2A 2O9CA 1FSWA 1XA7A 4I5SA 5HD3A 3TJZC 4ETZA 3SW1A 3PYPA 2ZMVA 2A3UA 2ZMFA 4QB8A 2J3TC 2ZQ9A 1VQQA 2H10A 1NZOA 4JKTA 3SS4A 4Y0OA 1JWZA 1IEMA 3OPPA 3W8KA 3BFEA 4HJ3A 5HL1A 5DF9A 3KSFA 3DW0A 3Q81A 3MKFA 4I3IA 1MWRA 3B33A 4H6JA 5AVEA 2PAVP 1P9RA 5D3OA 2V9AA 2WGWA 3BQAA 4N9LA 1YLZA 4YOFA 3CMZA 2XROA 2KX6A 4GDNA 3UDFA 1DP9A 4LFUA 5A90A 2XFSA 3UB8A 3GSGA 3UPOA 1N4OA 5FA7A 3ZQ5A 1TS8A 2Y2GA 1MBLA 1NXYA 4R6LA 3T4TA 2MJ6A 5TJJA 2WADA 1JWVA 2D01A 3JYIA 1WYCA 4DDSA 3NC8A 5FSRA 2G2UA 4MN7A 5HW3A 4LRYC 1ES2A 2QJ5A 3NECA 3KSIA 1H3QA 4IVKA 1XA1A 1PRQA 2DCFA 4JXWA 3T4SA 4K91A 4UAAA 4N1HA 4DKIA 4LPZA 3VP2A 2A24B 3UB9A 5F6AA 3WS5A 1TEMA 1S1ZA 2O0YA 4OOLA 4BD0A 3IF6B 4F3LA 3VSLA 5EVIC 1OTBA 3GECA 1DP6A 3MXRA 3UMDA 5HL6A 4JBFA 3UY6A 3RTYA 4QWOA 3UN7A 3LR5A 3QNCA 4PKYA 3C2WA 3T50A 1XJ4A 4R3JA 4NKPA 4B88A 1KGGA 2W3FA 4K0WA 3BECA 3VV4A 3MQ0A 1JTDA 4LV3A 2WAFA 2JKTM 3NJAA 2W1RA 3EGDC 2BG1A 5J8XA 3M2KA 3UB6A 3LEQA 4HIAA 2JE5A 3R4KA 4DF6A 1N9OA 4YINA 2HDUA 3HLWA 1K6SA 3HCYA 4FH4A 1K54C 4PM7A 1C3BA 4GNUA 3VFFA 3IX8A 2R9XA 4JF6A 2W1TA 4ZTKA 3SS3A 5CHUA 1H0MA 1VB6A 4FSFA 3GV9A 5AJGA 5L8MA 3ZGAB 3IF6A 4LV0A 5G4ZA 3O88A 3M6BA 1VETA 4OONA 3KSGA 2JN7A 3UNWA 2C6WB 2IWCA 1CQAA 1W8QA 4H8RA 3IBRA 3NOPC 4WLAA 3E4QA 1HLUP 1KE3A 3OBFA 3HLEA 2HV1A 2CC1A 2PU2A 2W1TB 2OAQ1 3HLGA 1I5QA 4JXSA 4OKPA 3BRMA 1HTZA 3PBQA 4IEDA 5FEGA 4BLMA 4U0TA 4H6JB 2E8IA 4UA6A 2Q9NA 4R4SA 3MSHA 3FWLA 4O0PA 4KZ6A 1G28A 4X1MA 5F5YA 1N9NA 4ESPA 1HD8A 5DTKA 1K55C 3NOTC 1YLWA 5CGSA 4KZ9A 5EFWA 3SS5A 1EI5A 1H8ZA 2P74A 3T1XA 5KIZA 3BFFA 3JVVA 3QP4A 5M18A 5EVID 1K54A 3NDEA 1IKGA 2WKQA 1ZC2A 2UWXA 4Q0JA 3KSHA 2Z6DA 3C4OA 1DJBA 3KX0X 3NBLA 4FD8A 4ID4A 1CI9A 4E3OA 2B95A 4O7DA 2PD8A 4JLFA 2VGLS 1FIKA 5DTTA 2VEAA 4O01A 3OPHA 2EX8A 1FCOA 4X53A 5L10A 2GDNA 5EPHA 3MZEA 3PAGA 3BFGA 4IVIA 3BYDA 5HPFA 5M1AA 3VP1A 1ES3A 4FOFA 1SDEA 1ZTUA 2HP5A 1T18A 1FCNA 4OPRA 2QKPA 4F3LB 2HP6A 4U3TA 3EOIA 1LSXA 2VV8A 3F1PB 4UA7A 3ZG8B 1YQSA 5AQ7A 1L2SA 4HHDA 4EQ1A 3VP3A 4MBHA 4IUKA 2J7VA 3WRTA 3LI9A 3GDIA 1ES4A 1FSYA 3NIAA 3T1RA 3G6OA 1E3UA 3IH9A 4Q0IA 2W3DA 4YWZA 1VEUB 1DJCA 3IQAA 5FQ9A 1TD5A 3A0SA 3ZVTA 1ESIA 1YLTA 1M6KA 3S7OA 3BEBA 4KG6A 3A3JA 2OWHA 1I2SA 2VV6A 3N7WA 1MC0A 3QP2A 3RXXA 1T1BA 4GOGA 4EBNA 4DDYA 2O9AA 3K3CA 3UPPA 4E04A 1KVLA 4K08A 1GSXA 2HDSA 5HDDA 1STZA 1BLSA 2J3TD 1IOUA 2W3HA 4I38A 4GS9A 4OH0A 1NYYA 2XK1A 1GHMA 3MQOA 4YFMA 3IHAA 2EFUA 2ZD8A 4MCWA 1MKIA 1UWPX 4KQQA 2WKPA 3DWZA 2PYPA 4WBGA 1PW8A 3BFDA 3HUMA 3HLFA 3UE6A 1E3UD 2PU4A 3BWLA 4X25A 1UWNX 4WF0A 3VE4A 2PBDP 4E6WA 4WZ5A 4BENA 1ACFA 1Z6FA 4UEYA 3V39A 3WWXA 5JYPA 3CPTB 3MXSA 2GZAA 2ZC3B 4EESA 1G68A 3SOIA 4WZ5C 2KLIA 1LSWA 4KG5A 5FDHA 2INWA 1M40A 5EM0A 3G4PA 3HVFA 3A3FA 4E3JA 4LRXC 4WM9A 4GZBA 3M2JA 2XD5A 4KUOA 3PR6A 1YMXA 2IWDA 4P85A 3HL9A 2D02A 3DTIA 4KENB 1S6RA 4BQMA 4RVAA 4GS9B 1GSVA 2ZQ7A 2WZZA 4WEKA 3MF0A 2P9VB 3UMEA 3QP6A 2Z2LB 1PWGA 2FH5A 4EW7A 3IXGA 4MDZA 4OPYA 4DE2A 2IA2A 4R1GA 5L07A 4JF4A 3TW8A 3CI6A 3IXDA 1OPXA 4EBPA 3NDGA 1K25A 3QP8A 2G7UA 5HZHA 4QHCA 4E3LA 4EBLA 4JPMA 2WKEA 3FG8A 4OQGA 2ZC5B 3HREA 1GCEA 4MN5A 2JC7A 1W63Q 5JYOA 1Q2PA 2HPBA 1XFNA 5AVFA 3WRZA 3SZTA 4S2LA 2ZJ9A 4I3AA 5EVIB 4ZDXA 3EEHA 3LICA 1Y54A 3N8RA 1MWUA 4N9KA 3H82B 5J4EA 2LB9A 2PHYA 1TF1A 2J3WA 3TRCA 2JCHA 4NK3A 2EXAA 4R3BA 2V0WA 1XGIA 3EQVA 5KSCA 3U2AA 4ZJ1A 3HBRA 3VP4A 3T1QB 3V50A 1SKOA 3IWQA 4JGQA 4C3QA 2VLGA 3B42A 5E43A 1JTGA 2XQZA 4B4XA 4PM9A 4MMNA 3HLBA 4CLCD 1BYWA 4HJ6A 4Z1WA 2ZOHA 1NY0A 3T4KA 2PR5A 3IWOA 3OCNA 4ARZA 4DE1A 1KGEA 4ZJ3A 4PHTA 2ZQ8A 1V9YA 2HJ9C 1ERMA 1HVBA 2JHEA 4DRTA 5FQKA 5F69A 1O7EA 5HSQA 5EOEA 2CMNA 3ZCZA 3MJQA 4MEZA 1E4DA 1MY8A 4U0XA 2OAP1 5KSHA 1PIOA 1Z09A 2VK3A 1S66L 4II7A 1TDLA 3O3VA 2K7SA 4UA9A 1OT6A 5G18A 3E4OA 5FI7A 1YKDA 4KZ8A 3NULA 3QNBA 3UB5P 2XGNA 3ZG5A 3FKWA 2ZLYA 4GDBA 4S2NA 2XF3A 1NRJA 3T4QA 2UV0E 3H9WA 1IELA 1IFQA 4C6YA 4FCFA 5CGXA 2OLVA 2JBFA 1FR6A 3B47A 4ZBEA 1XP4A 3S22A 3P98A 3A0RA 3BQ8A 3B3XA 3LIAA 3O87A 3FPVA 3OOVA 1MZUA 1TS7A 2DNSA 4EUZA 5AQBA 3UE1A 2Y2MA 4EETB 2EWWA 4BBVA 3JPUA 4OQHA 4HJ4A 5TR7A 2Z6CA 5HWTA 5I5LA 3C7VA 3ZG0A 4XT2A 3MFXA 5KZHA 5F1GA 4BJPA 4R38A 2PYRA 3CG5A 2NUPC 4WN5A 1W7FA 1KOUA 1SHVA 4GLQA 1BTLA 3W4PA 4DXBA 5L2FA 1FOFA 1FILA 5HAIA 2QZ6A 2IWBA 1KE0A 1K4EA 3IBJA 1L0EA 1K38A 4BL2A 2JKTI 5I94A 4JGPA 3E2KA 2L0WA 3Q82A 3UE0A 3FYZA 4DJ3A 3CWFA 3S7PA 3F1NA 2HDQA
chains in the Genus database with same CATH topology
2HP5A 4OPRA 1FCNA 5E2EA 5E2GA 4ZJ2A 3WS1A 3N6IA 2ZQAA 4GKUA 1LI0A 2EX9A 2HP6A 1RGZA 3Q7ZA 1RGYA 3VOYA 4U3TA 4OOMA 3VOZA 4EWFA 1WYBA 4UA7A 3ZG8B 1YQSA 3TG9A 5AQ7A 4D2OA 1DY6A 3OPLA 1K4FA 1L2SA 3MZFA 1IYOA 3PBOA 4EQIA 5A92A 1CEFA 5CECA 4LENA 4WELA 1N9BA 1PZPA 5CHMA 3VP3A 1BZAA 3GRJA 4MBHA 3LY3A 1HZOA 2J7VA 4P87A 3WRTA 4CPKA 2ZM2A 2PBYA 5CRFA 1BLHA 1W8YA 2OLUA 1L0DA 3PBTA 2WKIA 5F82A 3ZHHA 1ES4A 5HAQA 1FSYA 2C5WB 3CZDA 3IF5A 3NIAA 3W4QA 3BFCA 4N92A 3SH9A 2BLSA 1TDGA 2XR0A 1E3UA 3GQZA 3OC2A 4OP8A 3IH9A 3UDIA 1IYSA 4QY6A 1WE4A 3IT9A 3BLSA 4MBFA 1PI4A 1DJCA 1ONGA 3IQAA 5TGFA 1G6AA 5FQ9A 3DTMA 2VGJA 3IF6C 4OLDA 3ZVTA 4E6XA 4RX3A 1ESIA 1YLTA 1M6KA 5FAQA 3BEBA 2QPNA 3ZVWA 3M6HA 2Y2QA 5DVAA 4OVDA 1PI5A 4KG6A 1YMSA 3A3JA 3Q07A 4S2MA 3ZNYA 1I2SA 2V2FF 2ZC4B 4X68A 1LLBA 2Y59A 3IXHA 3N7WA 5CTNA 3Q7VA 5FATA 1K55A 4JF5A 3IHBA 3MKEA 5CEDA 2Y2HA 3RXXA 4GOGA 4EBNA 4OLGA 4DDYA 1RP5A 2VGKA 4XUXA 3AGFA 3UPPA 2Y55A 3BM6A 4P6BA 1KVLA 2R9WA 4OPZA 2QMIA 4Z9QA 2HDSA 4QJGA 1ALQA 3NY4A 4GD8A 4LV1A 4EV4A 1BLSA 4QU3A 4KZ7A 4X55A 2OV5A 1MWTA 5F83A 1DJAA 1QMEA 5HFOA 3WS4A 3FZCA 5CGWA 1YLYA 4XXRA 3BLMA 1EROA 4OH0A 5CERA 1NYYA 1H5XA 1CI8A 2XK1A 1GHMA 4YFMA 3IHAA 1PYYA 2XDMA 2EFUA 2HDRA 3SH8A 2ZD8A 1ERQA 4MNRA 1MKIA 5AQ9A 4KQQA 1GHPA 5GHZA 4X56A 5GLCA 5E2FA 3DWZA 1KDSA 4WBGA 5FQIA 1PW8A 3BFDA 3GR2A 3HUMA 3Q1FA 4A5RA 3HLFA 4WMCD 5DTSA 1LL5A 3E2LA 4P0MA 3ZNTA 2H0YA 2WGWB 4Y7PA 2XD1A 1E3UD 2Y2NA 4OP5A 2PU4A 2V20A 5FQQA 4RA7A 5AQAA 1K6RA 4S2NC 2J9OA 2XLNA 2J9PA 4JXGA 3LEZA 3HUOA 2Y2LA 1ZKJA 3LY4A 4E6WA 3N8SA 3PBRA 3OCLA 4WZ5A 3W4OA 2WAEA 4BENA 1Z6FA 3V39A 3N8LA 5DF7A 5CEBA 3WWXA 5JYPA 1FSWA 1LHYA 3TOIA 2ZQDA 3ZG7B 3MXSA 1U60A 1XA7A 2ZC3B 4F94A 1G68A 1YLPA 3EQUA 1XX2A 4R23A 3SOIA 2EX6A 1SCWA 4WZ5C 3VFHA 4KG5A 4OPQA 5FDHA 2A3UA 4QB8A 4R4RA 5M19A 5HX9A 3DWKA 4HBTA 3Q7VB 1M40A 3G4PA 5A93A 3HVFA 3A3FA 4E3JA 2ZQ9A 5FASA 1W79A 3PTEA 3GTCA 4WM9A 4GZBA 1VQQA 1KVMA 4OOYA 2H10A 3M2JA 1YT4A 4OQ0A 1NZOA 1VM1A 2XD5A 4JKTA 2Z2MB 3SS4A 3HLCA 4Y0OA 3ZDJA 1YMXA 1JWZA 1IEMA 2IWDA 4E3IA 4P85A 2Y91A 3OPPA 4JXVA 3HL9A 1BULA 3W8KA 3BFEA 4KZ4A 5HL1A 5DF9A 4BD1A 4KENB 5FAPA 1S6RA 4BQMA 3DW0A 3Q81A 4RVAA 5BOHA 5GL9A 3MKFA 4S2PA 1MWRA 4HESA 2ZC6B 1ZG4A 2ZQ7A 5D3OA 4HBUA 2WZZA 4WEKA 2Y4AA 2P9VB 2WK0A 2WGWA 2Z2LB 1PWGA 4N9LA 1L0FA 1YLZA 3IXGA 5HARA 2ZC7A 1O07A 1XGJA 3CMZA 1LI9A 4K0XA 4L0LA 4CJNA 4OPYA 4FH2A 4E3MA 1EWZA 1W5DA 4DE2A 4UHUA 3FV7A 3PAEA 2RL3A 4GDNA 4R1GA 3UDFA 1JWPA 4JF4A 1ES5A 2WUQA 3GMWA 5FAOA 2WKHA 2V1ZA 5A90A 3IXDA 2XFSA 3UPOA 1SDNA 3GSGA 4WEJA 1K56D 1N4OA 3D4FA 3HLDA 3ITBA 4S2OA 4EBPA 5FA7A 4IBXA 1NZUA 1K25A 1NJ4A 3NDGA 1MWSA 2Y2GA 4PM8A 4QHCA 3VMAA 4E3LA 1MBLA 1NXYA 3A3IA 1ZG6A 2Y2IA 2X71A 4EBLA 4JPMA 4KG2A 3IXBA 5EE8A 2FFYA 2WKEA 2J8YA 2WADA 1PWDA 3G31A 1QMFA 3G2YA 1FR1A 1JWVA 5EVLA 4OQGA 3JYIA 3I7JA 2ZC5B 1WYCA 4R0QA 4DDSA 3NC8A 4WZ4A 5FSRA 3V3SA 1KGFA 2G2UA 3HREA 4LCLA 5HW3A 3PBNA 1GCEA 2JC7A 1ES2A 2XH9A 5JYOA 1Q2PA 3WS0A 1MPLA 4NETA 5EUAA 4QY5A 1MXOA 2HPBA 4LCMA 4IVKA 1XA1A 2G2WA 3WRZA 4HEFA 1GHIA 2DCFA 4S2LA 4JXWA 5U47A 4K91A 2ZJ9A 4UAAA 1PZOA 4N1HA 5EVIB 4ZDXA 2DRWA 4DKIA 2ZM0A 3S4XA 1Y54A 2ZMAA 1BLPA 3OZHA 3VP2A 3N8RA 4S2KA 1MWUA 3RJUA 2Q9MA 5TFQA 4KZAA 4N9KA 3WS5A 1TEMA 4X6TA 5EOOA 3MBZA 4Y0UA 4OOLA 1TVFA 4BD0A 3IF6B 2JCHA 4NK3A 4E3KA 2EXAA 2WGVA 4R3BA 3VSLA 3G30A 5EVIC 1XGIA 3EQVA 4KZBA 1LL9A 5KSCA 4ZJ1A 3MXRA 5HAPA 3HBRA 3VP4A 3V50A 4JBFA 3IWQA 3C5AA 1OMEA 1XKZA 4C3QA 3UY6A 1ONHA 2HP9A 5E43A 4KZ3A 5GLDA 1JTGA 2XQZA 1BSGA 4B4XA 3A3EA 1S0WA 4PM9A 3UN7A 3HLBA 3QNCA 2A49A 4R3JA 1K56A 2XEPA 4DXCA 4QD4A 4B88A 2ZM8A 4MLLA 1KGGA 1NY0A 2WYXA 4E3NA 3IWOA 4PM5A 3OCNA 4DE1A 1KGEA 4K0WA 1JVJA 3BECA 3NCKA 4ZJ3A 1JTDA 2ZQ8A 4LV3A 2WAFA 3V5MA 1ERMA 5IHVA 1HVBA 2BG1A 5J8XA 4PPRA 4DRTA 3HUNA 3M2KA 3LO7A 5FQKA 3UE3A 4Y0TA 2JE5A 4WYYA 1O7EA 4PMAA 2EFXA 4DF6A 5EOEA 1SKFA 3ISGA 4YINA 5FI2A 2HDUA 3HLWA 3ZCZA 4MEZA 1E4DA 1K6SA 3UDXA 1MY8A 1K54C 4FH4A 2X02A 4PM7A 2WGIA 3V3RA 1C3BA 4U0XA 4GNUA 3UO9A 3VFFA 1IYPA 3FKVA 2R9XA 4JF6A 3G34A 3VP0A 5KSHA 1PIOA 4ZTKA 3SS3A 5CHUA 3ZFZA 2EX2A 5E2HA 2Y2JA 3S1YA 1YLJA 2WZXA 4FSFA 3GV9A 1TDLA 3OPRA 3O3VA 4OQIA 3ZGAB 4DE3A 3IF6A 4LV0A 4PM6A 4UA9A 3O88A 5G18A 2H5SA 3M6BA 4OONA 1FCMA 5FI7A 2Y2KA 5GLBA 2H0TA 1BLCA 5DF8A 3UNWA 2C6WB 1H8YA 4KZ8A 4Q8IA 5FQMA 2Y2PA 1AXBA 2IWCA 4X69A 3QNBA 4KQRA 1W8QA 3N4IA 2XGNA 4RYEA 2XFTA 4H8RA 4IBRA 4S2IA 4XUZA 3WS2A 3ZG5A 3FKWA 2ZLYA 4GDBA 1IKIA 5CXWA 1K57A 4LV2A 2Y2OA 4S2NA 2XF3A 1KE3A 3HLEA 3NI9A 4WMCA 2CC1A 1IELA 2PU2A 4GB7A 3G32A 3IWIA 3UPNA 4C6YA 4FCFA 3HLGA 5CGXA 2OLVA 1IYQA 5F1FA 1K57C 1FR6A 2JBFA 1KE4A 4ZBEA 1I5QA 1XP4A 4JXSA 4OKPA 5CTMA 4S2JA 3BRMA 1HTZA 3P98A 3PBQA 3S22A 4IEDA 3CJMA 4BLMA 4U0TA 5EECA 3B3XA 3O87A 3MFDA 2E8IA 3ITAA 4UA6A 2Q9NA 3LCEA 1I2WA 4R4SA 2DNSA 2RCXA 4EUZA 3FWLA 5GLAA 5AQBA 3RXWA 3UE1A 4MBKA 2Y2MA 4KZ6A 5A91A 2ZQCA 1L0GA 4OQHA 5FQJA 1PW1A 5TR7A 1NYMA 4DE0A 2P9VA 1HD8A 5DTKA 5KMWA 1K55C 2B5RA 1YLWA 3O86A 3C7VA 3ZG0A 5CGSA 3TSGA 1E25A 1NRFA 3C4PA 4KZ9A 5GHYA 4C75A 3SS5A 1CEGA 5KZHA 2FFFB 5F1GA 4BJPA 1EI5A 1H8ZA 2P74A 3CG5A 3QHYA 4GN2A 5GHXA 3VSKA 1W7FA 3BFFA 1SHVA 3A3DA 1BTLA 5M18A 5EVID 1K54A 1PWCA 2X01A 4N1XA 1J9MA 1XPBA 3NDEA 3IH8A 4ZAMA 3W4PA 2OSUA 1IKGA 4DXBA 4GD6A 1ZC2A 5L2FA 1FOFA 2UWXA 4RX2A 5HAIA 2QZ6A 1FQGA 2IWBA 1KE0A 1K4EA 1YM1A 1XXMA 3ZG9B 4BL3A 1Q2QA 1DJBA 3C4OA 3NBLA 1L0EA 3C7UA 4FD8A 1K38A 4BL2A 4ID4A 4KQOA 1CI9A 4E3OA 4O7DA 5I94A 1KDWA 4JLFA 1ESUA 5DTTA 3E2KA 4KZ5A 5FI6A 3OPHA 1BUEA 3Q82A 3MZDA 5CHJA 3AGDA 2EX8A 3UE0A 1FCOA 4X53A 1RCJA 3G2ZA 2GDNA 3P09A 3GVBA 3FYZA 3G35A 4B4ZA 1BT5A 5EPHA 3MZEA 3PAGA 1GA9A 3BFGA 3PBSA 1CK3A 2EXBA 4IVIA 2I72A 3BYDA 1GA0A 3AGEA 4M3KA 3SH7A 5M1AA 5EVIA 3VP1A 1ES3A 1SDEA 2HDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HP5 A;  4OPR A;  1FCN A;  5E2E A;  5E2G A;  4ZJ2 A;  3WS1 A;  3N6I A;  2ZQA A;  4GKU A;  1LI0 A;  2EX9 A;  2HP6 A;  1RGZ A;  3Q7Z A;  1RGY A;  3VOY A;  4U3T A;  4OOM A;  3VOZ A;  4EWF A;  1WYB A;  4UA7 A;  3ZG8 B;  1YQS A;  3TG9 A;  5AQ7 A;  4D2O A;  1DY6 A;  3OPL A;  1K4F A;  1L2S A;  3MZF A;  1IYO A;  3PBO A;  4EQI A;  5A92 A;  1CEF A;  5CEC A;  4LEN A;  4WEL A;  1N9B A;  1PZP A;  5CHM A;  3VP3 A;  1BZA A;  3GRJ A;  4MBH A;  3LY3 A;  1HZO A;  2J7V A;  4P87 A;  3WRT A;  4CPK A;  2ZM2 A;  2PBY A;  5CRF A;  1BLH A;  1W8Y A;  2OLU A;  1L0D A;  3PBT A;  2WKI A;  5F82 A;  3ZHH A;  1ES4 A;  5HAQ A;  1FSY A;  2C5W B;  3CZD A;  3IF5 A;  3NIA A;  3W4Q A;  3BFC A;  4N92 A;  3SH9 A;  2BLS A;  1TDG A;  2XR0 A;  1E3U A;  3GQZ A;  3OC2 A;  4OP8 A;  3IH9 A;  3UDI A;  1IYS A;  4QY6 A;  1WE4 A;  3IT9 A;  3BLS A;  4MBF A;  1PI4 A;  1DJC A;  1ONG A;  3IQA A;  5TGF A;  1G6A A;  5FQ9 A;  3DTM A;  2VGJ A;  3IF6 C;  4OLD A;  3ZVT A;  4E6X A;  4RX3 A;  1ESI A;  1YLT A;  1M6K A;  5FAQ A;  3BEB A;  2QPN A;  3ZVW A;  3M6H A;  2Y2Q A;  5DVA A;  4OVD A;  1PI5 A;  4KG6 A;  1YMS A;  3A3J A;  3Q07 A;  4S2M A;  3ZNY A;  1I2S A;  2V2F F;  2ZC4 B;  4X68 A;  1LLB A;  2Y59 A;  3IXH A;  3N7W A;  5CTN A;  3Q7V A;  5FAT A;  1K55 A;  4JF5 A;  3IHB A;  3MKE A;  5CED A;  2Y2H A;  3RXX A;  4GOG A;  4EBN A;  4OLG A;  4DDY A;  1RP5 A;  2VGK A;  4XUX A;  3AGF A;  3UPP A;  2Y55 A;  3BM6 A;  4P6B A;  1KVL A;  2R9W A;  4OPZ A;  2QMI A;  4Z9Q A;  2HDS A;  4QJG A;  1ALQ A;  3NY4 A;  4GD8 A;  4LV1 A;  4EV4 A;  1BLS A;  4QU3 A;  4KZ7 A;  4X55 A;  2OV5 A;  1MWT A;  5F83 A;  1DJA A;  1QME A;  5HFO A;  3WS4 A;  3FZC A;  5CGW A;  1YLY A;  4XXR A;  3BLM A;  1ERO A;  4OH0 A;  5CER A;  1NYY A;  1H5X A;  1CI8 A;  2XK1 A;  1GHM A;  4YFM A;  3IHA A;  1PYY A;  2XDM A;  2EFU A;  2HDR A;  3SH8 A;  2ZD8 A;  1ERQ A;  4MNR A;  1MKI A;  5AQ9 A;  4KQQ A;  1GHP A;  5GHZ A;  4X56 A;  5GLC A;  5E2F A;  3DWZ A;  1KDS A;  4WBG A;  5FQI A;  1PW8 A;  3BFD A;  3GR2 A;  3HUM A;  3Q1F A;  4A5R A;  3HLF A;  4WMC D;  5DTS A;  1LL5 A;  3E2L A;  4P0M A;  3ZNT A;  2H0Y A;  2WGW B;  4Y7P A;  2XD1 A;  1E3U D;  2Y2N A;  4OP5 A;  2PU4 A;  2V20 A;  5FQQ A;  4RA7 A;  5AQA A;  1K6R A;  4S2N C;  2J9O A;  2XLN A;  2J9P A;  4JXG A;  3LEZ A;  3HUO A;  2Y2L A;  1ZKJ A;  3LY4 A;  4E6W A;  3N8S A;  3PBR A;  3OCL A;  4WZ5 A;  3W4O A;  2WAE A;  4BEN A;  1Z6F A;  3V39 A;  3N8L A;  5DF7 A;  5CEB A;  3WWX A;  5JYP A;  1FSW A;  1LHY A;  3TOI A;  2ZQD A;  3ZG7 B;  3MXS A;  1U60 A;  1XA7 A;  2ZC3 B;  4F94 A;  1G68 A;  1YLP A;  3EQU A;  1XX2 A;  4R23 A;  3SOI A;  2EX6 A;  1SCW A;  4WZ5 C;  3VFH A;  4KG5 A;  4OPQ A;  5FDH A;  2A3U A;  4QB8 A;  4R4R A;  5M19 A;  5HX9 A;  3DWK A;  4HBT A;  3Q7V B;  1M40 A;  3G4P A;  5A93 A;  3HVF A;  3A3F A;  4E3J A;  2ZQ9 A;  5FAS A;  1W79 A;  3PTE A;  3GTC A;  4WM9 A;  4GZB A;  1VQQ A;  1KVM A;  4OOY A;  2H10 A;  3M2J A;  1YT4 A;  4OQ0 A;  1NZO A;  1VM1 A;  2XD5 A;  4JKT A;  2Z2M B;  3SS4 A;  3HLC A;  4Y0O A;  3ZDJ A;  1YMX A;  1JWZ A;  1IEM A;  2IWD A;  4E3I A;  4P85 A;  2Y91 A;  3OPP A;  4JXV A;  3HL9 A;  1BUL A;  3W8K A;  3BFE A;  4KZ4 A;  5HL1 A;  5DF9 A;  4BD1 A;  4KEN B;  5FAP A;  1S6R A;  4BQM A;  3DW0 A;  3Q81 A;  4RVA A;  5BOH A;  5GL9 A;  3MKF A;  4S2P A;  1MWR A;  4HES A;  2ZC6 B;  1ZG4 A;  2ZQ7 A;  5D3O A;  4HBU A;  2WZZ A;  4WEK A;  2Y4A A;  2P9V B;  2WK0 A;  2WGW A;  2Z2L B;  1PWG A;  4N9L A;  1L0F A;  1YLZ A;  3IXG A;  5HAR A;  2ZC7 A;  1O07 A;  1XGJ A;  3CMZ A;  1LI9 A;  4K0X A;  4L0L A;  4CJN A;  4OPY A;  4FH2 A;  4E3M A;  1EWZ A;  1W5D A;  4DE2 A;  4UHU A;  3FV7 A;  3PAE A;  2RL3 A;  4GDN A;  4R1G A;  3UDF A;  1JWP A;  4JF4 A;  1ES5 A;  2WUQ A;  3GMW A;  5FAO A;  2WKH A;  2V1Z A;  5A90 A;  3IXD A;  2XFS A;  3UPO A;  1SDN A;  3GSG A;  4WEJ A;  1K56 D;  1N4O A;  3D4F A;  3HLD A;  3ITB A;  4S2O A;  4EBP A;  5FA7 A;  4IBX A;  1NZU A;  1K25 A;  1NJ4 A;  3NDG A;  1MWS A;  2Y2G A;  4PM8 A;  4QHC A;  3VMA A;  4E3L A;  1MBL A;  1NXY A;  3A3I A;  1ZG6 A;  2Y2I A;  2X71 A;  4EBL A;  4JPM A;  4KG2 A;  3IXB A;  5EE8 A;  2FFY A;  2WKE A;  2J8Y A;  2WAD A;  1PWD A;  3G31 A;  1QMF A;  3G2Y A;  1FR1 A;  1JWV A;  5EVL A;  4OQG A;  3JYI A;  3I7J A;  2ZC5 B;  1WYC A;  4R0Q A;  4DDS A;  3NC8 A;  4WZ4 A;  5FSR A;  3V3S A;  1KGF A;  2G2U A;  3HRE A;  4LCL A;  5HW3 A;  3PBN A;  1GCE A;  2JC7 A;  1ES2 A;  2XH9 A;  5JYO A;  1Q2P A;  3WS0 A;  1MPL A;  4NET A;  5EUA A;  4QY5 A;  1MXO A;  2HPB A;  4LCM A;  4IVK A;  1XA1 A;  2G2W A;  3WRZ A;  4HEF A;  1GHI A;  2DCF A;  4S2L A;  4JXW A;  5U47 A;  4K91 A;  2ZJ9 A;  4UAA A;  1PZO A;  4N1H A;  5EVI B;  4ZDX A;  2DRW A;  4DKI A;  2ZM0 A;  3S4X A;  1Y54 A;  2ZMA A;  1BLP A;  3OZH A;  3VP2 A;  3N8R A;  4S2K A;  1MWU A;  3RJU A;  2Q9M A;  5TFQ A;  4KZA A;  4N9K A;  3WS5 A;  1TEM A;  4X6T A;  5EOO A;  3MBZ A;  4Y0U A;  4OOL A;  1TVF A;  4BD0 A;  3IF6 B;  2JCH A;  4NK3 A;  4E3K A;  2EXA A;  2WGV A;  4R3B A;  3VSL A;  3G30 A;  5EVI C;  1XGI A;  3EQV A;  4KZB A;  1LL9 A;  5KSC A;  4ZJ1 A;  3MXR A;  5HAP A;  3HBR A;  3VP4 A;  3V50 A;  4JBF A;  3IWQ A;  3C5A A;  1OME A;  1XKZ A;  4C3Q A;  3UY6 A;  1ONH A;  2HP9 A;  5E43 A;  4KZ3 A;  5GLD A;  1JTG A;  2XQZ A;  1BSG A;  4B4X A;  3A3E A;  1S0W A;  4PM9 A;  3UN7 A;  3HLB A;  3QNC A;  2A49 A;  4R3J A;  1K56 A;  2XEP A;  4DXC A;  4QD4 A;  4B88 A;  2ZM8 A;  4MLL A;  1KGG A;  1NY0 A;  2WYX A;  4E3N A;  3IWO A;  4PM5 A;  3OCN A;  4DE1 A;  1KGE A;  4K0W A;  1JVJ A;  3BEC A;  3NCK A;  4ZJ3 A;  1JTD A;  2ZQ8 A;  4LV3 A;  2WAF A;  3V5M A;  1ERM A;  5IHV A;  1HVB A;  2BG1 A;  5J8X A;  4PPR A;  4DRT A;  3HUN A;  3M2K A;  3LO7 A;  5FQK A;  3UE3 A;  4Y0T A;  2JE5 A;  4WYY A;  1O7E A;  4PMA A;  2EFX A;  4DF6 A;  5EOE A;  1SKF A;  3ISG A;  4YIN A;  5FI2 A;  2HDU A;  3HLW A;  3ZCZ A;  4MEZ A;  1E4D A;  1K6S A;  3UDX A;  1MY8 A;  1K54 C;  4FH4 A;  2X02 A;  4PM7 A;  2WGI A;  3V3R A;  1C3B A;  4U0X A;  4GNU A;  3UO9 A;  3VFF A;  1IYP A;  3FKV A;  2R9X A;  4JF6 A;  3G34 A;  3VP0 A;  5KSH A;  1PIO A;  4ZTK A;  3SS3 A;  5CHU A;  3ZFZ A;  2EX2 A;  5E2H A;  2Y2J A;  3S1Y A;  1YLJ A;  2WZX A;  4FSF A;  3GV9 A;  1TDL A;  3OPR A;  3O3V A;  4OQI A;  3ZGA B;  4DE3 A;  3IF6 A;  4LV0 A;  4PM6 A;  4UA9 A;  3O88 A;  5G18 A;  2H5S A;  3M6B A;  4OON A;  1FCM A;  5FI7 A;  2Y2K A;  5GLB A;  2H0T A;  1BLC A;  5DF8 A;  3UNW A;  2C6W B;  1H8Y A;  4KZ8 A;  4Q8I A;  5FQM A;  2Y2P A;  1AXB A;  2IWC A;  4X69 A;  3QNB A;  4KQR A;  1W8Q A;  3N4I A;  2XGN A;  4RYE A;  2XFT A;  4H8R A;  4IBR A;  4S2I A;  4XUZ A;  3WS2 A;  3ZG5 A;  3FKW A;  2ZLY A;  4GDB A;  1IKI A;  5CXW A;  1K57 A;  4LV2 A;  2Y2O A;  4S2N A;  2XF3 A;  1KE3 A;  3HLE A;  3NI9 A;  4WMC A;  2CC1 A;  1IEL A;  2PU2 A;  4GB7 A;  3G32 A;  3IWI A;  3UPN A;  4C6Y A;  4FCF A;  3HLG A;  5CGX A;  2OLV A;  1IYQ A;  5F1F A;  1K57 C;  1FR6 A;  2JBF A;  1KE4 A;  4ZBE A;  1I5Q A;  1XP4 A;  4JXS A;  4OKP A;  5CTM A;  4S2J A;  3BRM A;  1HTZ A;  3P98 A;  3PBQ A;  3S22 A;  4IED A;  3CJM A;  4BLM A;  4U0T A;  5EEC A;  3B3X A;  3O87 A;  3MFD A;  2E8I A;  3ITA A;  4UA6 A;  2Q9N A;  3LCE A;  1I2W A;  4R4S A;  2DNS A;  2RCX A;  4EUZ A;  3FWL A;  5GLA A;  5AQB A;  3RXW A;  3UE1 A;  4MBK A;  2Y2M A;  4KZ6 A;  5A91 A;  2ZQC A;  1L0G A;  4OQH A;  5FQJ A;  1PW1 A;  5TR7 A;  1NYM A;  4DE0 A;  2P9V A;  1HD8 A;  5DTK A;  5KMW A;  1K55 C;  2B5R A;  1YLW A;  3O86 A;  3C7V A;  3ZG0 A;  5CGS A;  3TSG A;  1E25 A;  1NRF A;  3C4P A;  4KZ9 A;  5GHY A;  4C75 A;  3SS5 A;  1CEG A;  5KZH A;  2FFF B;  5F1G A;  4BJP A;  1EI5 A;  1H8Z A;  2P74 A;  3CG5 A;  3QHY A;  4GN2 A;  5GHX A;  3VSK A;  1W7F A;  3BFF A;  1SHV A;  3A3D A;  1BTL A;  5M18 A;  5EVI D;  1K54 A;  1PWC A;  2X01 A;  4N1X A;  1J9M A;  1XPB A;  3NDE A;  3IH8 A;  4ZAM A;  3W4P A;  2OSU A;  1IKG A;  4DXB A;  4GD6 A;  1ZC2 A;  5L2F A;  1FOF A;  2UWX A;  4RX2 A;  5HAI A;  2QZ6 A;  1FQG A;  2IWB A;  1KE0 A;  1K4E A;  1YM1 A;  1XXM A;  3ZG9 B;  4BL3 A;  1Q2Q A;  1DJB A;  3C4O A;  3NBL A;  1L0E A;  3C7U A;  4FD8 A;  1K38 A;  4BL2 A;  4ID4 A;  4KQO A;  1CI9 A;  4E3O A;  4O7D A;  5I94 A;  1KDW A;  4JLF A;  1ESU A;  5DTT A;  3E2K A;  4KZ5 A;  5FI6 A;  3OPH A;  1BUE A;  3Q82 A;  3MZD A;  5CHJ A;  3AGD A;  2EX8 A;  3UE0 A;  1FCO A;  4X53 A;  1RCJ A;  3G2Z A;  2GDN A;  3P09 A;  3GVB A;  3FYZ A;  3G35 A;  4B4Z A;  1BT5 A;  5EPH A;  3MZE A;  3PAG A;  1GA9 A;  3BFG A;  3PBS A;  1CK3 A;  2EXB A;  4IVI A;  2I72 A;  3BYD A;  1GA0 A;  3AGE A;  4M3K A;  3SH7 A;  5M1A A;  5EVI A;  3VP1 A;  1ES3 A;  1SDE A;  2HDQ A; 
#chains in the Genus database with same CATH topology
 3R7W A;  5E2E A;  3WS1 A;  2ZQA A;  2EX9 A;  4OOM A;  4MN6 A;  1J3W A;  3TG9 A;  1K4F A;  4EQI A;  4LEN A;  1N9B A;  1T19 A;  3PHY A;  4CPK A;  2ZM2 A;  2PBY A;  4HOI A;  4GCZ A;  2WKI A;  5DFX A;  5HAQ A;  3CZD A;  3IF5 A;  3W4Q A;  3BFC A;  2BLS A;  3GQZ A;  3OC2 A;  3UDI A;  4M4X A;  4EER A;  1IYS A;  4MBF A;  1PI4 A;  2L1M A;  3IF6 C;  5FAQ A;  3ZVW A;  2P7J A;  2Y2Q A;  3ZNY A;  4S2M A;  5IU1 A;  2V2F F;  2XA7 M;  3IXH A;  5CTN A;  2XA7 S;  4JF5 A;  3K2N A;  4OLG A;  3H7W B;  1G5U A;  2Q0O A;  1ZHH B;  4P6B A;  1DRM A;  2K31 A;  2R9W A;  3PXP A;  2Y79 A;  1ALQ A;  3NY4 A;  4GD8 A;  4EV4 A;  4KZ7 A;  2OV5 A;  1EW0 A;  1MWT A;  3F1N B;  5F83 A;  1QME A;  3FZC A;  5CGW A;  1YLY A;  4XXR A;  5TBM B;  3BLM A;  1CI8 A;  1H5X A;  3V67 A;  2XDM A;  3D72 A;  1ERQ A;  4NXE A;  1Y28 A;  1OTA A;  2JKR M;  5E2F A;  2VA0 A;  3Q1F A;  5DTS A;  2J80 A;  2WGW B;  4Y7P A;  5MC7 A;  1XJ3 A;  1VEU A;  2J9P A;  3LEZ A;  3HUO A;  1S4S A;  2Y2L A;  3DTK A;  3KYQ A;  1TS0 A;  3W4O A;  5CEB A;  5DF7 A;  3TOI A;  1U60 A;  4F94 A;  1YLP A;  3ZYT A;  1XX2 A;  4JGO A;  4R23 A;  2PDR A;  4R4R A;  5HX9 A;  3DWK A;  4HBT A;  1OT9 A;  3MR0 A;  5FAS A;  1W79 A;  3PTE A;  3GTC A;  4OOY A;  1KVM A;  3CUE A;  2W27 A;  2Y91 A;  4JXV A;  1BUL A;  3CAX A;  4HQA A;  4KZ4 A;  4BD1 A;  2L4R A;  4AFI A;  2JKR I;  4HES A;  5EM1 A;  2ZC6 B;  4HP9 A;  3H82 A;  4HY8 A;  1L0F A;  1O07 A;  4L0L A;  4CJN A;  1LI9 A;  4E3M A;  1EWZ A;  1W5D A;  4UHU A;  3FV7 A;  2RL3 A;  2WUQ A;  1L3L A;  2WKH A;  2V1Z A;  2VV7 A;  2HGV A;  1YSP A;  1SDN A;  4WEJ A;  5EV0 A;  3D4F A;  4LLO B;  2B18 A;  4IBX A;  1NZU A;  2EA9 A;  1MWS A;  4PM8 A;  3VMA A;  1ZG6 A;  2Y2I A;  2X71 A;  3TE8 A;  1YSQ A;  4KG2 A;  3IXB A;  1PWD A;  1TS6 A;  3G2Y A;  4PKY G;  1FR1 A;  3F1O A;  4R0Q A;  4HH2 A;  3V3S A;  4EEP A;  1KGF A;  1F2K A;  1LL8 A;  3PBN A;  4R70 A;  4NET A;  5EUA A;  4Y15 A;  4P6Z M;  4QY5 A;  1MXO A;  3P01 A;  2G2W A;  3E0Y A;  1GHI A;  2K2N A;  4YNR A;  2A2L A;  2DRW A;  2ZM0 A;  4Y5F A;  4S2K A;  5TFQ A;  4KZA A;  4X6T A;  5EOO A;  3RH8 B;  3MBZ A;  5HWV A;  4Y0U A;  2BAS A;  2OOL A;  3T4O A;  1TVF A;  4E3K A;  2WGV A;  2M7U A;  4KZB A;  1LL9 A;  5HAP A;  4Y17 A;  3L9K A;  1ONH A;  3U4L P;  5GLD A;  3ULF A;  3A3E A;  1S0W A;  5F68 A;  2HF6 A;  1XJ2 A;  4QD4 A;  1P9W A;  4HI4 A;  4E3N A;  2WYX A;  2YKF A;  5A8B A;  1JVJ A;  3NCK A;  5TBM A;  3MS6 A;  2WKR A;  3LO7 A;  3HJK A;  4WYY A;  4PMA A;  2EFX A;  3T12 B;  3MMH A;  4BBT A;  3ISG A;  2PR6 A;  2V1A A;  5FI2 A;  3UDX A;  3V3R A;  3UO9 A;  1IYP A;  2OWJ A;  3FKV A;  5DJT A;  3G34 A;  2Y2J A;  3S1Y A;  1YLJ A;  3OPR A;  4IJG A;  4PM6 A;  2H5S A;  1FCM A;  2VGL M;  2Y2K A;  3MQQ A;  5IT5 A;  1BLC A;  5DF8 A;  1K0K A;  3D3O A;  1H8Y A;  1NLZ A;  1PNE A;  2Y2P A;  5FQM A;  1AXB A;  4X69 A;  4KQR A;  4RYE A;  2XFT A;  3K3D A;  1IKI A;  5CXW A;  1K57 A;  2Y2O A;  3NI9 A;  4WMC A;  4GB7 A;  3G32 A;  3UPN A;  5HDS A;  4ZRR A;  5F1F A;  1IYQ A;  1K57 C;  5CTM A;  1OTE A;  2GNX A;  3CJM A;  3MFD A;  3ITA A;  3O5Y A;  1LT0 A;  4P6Z S;  5GLA A;  3RXW A;  4MBK A;  5A91 A;  2ZQC A;  2HZ5 A;  1L0G A;  5FQJ A;  1NYM A;  5KMW A;  5GHY A;  3C4P A;  2PRF A;  1CEG A;  3IS2 B;  4IHQ A;  2FFF B;  4KUK A;  3QHY A;  3CUE C;  3A3D A;  2X01 A;  1PWC A;  1XPB A;  3BJN A;  3IH8 A;  2PT7 A;  3F1O B;  4RX2 A;  4BL3 A;  4UQI M;  1Q2Q A;  2M1C A;  1KDW A;  3LGO A;  4KZ5 A;  5C5K A;  5FI6 A;  1BUE A;  4CLC A;  3LR3 A;  1F5M A;  1RCJ A;  3G2Z A;  3GVB A;  5CX7 A;  4B4Z A;  4WL9 A;  1GA9 A;  2EXB A;  2I72 A;  1GA0 A;  3AGE A;  3BY8 A;  3SH7 A;  2VKS A;  3HJI A;  4BMW A;  2ZL1 A;  3N6I A;  4XT2 B;  1LI0 A;  1RGZ A;  3VOY A;  4ETX A;  1DY6 A;  1NLY A;  3MZF A;  4CQH A;  4WEL A;  3DBA A;  1ODV A;  2JKF A;  1BZA A;  1DP8 A;  3LUQ A;  2O99 A;  2M7V A;  5CRF A;  4EUV A;  2OLU A;  3S7N A;  5F82 A;  3ZHH A;  3LR4 A;  4N92 A;  3SH9 A;  1TDG A;  3E4P A;  4OP8 A;  1WE4 A;  3IT9 A;  3BLS A;  1G6A A;  1LSV A;  3DTM A;  4L9F A;  3VOL A;  3EWK A;  1PI5 A;  4WUJ A;  3Q07 A;  2ZC4 B;  2VJW A;  3CPT A;  1LLB A;  1K55 A;  3MKE A;  4Y3I A;  2Y2H A;  3DAV A;  4IUH A;  1RP5 A;  2W3E A;  1CF0 A;  3A0V A;  4CLC E;  1D1J A;  2VGK A;  4XUX A;  3AGF A;  3BM6 A;  4OPZ A;  4QJG A;  4QU3 A;  1DJA A;  1ERO A;  4GJ4 A;  5CER A;  4CLC C;  2JKG A;  1F9I A;  4HNB A;  2HDR A;  2EWV A;  4MNR A;  4RQ9 A;  1VET B;  1GHP A;  4X56 A;  1KDS A;  4LGW A;  4WMC D;  2H28 A;  1OJG A;  4P0M A;  3ZNT A;  2H0Y A;  3LIE A;  4OP5 A;  5FQQ A;  4RA7 A;  1NWZ A;  4S2N C;  2J9O A;  2XLN A;  2KDK A;  3LY4 A;  1YAX A;  3N8S A;  3OCL A;  3IS2 A;  3N8L A;  1LHY A;  2KOI A;  2ZQD A;  3ZG7 B;  3T4L A;  3EQU A;  2EX6 A;  1SCW A;  3VFH A;  4OPQ A;  3H7W A;  4LRZ E;  5M19 A;  3Q7V B;  2HJE A;  4NXG A;  5A93 A;  2NUT C;  1YT4 A;  4OQ0 A;  4GW9 A;  1VM1 A;  2XSS A;  2Z2M B;  3HLC A;  3ZDJ A;  4E3I A;  3QP5 A;  3LR0 A;  5FAP A;  5BOH A;  5GL9 A;  4S2P A;  1OJ5 A;  1H8M A;  4D60 A;  1ZG4 A;  4HBU A;  5DFY A;  4I39 A;  2W3G A;  2Y4A A;  2QHK A;  2WK0 A;  5LBR A;  5HAR A;  2ZC7 A;  1XGJ A;  4K0X A;  4FH2 A;  4NXB A;  3PAE A;  1JWP A;  4NXF A;  3R7W B;  5DJU A;  1ES5 A;  3GMW A;  2AVX A;  5FAO A;  4NEE D;  2E8J A;  4B93 A;  1K56 D;  1SZV A;  3HLD A;  3ITB A;  4S2O A;  1N9L A;  5HDC A;  1NJ4 A;  4L9E A;  3A3I A;  2V0U A;  5EE8 A;  2FFY A;  2J8Y A;  3G31 A;  1QMF A;  5EVL A;  3I7J A;  4WZ4 A;  2GX5 A;  4LCL A;  4BBU A;  4DMZ A;  2XH9 A;  5DKK A;  3VE3 A;  3WS0 A;  1A0K A;  1MPL A;  3OLO A;  3EGX C;  3JVU A;  4LCM A;  4PAU A;  3F1P A;  4HEF A;  5J3W A;  4CLC B;  5U47 A;  1PZO A;  3LID A;  1Y4O A;  3S4X A;  2VX8 A;  2ZMA A;  2XRN A;  1BLP A;  3OZH A;  5G4Y A;  2QJ7 A;  3RJU A;  5FDS A;  2Q9M A;  1CJF A;  4FUW A;  4L9G A;  4Y13 A;  4GHI B;  1D06 A;  3G30 A;  1D7E A;  4G3W A;  4BWI A;  2ZOI A;  2DMW A;  4ME4 A;  3C5A A;  1OME A;  1XKZ A;  1X0O A;  2HP9 A;  1V9Z A;  2O9B A;  4KZ3 A;  1BSG A;  5DKL A;  2GJ3 A;  1JNU A;  2P04 A;  2A49 A;  1K56 A;  2XEP A;  4DXC A;  5FEF A;  1PFL A;  2ZM8 A;  4MLL A;  4PM5 A;  1AWI A;  2LB5 A;  2V1B A;  3V5M A;  5IHV A;  3FC7 A;  4PPR A;  2Y8H A;  3HUN A;  3UE3 A;  4Y0T A;  4QPR A;  1GSW A;  4I3J A;  1SKF A;  5L09 A;  2V8F A;  3L7H A;  2X02 A;  1T1C A;  2WGI A;  2FZ0 A;  1OTD A;  1P97 A;  3KYE A;  3VP0 A;  3P7N A;  3ZFZ A;  2EX2 A;  2ZBB A;  5E2H A;  2WZX A;  5K5B A;  3LFV A;  4DE3 A;  4OQI A;  2BTF P;  5GLB A;  2H0T A;  3KYZ A;  4Q8I A;  3C30 A;  2V8C A;  1S67 L;  3N4I A;  4XUZ A;  4IBR A;  4S2I A;  3WS2 A;  4LV2 A;  4FTX A;  3CLO A;  3CHW P;  2ZL1 B;  3LIF A;  1F98 A;  3IWI A;  3T1S A;  4EU0 A;  1KE4 A;  3QP1 A;  4S2J A;  4X1L A;  5EEC A;  4UQI S;  3EEA A;  3LIB A;  3BW6 A;  3LCE A;  1I2W A;  2RCX A;  1XFQ A;  4DN0 A;  1PW1 A;  3C38 A;  4HH3 A;  2P08 A;  5J7E A;  4DE0 A;  2P9V A;  4GHI A;  2B5R A;  3O86 A;  3TSG A;  1E25 A;  1NRF A;  2B02 A;  1XJ6 A;  4C75 A;  1S1Y A;  4EEU A;  1T1A A;  5FL3 A;  1UGU A;  4GN2 A;  5GHX A;  3CIT A;  3VSK A;  2PD7 A;  3LI8 A;  3IX4 A;  1S4R A;  2I9V A;  4N1X A;  1J9M A;  4Y2F A;  1MKM A;  4ZAM A;  2OSU A;  3KO6 A;  4GD6 A;  3E98 A;  1FQG A;  5HD5 A;  1YM1 A;  3ZG9 B;  1XXM A;  3IX3 A;  3C7U A;  4G3V A;  4KQO A;  3NOU C;  1ESU A;  4DJ2 A;  4R3A A;  3MZD A;  3ICY A;  3AGD A;  5CHJ A;  3P09 A;  3G35 A;  1BT5 A;  3DTE A;  3PBS A;  1CK3 A;  1W63 M;  3BY9 A;  3NHQ A;  4M3K A;  5EVI A;  5E2G A;  4ZJ2 A;  4GKU A;  3S7Q A;  3Q7Z A;  1RGY A;  4KQD A;  3T4J A;  3VOZ A;  4EWF A;  1WYB A;  4G3K A;  1OTI A;  4D2O A;  3OPL A;  1IYO A;  1YPR A;  3PBO A;  5A92 A;  1CEF A;  5CEC A;  4O8G A;  3LYX A;  5HWW A;  1PZP A;  5CHM A;  3GRJ A;  1SKO B;  3LY3 A;  1HZO A;  4P87 A;  3W2Z A;  1BLH A;  1W8Y A;  1P0Z A;  1L0D A;  3PBT A;  2C5W B;  2A24 A;  2W0N A;  1VHM A;  3D9Y A;  2XR0 A;  3MXQ A;  4QY6 A;  5TGF A;  1ONG A;  4HP4 A;  4OLD A;  2VGJ A;  4E6X A;  4RX3 A;  2QPN A;  3M6H A;  2R78 A;  5DVA A;  4OVD A;  1YMS A;  3C8C A;  4JGR A;  4X68 A;  2Y59 A;  3Q7V A;  5FAT A;  5CED A;  3IHB A;  5IS1 A;  4ARZ B;  2Y55 A;  4B9O A;  3FPW A;  2QMI A;  4Z9Q A;  2VZW A;  4LV1 A;  4X55 A;  3WS4 A;  5HFO A;  5HPI A;  1PYY A;  5EVE A;  3SH8 A;  5AQ9 A;  4EXO A;  2ACG A;  5GHZ A;  5GLC A;  3UB7 A;  5FQI A;  2QWS A;  3GR2 A;  4A5R A;  1LL5 A;  3E2L A;  4Q0H A;  1WA9 A;  2XD1 A;  2YKH A;  2Y2N A;  2QYB A;  2V20 A;  5AQA A;  1K6R A;  4JXG A;  1G6O A;  3RFB A;  1ZKJ A;  3PBR A;  2WAE A;  4NG2 A;  2O9C A;  1FSW A;  1XA7 A;  4I5S A;  5HD3 A;  3TJZ C;  4ETZ A;  3SW1 A;  3PYP A;  2ZMV A;  2A3U A;  2ZMF A;  4QB8 A;  2J3T C;  2ZQ9 A;  1VQQ A;  2H10 A;  1NZO A;  4JKT A;  3SS4 A;  4Y0O A;  1JWZ A;  1IEM A;  3OPP A;  3W8K A;  3BFE A;  4HJ3 A;  5HL1 A;  5DF9 A;  3KSF A;  3DW0 A;  3Q81 A;  3MKF A;  4I3I A;  1MWR A;  3B33 A;  4H6J A;  5AVE A;  2PAV P;  1P9R A;  5D3O A;  2V9A A;  2WGW A;  3BQA A;  4N9L A;  1YLZ A;  4YOF A;  3CMZ A;  2XRO A;  2KX6 A;  4GDN A;  3UDF A;  1DP9 A;  4LFU A;  5A90 A;  2XFS A;  3UB8 A;  3GSG A;  3UPO A;  1N4O A;  5FA7 A;  3ZQ5 A;  1TS8 A;  2Y2G A;  1MBL A;  1NXY A;  4R6L A;  3T4T A;  2MJ6 A;  5TJJ A;  2WAD A;  1JWV A;  2D01 A;  3JYI A;  1WYC A;  4DDS A;  3NC8 A;  5FSR A;  2G2U A;  4MN7 A;  5HW3 A;  4LRY C;  1ES2 A;  2QJ5 A;  3NEC A;  3KSI A;  1H3Q A;  4IVK A;  1XA1 A;  1PRQ A;  2DCF A;  4JXW A;  3T4S A;  4K91 A;  4UAA A;  4N1H A;  4DKI A;  4LPZ A;  3VP2 A;  2A24 B;  3UB9 A;  5F6A A;  3WS5 A;  1TEM A;  1S1Z A;  2O0Y A;  4OOL A;  4BD0 A;  3IF6 B;  4F3L A;  3VSL A;  5EVI C;  1OTB A;  3GEC A;  1DP6 A;  3MXR A;  3UMD A;  5HL6 A;  4JBF A;  3UY6 A;  3RTY A;  4QWO A;  3UN7 A;  3LR5 A;  3QNC A;  4PKY A;  3C2W A;  3T50 A;  1XJ4 A;  4R3J A;  4NKP A;  4B88 A;  1KGG A;  2W3F A;  4K0W A;  3BEC A;  3VV4 A;  3MQ0 A;  1JTD A;  4LV3 A;  2WAF A;  2JKT M;  3NJA A;  2W1R A;  3EGD C;  2BG1 A;  5J8X A;  3M2K A;  3UB6 A;  3LEQ A;  4HIA A;  2JE5 A;  3R4K A;  4DF6 A;  1N9O A;  4YIN A;  2HDU A;  3HLW A;  1K6S A;  3HCY A;  4FH4 A;  1K54 C;  4PM7 A;  1C3B A;  4GNU A;  3VFF A;  3IX8 A;  2R9X A;  4JF6 A;  2W1T A;  4ZTK A;  3SS3 A;  5CHU A;  1H0M A;  1VB6 A;  4FSF A;  3GV9 A;  5AJG A;  5L8M A;  3ZGA B;  3IF6 A;  4LV0 A;  5G4Z A;  3O88 A;  3M6B A;  1VET A;  4OON A;  3KSG A;  2JN7 A;  3UNW A;  2C6W B;  2IWC A;  1CQA A;  1W8Q A;  4H8R A;  3IBR A;  3NOP C;  4WLA A;  3E4Q A;  1HLU P;  1KE3 A;  3OBF A;  3HLE A;  2HV1 A;  2CC1 A;  2PU2 A;  2W1T B;  2OAQ 1;  3HLG A;  1I5Q A;  4JXS A;  4OKP A;  3BRM A;  1HTZ A;  3PBQ A;  4IED A;  5FEG A;  4BLM A;  4U0T A;  4H6J B;  2E8I A;  4UA6 A;  2Q9N A;  4R4S A;  3MSH A;  3FWL A;  4O0P A;  4KZ6 A;  1G28 A;  4X1M A;  5F5Y A;  1N9N A;  4ESP A;  1HD8 A;  5DTK A;  1K55 C;  3NOT C;  1YLW A;  5CGS A;  4KZ9 A;  5EFW A;  3SS5 A;  1EI5 A;  1H8Z A;  2P74 A;  3T1X A;  5KIZ A;  3BFF A;  3JVV A;  3QP4 A;  5M18 A;  5EVI D;  1K54 A;  3NDE A;  1IKG A;  2WKQ A;  1ZC2 A;  2UWX A;  4Q0J A;  3KSH A;  2Z6D A;  3C4O A;  1DJB A;  3KX0 X;  3NBL A;  4FD8 A;  4ID4 A;  1CI9 A;  4E3O A;  2B95 A;  4O7D A;  2PD8 A;  4JLF A;  2VGL S;  1FIK A;  5DTT A;  2VEA A;  4O01 A;  3OPH A;  2EX8 A;  1FCO A;  4X53 A;  5L10 A;  2GDN A;  5EPH A;  3MZE A;  3PAG A;  3BFG A;  4IVI A;  3BYD A;  5HPF A;  5M1A A;  3VP1 A;  1ES3 A;  4FOF A;  1SDE A;  1ZTU A;  2HP5 A;  1T18 A;  1FCN A;  4OPR A;  2QKP A;  4F3L B;  2HP6 A;  4U3T A;  3EOI A;  1LSX A;  2VV8 A;  3F1P B;  4UA7 A;  3ZG8 B;  1YQS A;  5AQ7 A;  1L2S A;  4HHD A;  4EQ1 A;  3VP3 A;  4MBH A;  4IUK A;  2J7V A;  3WRT A;  3LI9 A;  3GDI A;  1ES4 A;  1FSY A;  3NIA A;  3T1R A;  3G6O A;  1E3U A;  3IH9 A;  4Q0I A;  2W3D A;  4YWZ A;  1VEU B;  1DJC A;  3IQA A;  5FQ9 A;  1TD5 A;  3A0S A;  3ZVT A;  1ESI A;  1YLT A;  1M6K A;  3S7O A;  3BEB A;  4KG6 A;  3A3J A;  2OWH A;  1I2S A;  2VV6 A;  3N7W A;  1MC0 A;  3QP2 A;  3RXX A;  1T1B A;  4GOG A;  4EBN A;  4DDY A;  2O9A A;  3K3C A;  3UPP A;  4E04 A;  1KVL A;  4K08 A;  1GSX A;  2HDS A;  5HDD A;  1STZ A;  1BLS A;  2J3T D;  1IOU A;  2W3H A;  4I38 A;  4GS9 A;  4OH0 A;  1NYY A;  2XK1 A;  1GHM A;  3MQO A;  4YFM A;  3IHA A;  2EFU A;  2ZD8 A;  4MCW A;  1MKI A;  1UWP X;  4KQQ A;  2WKP A;  3DWZ A;  2PYP A;  4WBG A;  1PW8 A;  3BFD A;  3HUM A;  3HLF A;  3UE6 A;  1E3U D;  2PU4 A;  3BWL A;  4X25 A;  1UWN X;  4WF0 A;  3VE4 A;  2PBD P;  4E6W A;  4WZ5 A;  4BEN A;  1ACF A;  1Z6F A;  4UEY A;  3V39 A;  3WWX A;  5JYP A;  3CPT B;  3MXS A;  2GZA A;  2ZC3 B;  4EES A;  1G68 A;  3SOI A;  4WZ5 C;  2KLI A;  1LSW A;  4KG5 A;  5FDH A;  2INW A;  1M40 A;  5EM0 A;  3G4P A;  3HVF A;  3A3F A;  4E3J A;  4LRX C;  4WM9 A;  4GZB A;  3M2J A;  2XD5 A;  4KUO A;  3PR6 A;  1YMX A;  2IWD A;  4P85 A;  3HL9 A;  2D02 A;  3DTI A;  4KEN B;  1S6R A;  4BQM A;  4RVA A;  4GS9 B;  1GSV A;  2ZQ7 A;  2WZZ A;  4WEK A;  3MF0 A;  2P9V B;  3UME A;  3QP6 A;  2Z2L B;  1PWG A;  2FH5 A;  4EW7 A;  3IXG A;  4MDZ A;  4OPY A;  4DE2 A;  2IA2 A;  4R1G A;  5L07 A;  4JF4 A;  3TW8 A;  3CI6 A;  3IXD A;  1OPX A;  4EBP A;  3NDG A;  1K25 A;  3QP8 A;  2G7U A;  5HZH A;  4QHC A;  4E3L A;  4EBL A;  4JPM A;  2WKE A;  3FG8 A;  4OQG A;  2ZC5 B;  3HRE A;  1GCE A;  4MN5 A;  2JC7 A;  1W63 Q;  5JYO A;  1Q2P A;  2HPB A;  1XFN A;  5AVF A;  3WRZ A;  3SZT A;  4S2L A;  2ZJ9 A;  4I3A A;  5EVI B;  4ZDX A;  3EEH A;  3LIC A;  1Y54 A;  3N8R A;  1MWU A;  4N9K A;  3H82 B;  5J4E A;  2LB9 A;  2PHY A;  1TF1 A;  2J3W A;  3TRC A;  2JCH A;  4NK3 A;  2EXA A;  4R3B A;  2V0W A;  1XGI A;  3EQV A;  5KSC A;  3U2A A;  4ZJ1 A;  3HBR A;  3VP4 A;  3T1Q B;  3V50 A;  1SKO A;  3IWQ A;  4JGQ A;  4C3Q A;  2VLG A;  3B42 A;  5E43 A;  1JTG A;  2XQZ A;  4B4X A;  4PM9 A;  4MMN A;  3HLB A;  4CLC D;  1BYW A;  4HJ6 A;  4Z1W A;  2ZOH A;  1NY0 A;  3T4K A;  2PR5 A;  3IWO A;  3OCN A;  4ARZ A;  4DE1 A;  1KGE A;  4ZJ3 A;  4PHT A;  2ZQ8 A;  1V9Y A;  2HJ9 C;  1ERM A;  1HVB A;  2JHE A;  4DRT A;  5FQK A;  5F69 A;  1O7E A;  5HSQ A;  5EOE A;  2CMN A;  3ZCZ A;  3MJQ A;  4MEZ A;  1E4D A;  1MY8 A;  4U0X A;  2OAP 1;  5KSH A;  1PIO A;  1Z09 A;  2VK3 A;  1S66 L;  4II7 A;  1TDL A;  3O3V A;  2K7S A;  4UA9 A;  1OT6 A;  5G18 A;  3E4O A;  5FI7 A;  1YKD A;  4KZ8 A;  3NUL A;  3QNB A;  3UB5 P;  2XGN A;  3ZG5 A;  3FKW A;  2ZLY A;  4GDB A;  4S2N A;  2XF3 A;  1NRJ A;  3T4Q A;  2UV0 E;  3H9W A;  1IEL A;  1IFQ A;  4C6Y A;  4FCF A;  5CGX A;  2OLV A;  2JBF A;  1FR6 A;  3B47 A;  4ZBE A;  1XP4 A;  3S22 A;  3P98 A;  3A0R A;  3BQ8 A;  3B3X A;  3LIA A;  3O87 A;  3FPV A;  3OOV A;  1MZU A;  1TS7 A;  2DNS A;  4EUZ A;  5AQB A;  3UE1 A;  2Y2M A;  4EET B;  2EWW A;  4BBV A;  3JPU A;  4OQH A;  4HJ4 A;  5TR7 A;  2Z6C A;  5HWT A;  5I5L A;  3C7V A;  3ZG0 A;  4XT2 A;  3MFX A;  5KZH A;  5F1G A;  4BJP A;  4R38 A;  2PYR A;  3CG5 A;  2NUP C;  4WN5 A;  1W7F A;  1KOU A;  1SHV A;  4GLQ A;  1BTL A;  3W4P A;  4DXB A;  5L2F A;  1FOF A;  1FIL A;  5HAI A;  2QZ6 A;  2IWB A;  1KE0 A;  1K4E A;  3IBJ A;  1L0E A;  1K38 A;  4BL2 A;  2JKT I;  5I94 A;  4JGP A;  3E2K A;  2L0W A;  3Q82 A;  3UE0 A;  3FYZ A;  4DJ3 A;  3CWF A;  3S7P A;  3F1N A;  2HDQ A; 
#chains in the Genus database with same CATH homology
 2HP5 A;  4OPR A;  1FCN A;  5E2E A;  5E2G A;  4ZJ2 A;  3WS1 A;  3N6I A;  2ZQA A;  4GKU A;  1LI0 A;  2EX9 A;  2HP6 A;  1RGZ A;  3Q7Z A;  1RGY A;  3VOY A;  4U3T A;  4OOM A;  3VOZ A;  4EWF A;  1WYB A;  4UA7 A;  3ZG8 B;  1YQS A;  3TG9 A;  5AQ7 A;  4D2O A;  1DY6 A;  3OPL A;  1K4F A;  1L2S A;  3MZF A;  1IYO A;  3PBO A;  4EQI A;  5A92 A;  1CEF A;  5CEC A;  4LEN A;  4WEL A;  1N9B A;  1PZP A;  5CHM A;  3VP3 A;  1BZA A;  3GRJ A;  4MBH A;  3LY3 A;  1HZO A;  2J7V A;  4P87 A;  3WRT A;  4CPK A;  2ZM2 A;  2PBY A;  5CRF A;  1BLH A;  1W8Y A;  2OLU A;  1L0D A;  3PBT A;  2WKI A;  5F82 A;  3ZHH A;  1ES4 A;  5HAQ A;  1FSY A;  2C5W B;  3CZD A;  3IF5 A;  3NIA A;  3W4Q A;  3BFC A;  4N92 A;  3SH9 A;  2BLS A;  1TDG A;  2XR0 A;  1E3U A;  3GQZ A;  3OC2 A;  4OP8 A;  3IH9 A;  3UDI A;  1IYS A;  4QY6 A;  1WE4 A;  3IT9 A;  3BLS A;  4MBF A;  1PI4 A;  1DJC A;  1ONG A;  3IQA A;  5TGF A;  1G6A A;  5FQ9 A;  3DTM A;  2VGJ A;  3IF6 C;  4OLD A;  3ZVT A;  4E6X A;  4RX3 A;  1ESI A;  1YLT A;  1M6K A;  5FAQ A;  3BEB A;  2QPN A;  3ZVW A;  3M6H A;  2Y2Q A;  5DVA A;  4OVD A;  1PI5 A;  4KG6 A;  1YMS A;  3A3J A;  3Q07 A;  4S2M A;  3ZNY A;  1I2S A;  2V2F F;  2ZC4 B;  4X68 A;  1LLB A;  2Y59 A;  3IXH A;  3N7W A;  5CTN A;  3Q7V A;  5FAT A;  1K55 A;  4JF5 A;  3IHB A;  3MKE A;  5CED A;  2Y2H A;  3RXX A;  4GOG A;  4EBN A;  4OLG A;  4DDY A;  1RP5 A;  2VGK A;  4XUX A;  3AGF A;  3UPP A;  2Y55 A;  3BM6 A;  4P6B A;  1KVL A;  2R9W A;  4OPZ A;  2QMI A;  4Z9Q A;  2HDS A;  4QJG A;  1ALQ A;  3NY4 A;  4GD8 A;  4LV1 A;  4EV4 A;  1BLS A;  4QU3 A;  4KZ7 A;  4X55 A;  2OV5 A;  1MWT A;  5F83 A;  1DJA A;  1QME A;  5HFO A;  3WS4 A;  3FZC A;  5CGW A;  1YLY A;  4XXR A;  3BLM A;  1ERO A;  4OH0 A;  5CER A;  1NYY A;  1H5X A;  1CI8 A;  2XK1 A;  1GHM A;  4YFM A;  3IHA A;  1PYY A;  2XDM A;  2EFU A;  2HDR A;  3SH8 A;  2ZD8 A;  1ERQ A;  4MNR A;  1MKI A;  5AQ9 A;  4KQQ A;  1GHP A;  5GHZ A;  4X56 A;  5GLC A;  5E2F A;  3DWZ A;  1KDS A;  4WBG A;  5FQI A;  1PW8 A;  3BFD A;  3GR2 A;  3HUM A;  3Q1F A;  4A5R A;  3HLF A;  4WMC D;  5DTS A;  1LL5 A;  3E2L A;  4P0M A;  3ZNT A;  2H0Y A;  2WGW B;  4Y7P A;  2XD1 A;  1E3U D;  2Y2N A;  4OP5 A;  2PU4 A;  2V20 A;  5FQQ A;  4RA7 A;  5AQA A;  1K6R A;  4S2N C;  2J9O A;  2XLN A;  2J9P A;  4JXG A;  3LEZ A;  3HUO A;  2Y2L A;  1ZKJ A;  3LY4 A;  4E6W A;  3N8S A;  3PBR A;  3OCL A;  4WZ5 A;  3W4O A;  2WAE A;  4BEN A;  1Z6F A;  3V39 A;  3N8L A;  5DF7 A;  5CEB A;  3WWX A;  5JYP A;  1FSW A;  1LHY A;  3TOI A;  2ZQD A;  3ZG7 B;  3MXS A;  1U60 A;  1XA7 A;  2ZC3 B;  4F94 A;  1G68 A;  1YLP A;  3EQU A;  1XX2 A;  4R23 A;  3SOI A;  2EX6 A;  1SCW A;  4WZ5 C;  3VFH A;  4KG5 A;  4OPQ A;  5FDH A;  2A3U A;  4QB8 A;  4R4R A;  5M19 A;  5HX9 A;  3DWK A;  4HBT A;  3Q7V B;  1M40 A;  3G4P A;  5A93 A;  3HVF A;  3A3F A;  4E3J A;  2ZQ9 A;  5FAS A;  1W79 A;  3PTE A;  3GTC A;  4WM9 A;  4GZB A;  1VQQ A;  1KVM A;  4OOY A;  2H10 A;  3M2J A;  1YT4 A;  4OQ0 A;  1NZO A;  1VM1 A;  2XD5 A;  4JKT A;  2Z2M B;  3SS4 A;  3HLC A;  4Y0O A;  3ZDJ A;  1YMX A;  1JWZ A;  1IEM A;  2IWD A;  4E3I A;  4P85 A;  2Y91 A;  3OPP A;  4JXV A;  3HL9 A;  1BUL A;  3W8K A;  3BFE A;  4KZ4 A;  5HL1 A;  5DF9 A;  4BD1 A;  4KEN B;  5FAP A;  1S6R A;  4BQM A;  3DW0 A;  3Q81 A;  4RVA A;  5BOH A;  5GL9 A;  3MKF A;  4S2P A;  1MWR A;  4HES A;  2ZC6 B;  1ZG4 A;  2ZQ7 A;  5D3O A;  4HBU A;  2WZZ A;  4WEK A;  2Y4A A;  2P9V B;  2WK0 A;  2WGW A;  2Z2L B;  1PWG A;  4N9L A;  1L0F A;  1YLZ A;  3IXG A;  5HAR A;  2ZC7 A;  1O07 A;  1XGJ A;  3CMZ A;  1LI9 A;  4K0X A;  4L0L A;  4CJN A;  4OPY A;  4FH2 A;  4E3M A;  1EWZ A;  1W5D A;  4DE2 A;  4UHU A;  3FV7 A;  3PAE A;  2RL3 A;  4GDN A;  4R1G A;  3UDF A;  1JWP A;  4JF4 A;  1ES5 A;  2WUQ A;  3GMW A;  5FAO A;  2WKH A;  2V1Z A;  5A90 A;  3IXD A;  2XFS A;  3UPO A;  1SDN A;  3GSG A;  4WEJ A;  1K56 D;  1N4O A;  3D4F A;  3HLD A;  3ITB A;  4S2O A;  4EBP A;  5FA7 A;  4IBX A;  1NZU A;  1K25 A;  1NJ4 A;  3NDG A;  1MWS A;  2Y2G A;  4PM8 A;  4QHC A;  3VMA A;  4E3L A;  1MBL A;  1NXY A;  3A3I A;  1ZG6 A;  2Y2I A;  2X71 A;  4EBL A;  4JPM A;  4KG2 A;  3IXB A;  5EE8 A;  2FFY A;  2WKE A;  2J8Y A;  2WAD A;  1PWD A;  3G31 A;  1QMF A;  3G2Y A;  1FR1 A;  1JWV A;  5EVL A;  4OQG A;  3JYI A;  3I7J A;  2ZC5 B;  1WYC A;  4R0Q A;  4DDS A;  3NC8 A;  4WZ4 A;  5FSR A;  3V3S A;  1KGF A;  2G2U A;  3HRE A;  4LCL A;  5HW3 A;  3PBN A;  1GCE A;  2JC7 A;  1ES2 A;  2XH9 A;  5JYO A;  1Q2P A;  3WS0 A;  1MPL A;  4NET A;  5EUA A;  4QY5 A;  1MXO A;  2HPB A;  4LCM A;  4IVK A;  1XA1 A;  2G2W A;  3WRZ A;  4HEF A;  1GHI A;  2DCF A;  4S2L A;  4JXW A;  5U47 A;  4K91 A;  2ZJ9 A;  4UAA A;  1PZO A;  4N1H A;  5EVI B;  4ZDX A;  2DRW A;  4DKI A;  2ZM0 A;  3S4X A;  1Y54 A;  2ZMA A;  1BLP A;  3OZH A;  3VP2 A;  3N8R A;  4S2K A;  1MWU A;  3RJU A;  2Q9M A;  5TFQ A;  4KZA A;  4N9K A;  3WS5 A;  1TEM A;  4X6T A;  5EOO A;  3MBZ A;  4Y0U A;  4OOL A;  1TVF A;  4BD0 A;  3IF6 B;  2JCH A;  4NK3 A;  4E3K A;  2EXA A;  2WGV A;  4R3B A;  3VSL A;  3G30 A;  5EVI C;  1XGI A;  3EQV A;  4KZB A;  1LL9 A;  5KSC A;  4ZJ1 A;  3MXR A;  5HAP A;  3HBR A;  3VP4 A;  3V50 A;  4JBF A;  3IWQ A;  3C5A A;  1OME A;  1XKZ A;  4C3Q A;  3UY6 A;  1ONH A;  2HP9 A;  5E43 A;  4KZ3 A;  5GLD A;  1JTG A;  2XQZ A;  1BSG A;  4B4X A;  3A3E A;  1S0W A;  4PM9 A;  3UN7 A;  3HLB A;  3QNC A;  2A49 A;  4R3J A;  1K56 A;  2XEP A;  4DXC A;  4QD4 A;  4B88 A;  2ZM8 A;  4MLL A;  1KGG A;  1NY0 A;  2WYX A;  4E3N A;  3IWO A;  4PM5 A;  3OCN A;  4DE1 A;  1KGE A;  4K0W A;  1JVJ A;  3BEC A;  3NCK A;  4ZJ3 A;  1JTD A;  2ZQ8 A;  4LV3 A;  2WAF A;  3V5M A;  1ERM A;  5IHV A;  1HVB A;  2BG1 A;  5J8X A;  4PPR A;  4DRT A;  3HUN A;  3M2K A;  3LO7 A;  5FQK A;  3UE3 A;  4Y0T A;  2JE5 A;  4WYY A;  1O7E A;  4PMA A;  2EFX A;  4DF6 A;  5EOE A;  1SKF A;  3ISG A;  4YIN A;  5FI2 A;  2HDU A;  3HLW A;  3ZCZ A;  4MEZ A;  1E4D A;  1K6S A;  3UDX A;  1MY8 A;  1K54 C;  4FH4 A;  2X02 A;  4PM7 A;  2WGI A;  3V3R A;  1C3B A;  4U0X A;  4GNU A;  3UO9 A;  3VFF A;  1IYP A;  3FKV A;  2R9X A;  4JF6 A;  3G34 A;  3VP0 A;  5KSH A;  1PIO A;  4ZTK A;  3SS3 A;  5CHU A;  3ZFZ A;  2EX2 A;  5E2H A;  2Y2J A;  3S1Y A;  1YLJ A;  2WZX A;  4FSF A;  3GV9 A;  1TDL A;  3OPR A;  3O3V A;  4OQI A;  3ZGA B;  4DE3 A;  3IF6 A;  4LV0 A;  4PM6 A;  4UA9 A;  3O88 A;  5G18 A;  2H5S A;  3M6B A;  4OON A;  1FCM A;  5FI7 A;  2Y2K A;  5GLB A;  2H0T A;  1BLC A;  5DF8 A;  3UNW A;  2C6W B;  1H8Y A;  4KZ8 A;  4Q8I A;  5FQM A;  2Y2P A;  1AXB A;  2IWC A;  4X69 A;  3QNB A;  4KQR A;  1W8Q A;  3N4I A;  2XGN A;  4RYE A;  2XFT A;  4H8R A;  4IBR A;  4S2I A;  4XUZ A;  3WS2 A;  3ZG5 A;  3FKW A;  2ZLY A;  4GDB A;  1IKI A;  5CXW A;  1K57 A;  4LV2 A;  2Y2O A;  4S2N A;  2XF3 A;  1KE3 A;  3HLE A;  3NI9 A;  4WMC A;  2CC1 A;  1IEL A;  2PU2 A;  4GB7 A;  3G32 A;  3IWI A;  3UPN A;  4C6Y A;  4FCF A;  3HLG A;  5CGX A;  2OLV A;  1IYQ A;  5F1F A;  1K57 C;  1FR6 A;  2JBF A;  1KE4 A;  4ZBE A;  1I5Q A;  1XP4 A;  4JXS A;  4OKP A;  5CTM A;  4S2J A;  3BRM A;  1HTZ A;  3P98 A;  3PBQ A;  3S22 A;  4IED A;  3CJM A;  4BLM A;  4U0T A;  5EEC A;  3B3X A;  3O87 A;  3MFD A;  2E8I A;  3ITA A;  4UA6 A;  2Q9N A;  3LCE A;  1I2W A;  4R4S A;  2DNS A;  2RCX A;  4EUZ A;  3FWL A;  5GLA A;  5AQB A;  3RXW A;  3UE1 A;  4MBK A;  2Y2M A;  4KZ6 A;  5A91 A;  2ZQC A;  1L0G A;  4OQH A;  5FQJ A;  1PW1 A;  5TR7 A;  1NYM A;  4DE0 A;  2P9V A;  1HD8 A;  5DTK A;  5KMW A;  1K55 C;  2B5R A;  1YLW A;  3O86 A;  3C7V A;  3ZG0 A;  5CGS A;  3TSG A;  1E25 A;  1NRF A;  3C4P A;  4KZ9 A;  5GHY A;  4C75 A;  3SS5 A;  1CEG A;  5KZH A;  2FFF B;  5F1G A;  4BJP A;  1EI5 A;  1H8Z A;  2P74 A;  3CG5 A;  3QHY A;  4GN2 A;  5GHX A;  3VSK A;  1W7F A;  3BFF A;  1SHV A;  3A3D A;  1BTL A;  5M18 A;  5EVI D;  1K54 A;  1PWC A;  2X01 A;  4N1X A;  1J9M A;  1XPB A;  3NDE A;  3IH8 A;  4ZAM A;  3W4P A;  2OSU A;  1IKG A;  4DXB A;  4GD6 A;  1ZC2 A;  5L2F A;  1FOF A;  2UWX A;  4RX2 A;  5HAI A;  2QZ6 A;  1FQG A;  2IWB A;  1KE0 A;  1K4E A;  1YM1 A;  1XXM A;  3ZG9 B;  4BL3 A;  1Q2Q A;  1DJB A;  3C4O A;  3NBL A;  1L0E A;  3C7U A;  4FD8 A;  1K38 A;  4BL2 A;  4ID4 A;  4KQO A;  1CI9 A;  4E3O A;  4O7D A;  5I94 A;  1KDW A;  4JLF A;  1ESU A;  5DTT A;  3E2K A;  4KZ5 A;  5FI6 A;  3OPH A;  1BUE A;  3Q82 A;  3MZD A;  5CHJ A;  3AGD A;  2EX8 A;  3UE0 A;  1FCO A;  4X53 A;  1RCJ A;  3G2Z A;  2GDN A;  3P09 A;  3GVB A;  3FYZ A;  3G35 A;  4B4Z A;  1BT5 A;  5EPH A;  3MZE A;  3PAG A;  1GA9 A;  3BFG A;  3PBS A;  1CK3 A;  2EXB A;  4IVI A;  2I72 A;  3BYD A;  1GA0 A;  3AGE A;  4M3K A;  3SH7 A;  5M1A A;  5EVI A;  3VP1 A;  1ES3 A;  1SDE A;  2HDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...