4N92A

Crystal structure of beta-lactamse penp_e166s
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
256
structure length
256
Chain Sequence
DDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFSPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Perturbing the General Base Residue Glu166 in the Active Site of Class A beta-Lactamase Leads to Enhanced Carbapenem Binding and Acylation
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
total genus 90
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4n92A00
1ES4A 3VP0A 3G32A 3IXBA 4EQIA 3IQAA 4ZJ3A 1MBLA 1GHPA 5FSRA 1NYMA 1W5DA 4MBHA 1TEMA 3O88A 1YT4A 3FWLA 1K57C 2WAEA 5DTKA 1RP5A 3IH8A 2ZC4B 2HP6A 1YMSA 1PZPA 2H0YA 4QU3A 4LENA 2ZQ9A 4JF5A 1TDLA 1GCEA 2VGKA 2Q9NA 1KGGA 4OONA 4P0MA 5KSHA 5CGSA 2Y2JA 2XK1A 5CRFA 1XPBA 3N6IA 3ZG8B 5M19A 1S6RA 4GZBA 3ZNYA 2A49A 2GDNA 4E3KA 1KGEA 2XR0A 3W4OA 3W4QA 4GOGA 1W79A 2Y2NA 1PWCA 1MWSA 4E6WA 3HBRA 1O7EA 3SH7A 1EWZA 4R4RA 4X69A 2WADA 1RGYA 1HTZA 2XF3A 1DJAA 5I94A 4Y0OA 5CTMA 1ALQA 4KZ4A 4F94A 4K91A 3UE1A 2JCHA 5F1GA 1KVMA 4KZAA 2WAFA 2QPNA 2A3UA 2P9VB 4A5RA 4WZ4A 3OC2A 4DE1A 3ZDJA 1OMEA 3A3FA 3HL9A 1K56A 1YM1A 3IT9A 5EOEA 1JWPA 4IBXA 1G68A 4LV3A 5FI7A 1WYBA 1ONHA 3FV7A 5EUAA 5M1AA 3VFHA 2QZ6A 4IVIA 3A3EA 3BRMA 3A3JA 2HP5A 1ZKJA 2DNSA 4KZBA 1AXBA 3WS1A 3AGEA 1BSGA 1XGJA 2V20A 4RX3A 2G2WA 4LCLA 3CG5A 3HLEA 2P9VA 2R9XA 3DWKA 5GLDA 1WE4A 1JWZA 1M6KA 2EXBA 1I5QA 2WGIA 1KGFA 1GHMA 1SDNA 3HLGA 4JXGA 3MFDA 5F82A 1K6SA 3DWZA 3NC8A 3UPPA 1BTLA 2OSUA 1XA1A 4GN2A 3WS5A 1TDGA 5DF8A 3GTCA 2PU2A 4QHCA 3Q07A 5FAOA 1IKIA 1XP4A 1QMFA 1FOFA 1NYYA 4RVAA 1YLPA 1I2SA 3EQVA 3FKVA 3PBRA 5GLCA 4OLDA 1IYOA 4OOMA 1L0DA 3N7WA 4KZ8A 4OVDA 5AQAA 2Y2LA 5HAQA 3OCLA 2XQZA 4D2OA 2G2UA 3WRZA 3GV9A 4XUZA 4P6BA 1CI9A 2X02A 4N1XA 3OPHA 4E3OA 3ITAA 4WEKA 5CGXA 1YMXA 5HAPA 3G30A 1IELA 4U0XA 3G2ZA 1GHIA 3BFCA 5L2FA 1VM1A 3O87A 3EQUA 3VOYA 4GD8A 3ZVTA 2JC7A 4X53A 4DDYA 2HPBA 4S2MA 2XEPA 4JXWA 3E2KA 1JTGA 4PM8A 1PYYA 3BEBA 5E2GA 1BT5A 1FR6A 2IWCA 4L0LA 3VSLA 3ZNTA 4B4ZA 5FI6A 4E6XA 3A3DA 3M6HA 4GNUA 4Y0TA 1SCWA 1NY0A 5EECA 1IYSA 3TG9A 4KZ7A 5JYOA 2ZQAA 1SHVA 5E2EA 4E3IA 1LI9A 2EX2A 2Y59A 1ERQA 4FSFA 5EVIB 3SS3A 3DW0A 1FCOA 5GHYA 3IXDA 4DE3A 3BYDA 2HDRA 4HESA 4ZTKA 5GLAA 4C3QA 5CEDA 3VOZA 2C6WB 5FQQA 1N9BA 4PM9A 2ZC6B 3IF5A 2J9PA 2Y2HA 4X68A 3V3SA 3WS2A 4IVKA 2Y2OA 4JBFA 4K0WA 4OLGA 4RA7A 4JKTA 5EVIA 2IWDA 4BLMA 4DXBA 3SOIA 1PI5A 5BOHA 3SH8A 4FH2A 4E3NA 2IWBA 1TVFA 2XD5A 5FQKA 3ZG9B 3RXWA 5G18A 3VP2A 5F1FA 1CI8A 1Q2QA 3MXSA 1CK3A 2Y2KA 1FR1A 1PI4A 3BFDA 4WELA 5CGWA 4R3JA 2Q9MA 3NI9A 5EVIC 1IKGA 4EV4A 4YFMA 2V2FF 4HEFA 5KSCA 1ESUA 2V1ZA 3FKWA 2DRWA 4KG5A 4EBPA 5HAIA 2WYXA 2H5SA 3GR2A 4MNRA 3OPRA 3AGDA 3FYZA 4PM7A 1NXYA 1K4EA 2ZQ8A 1C3BA 3C7VA 5E2FA 1LL5A 4IEDA 4BENA 3LO7A 1EROA 2OLVA 1MXOA 4RYEA 3TSGA 3W8KA 4C75A 3NCKA 4WBGA 4PM6A 3G4PA 3QNBA 4DDSA 3PBSA 4E3LA 3OPLA 1XXMA 3SS4A 2J9OA 4OPRA 3RXXA 3HLWA 5CHUA 3NIAA 3ZG5A 3HUOA 4QY6A 5KMWA 2C5WB 3PBOA 3IH9A 1J9MA 4X6TA 1K6RA 2ZQDA 3LY4A 1IYPA 4DE0A 4ZBEA 5HARA 1KDSA 2ZC7A 3IXHA 4X56A 5FATA 1KVLA 3IF6B 5CHMA 5EVID 3GRJA 2E8IA 4WZ5A 5AQ7A 1PIOA 4OP8A 3N4IA 4JF6A 1ES5A 2XFTA 5A92A 2Y2MA 1LHYA 4MEZA 4N9KA 4R4SA 1NJ4A 1GA0A 4S2PA 4MBFA 5FAQA 3MZDA 2Y4AA 1Y54A 4QD4A 3UO9A 3ITBA 3P09A 3UDXA 5D3OA 1PWGA 2EFXA 1PWDA 2J8YA 4S2JA 1K55A 1NZUA 1MWUA 4KG2A 1W7FA 2XH9A 3UDFA 4S2LA 1Q2PA 2Y2QA 3N8RA 2FFFB 1KE0A 3IXGA 4WM9A 4WMCA 3IF6A 3Q82A 1K54A 4WZ5C 5TFQA 3OCNA 3ZG7B 4OPYA 5TGFA 2HDQA 1XA7A 4KZ6A 3UPNA 1MWRA 3AGFA 3HREA 4WEJA 5GLBA 4PPRA 4LCMA 3M2JA 1BZAA 4KQOA 5DTTA 2ZM0A 3MZFA 1K55C 4B88A 3LY3A 3OPPA 1XKZA 5DVAA 3UE0A 3D4FA 3VMAA 4N9LA 3GSGA 2WGVA 3Q1FA 5EPHA 5TR7A 5CECA 4KZ9A 3UPOA 1VQQA 4HBUA 1FQGA 4OQGA 1K25A 1LL9A 5FQ9A 4KZ3A 2VGJA 4UA9A 2XD1A 3HLBA 5E43A 3PAEA 1ONGA 3V5MA 4QJGA 3Q7VB 4PM5A 3MKFA 3MBZA 4XUXA 1ES3A 4JXVA 4JF4A 2Y55A 4BQMA 4ZDXA 1HZOA 3C4PA 1KE3A 2WGWB 1H5XA 5CERA 5FQIA 2EFUA 4QY5A 4LV2A 4Q8IA 4UAAA 3WWXA 4WYYA 3VP4A 1NRFA 5GHZA 1FSWA 4HBTA 3I7JA 3HVFA 3VSKA 2BG1A 4ZJ2A 3NDGA 4DF6A 1L2SA 2Y91A 1DJBA 4B4XA 3V39A 3Q7VA 3PBQA 3QNCA 3WS4A 2WZXA 2ZC3B 3PTEA 4DRTA 3ZGAB 4OPQA 1YLTA 5KZHA 4WMCD 2WGWA 4OQ0A 1YLJA 1H8YA 2Y2PA 4KENB 3BECA 3A3IA 1MPLA 3OZHA 2R9WA 3W4PA 3Q7ZA 1YQSA 3CMZA 3UE3A 3BLSA 1LLBA 3NY4A 4R1GA 1Z6FA 4BJPA 1IEMA 2JBFA 2WUQA 4FD8A 4U3TA 4UA6A 1FCNA 3SS5A 2XDMA 1MWTA 5J8XA 1G6AA 3UY6A 4P85A 5EOOA 3WS0A 3UDIA 3IHAA 2QMIA 1N4OA 2PBYA 2WK0A 3GQZA 3N8SA 2RCXA 3BFGA 3E2LA 3WRTA 4C6YA 2XGNA 1BUEA 3JYIA 1I2WA 3C7UA 1E4DA 5DF9A 1JTDA 4Y7PA 4Y0UA 3BFFA 1BLCA 3IWQA 4DXCA 2ZC5B 3G34A 1HD8A 3ZFZA 2BLSA 3PAGA 4UA7A 1S0WA 4EBNA 1CEGA 4KQQA 3O86A 1QMEA 4BL3A 4KZ5A 1DJCA 2H10A 4EWFA 1MKIA 1CEFA 1W8QA 1L0EA 2WKIA 5FDHA 1LI0A 3ISGA 2J7VA 5HFOA 3CZDA 4OQIA 2ZJ9A 4BD0A 2ZMAA 2JE5A 2B5RA 5F83A 1K38A 5JYPA 3M2KA 3CJMA 4JPMA 3O3VA 3M6BA 1KE4A 3RJUA 2OV5A 1MY8A 5EVLA 1L0GA 1YLZA 2H0TA 3PBTA 1BLPA 1ZG4A 4E3MA 4CJNA 4EBLA 2ZM2A 1O07A 3VP3A 2Z2LB 1HVBA 4LV1A 3ZG0A 3Q81A 1W8YA 2XFSA 4S2OA 4BD1A 1K4FA 1PW8A 3MKEA 4N1HA 4R0QA 5HW3A 2RL3A 1YLWA 2EXAA 2Y2GA 3UNWA 1PZOA 4KG6A 2HDUA 3HLFA 4UHUA 5AQBA 2EX6A 3NBLA 3V3RA 5CHJA 5EE8A 3V50A 5FASA 2EX9A 3GVBA 2XLNA 3BM6A 5AQ9A 1E3UA 2X71A 4OKPA 4YINA 4RX2A 1BLSA 3HLCA 2WKEA 2FFYA 1IYQA 2PU4A 5FQMA 4XXRA 5A91A 4JXSA 5A93A 3S22A 1RGZA 5CXWA 4MBKA 5HX9A 3QHYA 4EUZA 2CC1A 1JVJA 3UN7A 4GD6A 2ZQ7A 4S2NA 3DTMA 3PBNA 4GKUA 1WYCA 1SKFA 1ES2A 3P98A 4DKIA 5M18A 3BLMA 4OOLA 2OLUA 4U0TA 1GA9A 1XX2A 4X55A 5CTNA 4M3KA 3NDEA 2DCFA 3HUMA 3IF6C 1K54C 2ZM8A 4KQRA 4N92A 2X01A 3G31A 3VP1A 2WZZA 5FA7A 4R23A 1RCJA 5IHVA 4GDBA 2P74A 1H8ZA 1BLHA 4OH0A 4R3BA 4BL2A 2ZD8A 4Z9QA 3SH9A 5FAPA 1KDWA 3FZCA 4S2NC 1NZOA 2ZQCA 1ERMA 5GHXA 4CPKA 5CEBA 1ZC2A 1ZG6A 3BFEA 3ZVWA 5DF7A 1M40A 4E3JA 2HP9A 2Y2IA 3MXRA 4OOYA 2WKHA 3LEZA 1XGIA 3GMWA 4GB7A 3VFFA 1ESIA 5FI2A 3C5AA 3ZHHA 4ID4A 4ZJ1A 2UWXA 4LV0A 1U60A 4MLLA 4JLFA 5E2HA 1K56D 3HUNA 3HLDA 4S2KA 1FSYA 1E3UD 5HL1A 4P87A 1YLYA 1E25A 1DY6A 3TOIA 3MZEA 1L0FA 3N8LA 1EI5A 4NETA 4GDNA 5A90A 2Z2MB 5U47A 4H8RA 4NK3A 2ZLYA 3S1YA 3S4XA 3ZCZA 2HDSA 3B3XA 3IWIA 4O7DA 4DE2A 1JWVA 4OP5A 1PW1A 1SDEA 5DTSA 3G35A 5FQJA 4OQHA 3LCEA 2I72A 1FCMA 3C4OA 4S2IA 4OPZA 4ZAMA 4FCFA 3G2YA 4PMAA 3IHBA 1K57A 5GL9A 4K0XA 1BULA 4IBRA 2EX8A 4QB8A 3IWOA 4FH4A
chains in the Genus database with same CATH superfamily
3G32A 1GHPA 1W5DA 1K57C 2WAEA 1PNEA 2HP6A 3UB9A 2KLIA 4QU3A 4LENA 1TDLA 5F6AA 1KGGA 2XK1A 5CRFA 3ZG8B 1S6RA 3T4OA 2A49A 2GDNA 2XR0A 1YPRA 3KX0X 3P7NA 1ZTUA 4X1LA 1PWCA 1UGUA 4E6WA 1O7EA 4Q0IA 3BQ8A 3IBJA 5DJUA 1EWZA 2WADA 2XF3A 1HTZA 4Y0OA 2QWSA 5FEFA 3UE1A 5F1GA 2L0WA 2A3UA 3OC2A 1N9OA 3T1RA 1K56A 1YM1A 1ONHA 3FV7A 3VFHA 4X1MA 4CLCC 4RX3A 1YSPA 2G2WA 1OJ5A 3HLEA 2P9VA 2Y79A 3HLGA 2WGIA 1K6SA 3DWZA 1BTLA 5AVEA 3K2NA 3GTCA 3R4KA 1IKIA 1FOFA 3NULA 4RVAA 1I2SA 3FKVA 5GLCA 1IYOA 1L0DA 3N7WA 3OCLA 3WRZA 3GV9A 2PRFA 3ITAA 2V9AA 1YMXA 3G30A 2JKGA 4U0XA 3KYZA 3O87A 2JKRM 3EQUA 3ZVTA 4X53A 2HPBA 2XEPA 3E2KA 4PM8A 1BT5A 2IWCA 4E6XA 3A3DA 3M6HA 1EW0A 5EECA 3TG9A 4KZ7A 1LI9A 2Y59A 1FCOA 4DE3A 2HGVA 4HESA 2B18A 4ZTKA 3VE4A 5GLAA 4C3QA 2KX6A 4I38A 5A8BA 1N9BA 1S67L 3IF5A 3PR6A 5C5KA 4BLMA 3SH8A 4FH2A 1TVFA 2XD5A 1P9RA 3VE3A 2V0UA 1IFQA 1Q2QA 4WELA 5CGWA 3W2ZA 3QP5A 3NI9A 3CAXA 1D7EA 4YFMA 2DRWA 5HAIA 3GR2A 2O99A 3C7VA 1EROA 2OLVA 4II7A 4RYEA 3NCKA 4MDZA 4E3LA 2D01A 5FDSA 2O9CA 3HLWA 3BW6A 3P01A 4R6LA 4QY6A 5KMWA 4R38A 2C5WB 3IH9A 3T4LA 4LRZE 2XROA 4MCWA 1IYPA 4DE0A 5HARA 1KDSA 2ZC7A 3IXHA 3LIDA 4ME4A 2E8IA 5AQ7A 2K31A 2Y2MA 5A92A 1NJ4A 1Y54A 3UO9A 3ITBA 5D3OA 2EFXA 4ETXA 4BMWA 1K55A 2XA7M 1NZUA 1MWUA 4LPZA 3CUEC 3UDFA 1Q2PA 3N8RA 4WMCA 3Q82A 4WZ5C 1YAXA 4KUOA 5TGFA 4Y17A 5F5YA 5EV0A 3HREA 3QP6A 4LCMA 3LY3A 5DVAA 3UE0A 2INWA 2H28A 3GSGA 3MF0A 1VQQA 2VGLS 3T1QB 2VGJA 3U2AA 5L09A 2V1BA 3Q7VB 5L07A 2VEAA 4JF4A 2Y55A 4BQMA 4JGPA 1HZOA 3C4PA 1KE3A 2AVXA 2WGWB 1GSVA 4HOIA 1NRFA 2OWHA 3NDGA 4DF6A 1L2SA 2PR5A 3V39A 3PBQA 3F1OA 3OBFA 1S4RA 4DRTA 1XJ6A 3UB5P 5KZHA 4WMCD 4HJ4A 3NECA 1H8YA 5HWWA 3OZHA 1AWIA 3Q7ZA 4EEPA 4R1GA 1Z6FA 4BJPA 1XFNA 2JBFA 1DP9A 1MWTA 3LIFA 5EOOA 3IHAA 3N8SA 2RCXA 3BFGA 3L7HA 1BUEA 1TS6A 1E4DA 5EM1A 1JTDA 4Y7PA 3IWQA 3LI9A 2BLSA 3PAGA 5J3WA 4NEED 1CEGA 1XJ2A 3O86A 1CJFA 2ZL1B 4EETB 1QMEA 3V67A 1MKIA 5HPIA 1STZA 1L0EA 5HFOA 4OQIA 3T4TA 5F83A 5JYPA 3CJMA 4JPMA 3M6BA 5EVLA 1X0OA 3L9KA 4O0PA 1BLPA 1ZG4A 4E3MA 4CJNA 4EBLA 3VP3A 5MC7A 2Z2LB 1HVBA 4LV1A 1OT6A 3ZG0A 2XFSA 2OAP1 4N1HA 1A0KA 1YLWA 2EXAA 4HP9A 2HDUA 3HLFA 2PD8A 5AQBA 2EWWA 5CHJA 5EE8A 3VV4A 2XLNA 3K3CA 1E3UA 2X71A 5DKLA 4XXRA 4EUZA 3KO6A 4DN0A 2ZQ7A 3DTMA 3PBNA 4GKUA 1WYCA 5FI6A 4HH3A 2DCFA 4N92A 4I3IA 2WZZA 4IHQA 1RCJA 2LB5A 3SW1A 1XFQA 3FZCA 2QHKA 5GHXA 3MMHA 1ZG6A 3EEAA 1XGIA 3VFFA 5FI2A 3C8CA 4WF0A 1UWPX 2XSSA 3HUNA 3RFBA 1F2KA 1E3UD 3C2WA 2XRNA 1EI5A 4NETA 4NK3A 4DE2A 1LSWA 4LLOB 3C4OA 5AJGA 3G2YA 4PMAA 2YKHA 5DFYA 3VP0A 4FOFA 3IQAA 3O88A 3IH8A 4F3LA 4JGQA 4DJ2A 2O0YA 4JF5A 4WLAA 1GCEA 2VGKA 3QP8A 4G3VA 4P0MA 5CGSA 2G7UA 5M19A 4GZBA 4HHDA 3ZNYA 4K08A 4CLCB 5HPFA 4E3KA 4NXGA 4EESA 5TJJA 1RGYA 3H7WB 2HV1A 1OJGA 1DJAA 2V8CA 5I94A 2J3TC 5CTMA 4F94A 3RTYA 2JCHA 2KOIA 4KZAA 3IX4A 3A3FA 4IJGA 3IT9A 1JWPA 4IBXA 2FZ0A 2W1TB 3A3JA 4KZBA 3WS1A 1WA9A 2V20A 2GJ3A 4LCLA 3CG5A 4L9FA 1L3LA 1JWZA 4M4XA 2O9BA 1I5QA 4JXGA 1SDNA 4P6ZS 4WUJA 4LRYC 5F82A 1XA1A 1TDGA 4BBUA 2PU2A 1H0MA 1YLPA 3PBRA 1W63M 4OOMA 4OVDA 2Y2LA 2X02A 4YNRA 4L9EA 1VB6A 2M7UA 3UB6A 1OTAA 3EOIA 4JGOA 4WEKA 5CGXA 3BFCA 3VOYA 4GD8A 5L10A 1S1ZA 3FPVA 4JXWA 1JTGA 2Z6CA 1JNUA 4LRXC 4B4ZA 4L0LA 1FR6A 2W3EA 3CI6A 4Y0TA 1SCWA 1NY0A 2M7VA 4I3AA 2ZQAA 5E2EA 4FSFA 1ERQA 2QJ7A 3T12B 3IXDA 3MS6A 4F3LB 5CEDA 5FEGA 4PM9A 2J9PA 3F1NA 4HIAA 3U4LP 4K0WA 4OLGA 4XT2B 5FL3A 1KOUA 4PAUA 5HWTA 2IWBA 3H82B 3RXWA 3VP2A 5IU1A 1CK3A 1PI4A 3BFDA 4ARZB 2Q9MA 2K7SA 5EVIC 4GW9A 2V2FF 4HEFA 4KG5A 4B93A 2WYXA 3UB7A 1T18A 2YKFA 1VEUB 4PM7A 1NXYA 2ZQ8A 5E2FA 2I9VA 4BENA 3LO7A 1OTEA 4GHIB 1MXOA 3TSGA 4WBGA 2MJ6A 5HDSA 2NUPC 4OPRA 3DTKA 3HUOA 5L8MA 1K6RA 4ZBEA 5EVEA 5FATA 1KVLA 3IF6B 3LR4A 1MKMA 3HJIA 4JF6A 1ES5A 4MEZA 5HL6A 5FAQA 3T4KA 4S2PA 4MBFA 3UE6A 3P09A 4NXFA 3ZQ5A 4KG2A 1W7FA 2FFFB 3ZG7B 3CWFA 4R70A 2HDQA 4KZ6A 3S7QA 3UPNA 4LGWA 5DTTA 4B88A 1XKZA 3IX3A 4HP4A 5EPHA 5CECA 2B02A 3SZTA 5FQ9A 4KZ3A 4UA9A 3MQOA 1D1JA 1ONGA 4PM5A 1Y4OA 3MKFA 2V1AA 3MBZA 1ES3A 5G4ZA 2NUTC 5CERA 3F1NB 4Q8IA 2J3WA 3HVFA 4ZJ2A 4EERA 3Q7VA 3QNCA 3WS4A 1TS7A 3PTEA 1YLTA 2WGWA 3BQAA 1YLJA 2Y2PA 2WKRA 4KENB 3BECA 2K2NA 1LT0A 3CMZA 5HZHA 3BLSA 1LLBA 3NY4A 5TBMB 5CX7A 2WUQA 4RQ9A 1FCNA 1G6OA 1G6AA 3WS0A 2VV7A 3HCYA 5J7EA 2PBYA 2WK0A 4FTXA 2XGNA 2L4RA 4DMZA 1BLCA 1SKOB 3IS2B 4UA7A 4HY8A 4EBNA 1CEFA 2WKIA 5FDHA 1LI0A 2J7VA 4MN6A 4BD0A 1NLZA 3LIEA 4EXOA 2ZL1A 3M2KA 4P6ZM 1L0GA 4BWIA 1O07A 3KSIA 5DKKA 1K4FA 3MKEA 3UB8A 3NBLA 3V3RA 1D06A 3F1PA 4OKPA 1BLSA 3LICA 3HLCA 1TD5A 2FFYA 1IYQA 5FQMA 4JXSA 4E04A 5A93A 1RGZA 4MBKA 4GD6A 1P97A 4DKIA 1SKFA 3P98A 3BLMA 4OOLA 5CTNA 1GA9A 4X55A 4C6YA 4M3KA 4NXEA 3HUMA 3IF6C 2ZM8A 3G31A 4R23A 2P74A 4OH0A 5HD3A 4R3BA 1T1BA 3SH9A 4HH2A 4S2NC 5DF7A 1H8MA 4E3JA 1TS8A 2Y2IA 3T4SA 2WKHA 4GB7A 3MR0A 1ESIA 3KYEA 4ID4A 4YWZA 3A0RA 2W3DA 3BWLA 1J3WA 1U60A 4JLFA 1FSYA 1S1YA 1E25A 1FILA 1VHMA 1OTIA 5A90A 5U47A 3ZCZA 4O7DA 2HF6A 4EU0A 3OOVA 4OP5A 1PW1A 5FQJA 3LI8A 3FPWA 3LCEA 4S2IA 4OPZA 4ZAMA 3IHBA 1K57A 4K0XA 3JVVA 2PR6A 3T50A 3KSHA 4I3JA 3S7OA 2B95A 1ES4A 3NJAA 1YKDA 4Q0HA 1MBLA 5FSRA 1NYMA 1W63Q 1TEMA 1LSXA 5DTKA 4HNBA 1RP5A 3S7PA 1YMSA 2ZQ9A 3C38A 3KSFA 3E4OA 4OONA 1S66L 1XPBA 1G5UA 1KGEA 3W4OA 3W4QA 1W79A 3NOTC 4FUWA 1MWSA 4Z1WA 1H3QA 3SH7A 3F1PB 4EUVA 4R4RA 3A0SA 2JKTM 1ALQA 4KZ4A 3TE8A 4CLCA 3OLOA 3C30A 4DE1A 3PHYA 4WZ4A 3QP1A 4LV3A 3CHWP 2ACGA 5M1AA 2QZ6A 4IVIA 3A3EA 3H7WA 4Y15A 1ZKJA 1AXBA 2VZWA 3G6OA 1BSGA 1XGJA 3LEQA 3B42A 4PKYA 3MFXA 5GLDA 1K0KA 1M6KA 2EXBA 4QWOA 3MFDA 4IUKA 1BYWA 3NC8A 3UPPA 4GN2A 2W1TA 5FAOA 1N9LA 2A2LA 1QMFA 1NYYA 4OLDA 5HAQA 4HJ3A 4UEYA 5AQAA 1PRQA 4D2OA 2G2UA 3EGDC 1CI9A 1YSQA 2V0WA 3OPHA 4E3OA 4CLCD 2J80A 5HAPA 1IELA 3G2ZA 3LR0A 4GS9B 5G4YA 1GSXA 4EEUA 3FG8A 2GZAA 4S2MA 3H9WA 1PYYA 5HSQA 3BEBA 3VSLA 3ZNTA 4GNUA 3LR5A 4ESPA 1IYSA 2DMWA 1SHVA 3O5YA 4E3IA 5EVIB 3SS3A 1S4SA 2HDRA 3S7NA 1XJ3A 3RH8B 1F9IA 3D72A 2C6WB 4CQHA 2Y2HA 4X68A 3WS2A 4IVKA 2Y2OA 4JBFA 4L9GA 4RA7A 4JKTA 2IWDA 4DXBA 3SOIA 1CF0A 1NLYA 4E3NA 3MSHA 4GJ4A 5F1FA 2Y2KA 3DTIA 1FR1A 3NOPC 3T4JA 2HZ5A 4UQIS 4XT2A 1IKGA 4G3KA 4EV4A 1ESUA 2V1ZA 3FKWA 3KSGA 4EBPA 3E0YA 4H6JB 3H82A 2M1CA 4MNRA 3OPRA 5K5BA 3AGDA 3FYZA 4ARZA 4IEDA 3W8KA 4PM6A 3QNBA 4DDSA 3PBSA 4O8GA 3OPLA 2PHYA 3VOLA 3ZG5A 3MXQA 3PBOA 2PAVP 1VEUA 4X6TA 1SZVA 4GHIA 3CUEA 3LIAA 5CHMA 4WL9A 2VGLM 3GRJA 4WZ5A 1PIOA 4OP8A 1LHYA 4N9KA 2Y8HA 3MZDA 2Y4AA 2A24B 2EWVA 2J8YA 4S2JA 1LSVA 2XH9A 4S2LA 2Y2QA 4EQ1A 4WM9A 3IXGA 5TFQA 3IF6A 1MC0A 2R78A 1MWRA 5GLBA 4KQDA 4D60A 1BZAA 4KQOA 4ZRRA 1K55C 3VMAA 3D4FA 2PDRA 4N9LA 2WGVA 2VV6A 3B47A 5TR7A 4KZ9A 4HBUA 1FQGA 2VX8A 1K25A 2XD1A 3HLBA 3V5MA 4QJGA 2VK3A 4XUXA 5DJTA 4JXVA 2W27A 4QY5A 4LV2A 4UAAA 3WWXA 3BY8A 4WYYA 1FSWA 5KIZA 1DJBA 2Z6DA 2WKQA 3IX8A 2W0NA 2WZXA 2ZC3B 3ZGAB 4OPQA 3BJNA 3R7WB 2W3FA 3UMDA 2GX5A 2PYRA 1MPLA 2R9WA 3W4PA 1YQSA 1LL8A 1OPXA 1IEMA 3SS5A 1TF1A 4U3TA 4UA6A 5J8XA 3UY6A 4MN7A 2QMIA 1N4OA 3GQZA 3E2LA 3WRTA 4PHTA 3B33A 3LFVA 1I2WA 5DFXA 3C7UA 3JYIA 3UMEA 3CLOA 3CPTA 5TBMA 4Y0UA 4AFIA 2V8FA 2ZC5B 4G3WA 1HD8A 3ZFZA 3MQQA 3DBAA 3LUQA 1ACFA 4KZ5A 1DJCA 4EWFA 4JGRA 2E8JA 5IS1A 1W8QA 1SKOA 2ZJ9A 3IS2A 2B5RA 1K38A 3QP4A 2OV5A 1YLZA 3QP2A 3E98A 2BTFP 2ZM2A 2UV0E 4S2OA 5HW3A 2RL3A 4CLCE 3UNWA 3V50A 5FASA 5AQ9A 4YINA 4RX2A 5EFWA 4WN5A 2PU4A 4ETZA 5A91A 5CXWA 3QHYA 2CC1A 3LYXA 1ES2A 3PYPA 2JN7A 4EW7A 2ZOHA 3NDEA 3VP1A 1K54C 5FA7A 4GDBA 1H8ZA 4Z9QA 5FAPA 1KDWA 4PKYG 2JKFA 3ICYA 1NZOA 1VETB 5CEBA 3E4QA 3BFEA 1M40A 2JKTI 4OOYA 2ZBBA 3LEZA 4DJ3A 1P0ZA 3C5AA 3PXPA 2VJWA 4LV0A 3LGOA 1K56D 4S2KA 5IT5A 1DY6A 3TOIA 4HQAA 3K3DA 4GDNA 2JHEA 4H8RA 3S4XA 4UQIM 2EA9A 3EEHA 2HDSA 3B3XA 3CPTB 3IWIA 1SDEA 3G35A 4OQHA 2I72A 1FCMA 5HD5A 3IBRA 5GL9A 1BULA 2VLGA 4QB8A 2W3HA 3IXBA 4EQIA 2BASA 4ZJ3A 3GDIA 4MBHA 1YT4A 3FWLA 2QYBA 4Y13A 2ZC4B 1PZPA 2H0YA 3D9YA 3MQ0A 1T1AA 3BY9A 2Q9NA 5KSHA 4KUKA 2Y2JA 3N6IA 5AVFA 1XJ4A 4BBVA 4GOGA 2Y2NA 1N9NA 3HBRA 4X69A 1DP6A 1NRJA 2PYPA 4K91A 1KVMA 2WAFA 2QPNA 4A5RA 2P9VB 4MMNA 3ZDJA 1T19A 1OMEA 3HL9A 5EOEA 2HJEA 1G68A 5FI7A 1WYBA 5EUAA 3BRMA 2HP5A 2DNSA 1Z09A 3NHQA 3AGEA 1GSWA 2R9XA 3TRCA 3DWKA 1WE4A 1KGFA 1GHMA 3HJKA 2QKPA 2LB9A 3WS5A 2OSUA 2ZMVA 5DF8A 4QHCA 3Q07A 2J3TD 1XP4A 2D02A 3EQVA 2L1MA 4R3AA 4KZ8A 3T1XA 4B9OA 2XQZA 4XUZA 4P6BA 2PBDP 4N1XA 2PD7A 1DP8A 2P04A 1GHIA 5L2FA 1VM1A 2ZOIA 1V9YA 2JC7A 4DDYA 1FIKA 5E2GA 4I39A 3T4QA 5JYOA 5LBRA 4NG2A 2EX2A 4GS9A 3DW0A 5GHYA 3BYDA 3DTEA 3VOZA 5FQQA 2ZC6B 3V3SA 5EVIA 4BBTA 5HDCA 1PI5A 5BOHA 5FQKA 3ZG9B 5G18A 1CI8A 3A0VA 2OAQ1 3MXSA 1Y28A 4R3JA 5KSCA 1G28A 5F69A 2H5SA 1ZHHB 4HJ6A 1K4EA 1C3BA 3GECA 1LL5A 2IA2A 3FC7A 4MN5A 4C75A 3G4PA 1XXMA 3SS4A 2J9OA 1TS0A 3RXXA 1P9WA 5CHUA 3NIAA 4H6JA 4Y2FA 5I5LA 1J9MA 2ZQDA 3LY4A 5EM0A 4X56A 5EVID 2WKPA 3N4IA 2XFTA 4R4SA 1GA0A 5J4EA 4I5SA 2QJ5A 4QD4A 3UDXA 3DAVA 1PWGA 1F98A 2P7JA 1PWDA 3LR3A 1HLUP 4QPRA 2Q0OA 1KE0A 1K54A 3OCNA 4OPYA 4GLQA 1XA7A 3AGFA 4WEJA 4PPRA 3M2JA 2OWJA 2A24A 2ZM0A 3MZFA 2VA0A 3OPPA 1ODVA 1OTBA 3Q1FA 3UPOA 4OQGA 3D3OA 1LL9A 2HJ9C 4Y3IA 5E43A 3PAEA 3F1OB 1IOUA 4ZDXA 1UWNX 1H5XA 5FQIA 2EFUA 3JPUA 1T1CA 3VP4A 5GHZA 5HDDA 4HBTA 3I7JA 3VSKA 2BG1A 2Y91A 4B4XA 3TJZC 2PT7A 4OQ0A 2VV8A 3A3IA 3CITA 4LFUA 2W1RA 3UE3A 4YOFA 4NXBA 2VKSA 4IUHA 4FD8A 1PFLA 2XDMA 2KDKA 3R7WA 4P85A 1NWZA 3UDIA 5F68A 3TW8A 2P08A 3EWKA 5DF9A 5HWVA 1F5MA 3BFFA 4DXCA 3G34A 4Y5FA 4O01A 1S0WA 3MJQA 4KQQA 4BL3A 2ZMFA 2H10A 2JKRI 2FH5A 3NOUC 3ISGA 3CZDA 2ZMAA 2JE5A 3O3VA 1KE4A 3RJUA 1MY8A 3KYQA 2GNXA 2H0TA 1MZUA 3PBTA 1CQAA 3Q81A 1W8YA 4BD1A 1PW8A 4R0QA 2Y2GA 1PZOA 4KG6A 2OOLA 4UHUA 2EX6A 2EX9A 3GVBA 3BM6A 2CMNA 2WKEA 4NKPA 2O9AA 4HI4A 3S22A 5HX9A 1JVJA 3ZYTA 3UN7A 3LIBA 2W3GA 1OTDA 4S2NA 5M18A 2OLUA 4U0TA 1XX2A 4KQRA 2X01A 5IHVA 1BLHA 3JVUA 4BL2A 2ZD8A 3ULFA 2ZQCA 1ERMA 4CPKA 1ZC2A 2XA7S 3ZVWA 1OT9A 3T1SA 2HP9A 3MXRA 3GMWA 3ZHHA 3E4PA 4ZJ1A 2UWXA 1DRMA 1V9ZA 1VETA 4MLLA 5E2HA 3EGXC 3HLDA 5HL1A 4P87A 1YLYA 3MZEA 1L0FA 3N8LA 4GCZA 2Z2MB 4X25A 3S1YA 2ZLYA 4Q0JA 1JWVA 5DTSA 4FCFA 4IBRA 2EX8A 3IWOA 4FH4A
chains in the Genus database with same CATH topology
1ES4A 3VP0A 3G32A 3IXBA 4EQIA 3IQAA 4ZJ3A 1MBLA 1GHPA 5FSRA 1NYMA 1W5DA 4MBHA 1TEMA 3O88A 1YT4A 3FWLA 1K57C 2WAEA 5DTKA 1RP5A 3IH8A 2ZC4B 2HP6A 1YMSA 1PZPA 2H0YA 4QU3A 4LENA 2ZQ9A 4JF5A 1TDLA 1GCEA 2VGKA 2Q9NA 1KGGA 4OONA 4P0MA 5KSHA 5CGSA 2Y2JA 2XK1A 5CRFA 1XPBA 3N6IA 3ZG8B 5M19A 1S6RA 4GZBA 3ZNYA 2A49A 2GDNA 4E3KA 1KGEA 2XR0A 3W4OA 3W4QA 4GOGA 1W79A 2Y2NA 1PWCA 1MWSA 4E6WA 3HBRA 1O7EA 3SH7A 1EWZA 4R4RA 4X69A 2WADA 1RGYA 1HTZA 2XF3A 1DJAA 5I94A 4Y0OA 5CTMA 1ALQA 4KZ4A 4F94A 4K91A 3UE1A 2JCHA 5F1GA 1KVMA 4KZAA 2WAFA 2QPNA 2A3UA 2P9VB 4A5RA 4WZ4A 3OC2A 4DE1A 3ZDJA 1OMEA 3A3FA 3HL9A 1K56A 1YM1A 3IT9A 5EOEA 1JWPA 4IBXA 1G68A 4LV3A 5FI7A 1WYBA 1ONHA 3FV7A 5EUAA 5M1AA 3VFHA 2QZ6A 4IVIA 3A3EA 3BRMA 3A3JA 2HP5A 1ZKJA 2DNSA 4KZBA 1AXBA 3WS1A 3AGEA 1BSGA 1XGJA 2V20A 4RX3A 2G2WA 4LCLA 3CG5A 3HLEA 2P9VA 2R9XA 3DWKA 5GLDA 1WE4A 1JWZA 1M6KA 2EXBA 1I5QA 2WGIA 1KGFA 1GHMA 1SDNA 3HLGA 4JXGA 3MFDA 5F82A 1K6SA 3DWZA 3NC8A 3UPPA 1BTLA 2OSUA 1XA1A 4GN2A 3WS5A 1TDGA 5DF8A 3GTCA 2PU2A 4QHCA 3Q07A 5FAOA 1IKIA 1XP4A 1QMFA 1FOFA 1NYYA 4RVAA 1YLPA 1I2SA 3EQVA 3FKVA 3PBRA 5GLCA 4OLDA 1IYOA 4OOMA 1L0DA 3N7WA 4KZ8A 4OVDA 5AQAA 2Y2LA 5HAQA 3OCLA 2XQZA 4D2OA 2G2UA 3WRZA 3GV9A 4XUZA 4P6BA 1CI9A 2X02A 4N1XA 3OPHA 4E3OA 3ITAA 4WEKA 5CGXA 1YMXA 5HAPA 3G30A 1IELA 4U0XA 3G2ZA 1GHIA 3BFCA 5L2FA 1VM1A 3O87A 3EQUA 3VOYA 4GD8A 3ZVTA 2JC7A 4X53A 4DDYA 2HPBA 4S2MA 2XEPA 4JXWA 3E2KA 1JTGA 4PM8A 1PYYA 3BEBA 5E2GA 1BT5A 1FR6A 2IWCA 4L0LA 3VSLA 3ZNTA 4B4ZA 5FI6A 4E6XA 3A3DA 3M6HA 4GNUA 4Y0TA 1SCWA 1NY0A 5EECA 1IYSA 3TG9A 4KZ7A 5JYOA 2ZQAA 1SHVA 5E2EA 4E3IA 1LI9A 2EX2A 2Y59A 1ERQA 4FSFA 5EVIB 3SS3A 3DW0A 1FCOA 5GHYA 3IXDA 4DE3A 3BYDA 2HDRA 4HESA 4ZTKA 5GLAA 4C3QA 5CEDA 3VOZA 2C6WB 5FQQA 1N9BA 4PM9A 2ZC6B 3IF5A 2J9PA 2Y2HA 4X68A 3V3SA 3WS2A 4IVKA 2Y2OA 4JBFA 4K0WA 4OLGA 4RA7A 4JKTA 5EVIA 2IWDA 4BLMA 4DXBA 3SOIA 1PI5A 5BOHA 3SH8A 4FH2A 4E3NA 2IWBA 1TVFA 2XD5A 5FQKA 3ZG9B 3RXWA 5G18A 3VP2A 5F1FA 1CI8A 1Q2QA 3MXSA 1CK3A 2Y2KA 1FR1A 1PI4A 3BFDA 4WELA 5CGWA 4R3JA 2Q9MA 3NI9A 5EVIC 1IKGA 4EV4A 4YFMA 2V2FF 4HEFA 5KSCA 1ESUA 2V1ZA 3FKWA 2DRWA 4KG5A 4EBPA 5HAIA 2WYXA 2H5SA 3GR2A 4MNRA 3OPRA 3AGDA 3FYZA 4PM7A 1NXYA 1K4EA 2ZQ8A 1C3BA 3C7VA 5E2FA 1LL5A 4IEDA 4BENA 3LO7A 1EROA 2OLVA 1MXOA 4RYEA 3TSGA 3W8KA 4C75A 3NCKA 4WBGA 4PM6A 3G4PA 3QNBA 4DDSA 3PBSA 4E3LA 3OPLA 1XXMA 3SS4A 2J9OA 4OPRA 3RXXA 3HLWA 5CHUA 3NIAA 3ZG5A 3HUOA 4QY6A 5KMWA 2C5WB 3PBOA 3IH9A 1J9MA 4X6TA 1K6RA 2ZQDA 3LY4A 1IYPA 4DE0A 4ZBEA 5HARA 1KDSA 2ZC7A 3IXHA 4X56A 5FATA 1KVLA 3IF6B 5CHMA 5EVID 3GRJA 2E8IA 4WZ5A 5AQ7A 1PIOA 4OP8A 3N4IA 4JF6A 1ES5A 2XFTA 5A92A 2Y2MA 1LHYA 4MEZA 4N9KA 4R4SA 1NJ4A 1GA0A 4S2PA 4MBFA 5FAQA 3MZDA 2Y4AA 1Y54A 4QD4A 3UO9A 3ITBA 3P09A 3UDXA 5D3OA 1PWGA 2EFXA 1PWDA 2J8YA 4S2JA 1K55A 1NZUA 1MWUA 4KG2A 1W7FA 2XH9A 3UDFA 4S2LA 1Q2PA 2Y2QA 3N8RA 2FFFB 1KE0A 3IXGA 4WM9A 4WMCA 3IF6A 3Q82A 1K54A 4WZ5C 5TFQA 3OCNA 3ZG7B 4OPYA 5TGFA 2HDQA 1XA7A 4KZ6A 3UPNA 1MWRA 3AGFA 3HREA 4WEJA 5GLBA 4PPRA 4LCMA 3M2JA 1BZAA 4KQOA 5DTTA 2ZM0A 3MZFA 1K55C 4B88A 3LY3A 3OPPA 1XKZA 5DVAA 3UE0A 3D4FA 3VMAA 4N9LA 3GSGA 2WGVA 3Q1FA 5EPHA 5TR7A 5CECA 4KZ9A 3UPOA 1VQQA 4HBUA 1FQGA 4OQGA 1K25A 1LL9A 5FQ9A 4KZ3A 2VGJA 4UA9A 2XD1A 3HLBA 5E43A 3PAEA 1ONGA 3V5MA 4QJGA 3Q7VB 4PM5A 3MKFA 3MBZA 4XUXA 1ES3A 4JXVA 4JF4A 2Y55A 4BQMA 4ZDXA 1HZOA 3C4PA 1KE3A 2WGWB 1H5XA 5CERA 5FQIA 2EFUA 4QY5A 4LV2A 4Q8IA 4UAAA 3WWXA 4WYYA 3VP4A 1NRFA 5GHZA 1FSWA 4HBTA 3I7JA 3HVFA 3VSKA 2BG1A 4ZJ2A 3NDGA 4DF6A 1L2SA 2Y91A 1DJBA 4B4XA 3V39A 3Q7VA 3PBQA 3QNCA 3WS4A 2WZXA 2ZC3B 3PTEA 4DRTA 3ZGAB 4OPQA 1YLTA 5KZHA 4WMCD 2WGWA 4OQ0A 1YLJA 1H8YA 2Y2PA 4KENB 3BECA 3A3IA 1MPLA 3OZHA 2R9WA 3W4PA 3Q7ZA 1YQSA 3CMZA 3UE3A 3BLSA 1LLBA 3NY4A 4R1GA 1Z6FA 4BJPA 1IEMA 2JBFA 2WUQA 4FD8A 4U3TA 4UA6A 1FCNA 3SS5A 2XDMA 1MWTA 5J8XA 1G6AA 3UY6A 4P85A 5EOOA 3WS0A 3UDIA 3IHAA 2QMIA 1N4OA 2PBYA 2WK0A 3GQZA 3N8SA 2RCXA 3BFGA 3E2LA 3WRTA 4C6YA 2XGNA 1BUEA 3JYIA 1I2WA 3C7UA 1E4DA 5DF9A 1JTDA 4Y7PA 4Y0UA 3BFFA 1BLCA 3IWQA 4DXCA 2ZC5B 3G34A 1HD8A 3ZFZA 2BLSA 3PAGA 4UA7A 1S0WA 4EBNA 1CEGA 4KQQA 3O86A 1QMEA 4BL3A 4KZ5A 1DJCA 2H10A 4EWFA 1MKIA 1CEFA 1W8QA 1L0EA 2WKIA 5FDHA 1LI0A 3ISGA 2J7VA 5HFOA 3CZDA 4OQIA 2ZJ9A 4BD0A 2ZMAA 2JE5A 2B5RA 5F83A 1K38A 5JYPA 3M2KA 3CJMA 4JPMA 3O3VA 3M6BA 1KE4A 3RJUA 2OV5A 1MY8A 5EVLA 1L0GA 1YLZA 2H0TA 3PBTA 1BLPA 1ZG4A 4E3MA 4CJNA 4EBLA 2ZM2A 1O07A 3VP3A 2Z2LB 1HVBA 4LV1A 3ZG0A 3Q81A 1W8YA 2XFSA 4S2OA 4BD1A 1K4FA 1PW8A 3MKEA 4N1HA 4R0QA 5HW3A 2RL3A 1YLWA 2EXAA 2Y2GA 3UNWA 1PZOA 4KG6A 2HDUA 3HLFA 4UHUA 5AQBA 2EX6A 3NBLA 3V3RA 5CHJA 5EE8A 3V50A 5FASA 2EX9A 3GVBA 2XLNA 3BM6A 5AQ9A 1E3UA 2X71A 4OKPA 4YINA 4RX2A 1BLSA 3HLCA 2WKEA 2FFYA 1IYQA 2PU4A 5FQMA 4XXRA 5A91A 4JXSA 5A93A 3S22A 1RGZA 5CXWA 4MBKA 5HX9A 3QHYA 4EUZA 2CC1A 1JVJA 3UN7A 4GD6A 2ZQ7A 4S2NA 3DTMA 3PBNA 4GKUA 1WYCA 1SKFA 1ES2A 3P98A 4DKIA 5M18A 3BLMA 4OOLA 2OLUA 4U0TA 1GA9A 1XX2A 4X55A 5CTNA 4M3KA 3NDEA 2DCFA 3HUMA 3IF6C 1K54C 2ZM8A 4KQRA 4N92A 2X01A 3G31A 3VP1A 2WZZA 5FA7A 4R23A 1RCJA 5IHVA 4GDBA 2P74A 1H8ZA 1BLHA 4OH0A 4R3BA 4BL2A 2ZD8A 4Z9QA 3SH9A 5FAPA 1KDWA 3FZCA 4S2NC 1NZOA 2ZQCA 1ERMA 5GHXA 4CPKA 5CEBA 1ZC2A 1ZG6A 3BFEA 3ZVWA 5DF7A 1M40A 4E3JA 2HP9A 2Y2IA 3MXRA 4OOYA 2WKHA 3LEZA 1XGIA 3GMWA 4GB7A 3VFFA 1ESIA 5FI2A 3C5AA 3ZHHA 4ID4A 4ZJ1A 2UWXA 4LV0A 1U60A 4MLLA 4JLFA 5E2HA 1K56D 3HUNA 3HLDA 4S2KA 1FSYA 1E3UD 5HL1A 4P87A 1YLYA 1E25A 1DY6A 3TOIA 3MZEA 1L0FA 3N8LA 1EI5A 4NETA 4GDNA 5A90A 2Z2MB 5U47A 4H8RA 4NK3A 2ZLYA 3S1YA 3S4XA 3ZCZA 2HDSA 3B3XA 3IWIA 4O7DA 4DE2A 1JWVA 4OP5A 1PW1A 1SDEA 5DTSA 3G35A 5FQJA 4OQHA 3LCEA 2I72A 1FCMA 3C4OA 4S2IA 4OPZA 4ZAMA 4FCFA 3G2YA 4PMAA 3IHBA 1K57A 5GL9A 4K0XA 1BULA 4IBRA 2EX8A 4QB8A 3IWOA 4FH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ES4 A;  3VP0 A;  3G32 A;  3IXB A;  4EQI A;  3IQA A;  4ZJ3 A;  1MBL A;  1GHP A;  5FSR A;  1NYM A;  1W5D A;  4MBH A;  1TEM A;  3O88 A;  1YT4 A;  3FWL A;  1K57 C;  2WAE A;  5DTK A;  1RP5 A;  3IH8 A;  2ZC4 B;  2HP6 A;  1YMS A;  1PZP A;  2H0Y A;  4QU3 A;  4LEN A;  2ZQ9 A;  4JF5 A;  1TDL A;  1GCE A;  2VGK A;  2Q9N A;  1KGG A;  4OON A;  4P0M A;  5KSH A;  5CGS A;  2Y2J A;  2XK1 A;  5CRF A;  1XPB A;  3N6I A;  3ZG8 B;  5M19 A;  1S6R A;  4GZB A;  3ZNY A;  2A49 A;  2GDN A;  4E3K A;  1KGE A;  2XR0 A;  3W4O A;  3W4Q A;  4GOG A;  1W79 A;  2Y2N A;  1PWC A;  1MWS A;  4E6W A;  3HBR A;  1O7E A;  3SH7 A;  1EWZ A;  4R4R A;  4X69 A;  2WAD A;  1RGY A;  1HTZ A;  2XF3 A;  1DJA A;  5I94 A;  4Y0O A;  5CTM A;  1ALQ A;  4KZ4 A;  4F94 A;  4K91 A;  3UE1 A;  2JCH A;  5F1G A;  1KVM A;  4KZA A;  2WAF A;  2QPN A;  2A3U A;  2P9V B;  4A5R A;  4WZ4 A;  3OC2 A;  4DE1 A;  3ZDJ A;  1OME A;  3A3F A;  3HL9 A;  1K56 A;  1YM1 A;  3IT9 A;  5EOE A;  1JWP A;  4IBX A;  1G68 A;  4LV3 A;  5FI7 A;  1WYB A;  1ONH A;  3FV7 A;  5EUA A;  5M1A A;  3VFH A;  2QZ6 A;  4IVI A;  3A3E A;  3BRM A;  3A3J A;  2HP5 A;  1ZKJ A;  2DNS A;  4KZB A;  1AXB A;  3WS1 A;  3AGE A;  1BSG A;  1XGJ A;  2V20 A;  4RX3 A;  2G2W A;  4LCL A;  3CG5 A;  3HLE A;  2P9V A;  2R9X A;  3DWK A;  5GLD A;  1WE4 A;  1JWZ A;  1M6K A;  2EXB A;  1I5Q A;  2WGI A;  1KGF A;  1GHM A;  1SDN A;  3HLG A;  4JXG A;  3MFD A;  5F82 A;  1K6S A;  3DWZ A;  3NC8 A;  3UPP A;  1BTL A;  2OSU A;  1XA1 A;  4GN2 A;  3WS5 A;  1TDG A;  5DF8 A;  3GTC A;  2PU2 A;  4QHC A;  3Q07 A;  5FAO A;  1IKI A;  1XP4 A;  1QMF A;  1FOF A;  1NYY A;  4RVA A;  1YLP A;  1I2S A;  3EQV A;  3FKV A;  3PBR A;  5GLC A;  4OLD A;  1IYO A;  4OOM A;  1L0D A;  3N7W A;  4KZ8 A;  4OVD A;  5AQA A;  2Y2L A;  5HAQ A;  3OCL A;  2XQZ A;  4D2O A;  2G2U A;  3WRZ A;  3GV9 A;  4XUZ A;  4P6B A;  1CI9 A;  2X02 A;  4N1X A;  3OPH A;  4E3O A;  3ITA A;  4WEK A;  5CGX A;  1YMX A;  5HAP A;  3G30 A;  1IEL A;  4U0X A;  3G2Z A;  1GHI A;  3BFC A;  5L2F A;  1VM1 A;  3O87 A;  3EQU A;  3VOY A;  4GD8 A;  3ZVT A;  2JC7 A;  4X53 A;  4DDY A;  2HPB A;  4S2M A;  2XEP A;  4JXW A;  3E2K A;  1JTG A;  4PM8 A;  1PYY A;  3BEB A;  5E2G A;  1BT5 A;  1FR6 A;  2IWC A;  4L0L A;  3VSL A;  3ZNT A;  4B4Z A;  5FI6 A;  4E6X A;  3A3D A;  3M6H A;  4GNU A;  4Y0T A;  1SCW A;  1NY0 A;  5EEC A;  1IYS A;  3TG9 A;  4KZ7 A;  5JYO A;  2ZQA A;  1SHV A;  5E2E A;  4E3I A;  1LI9 A;  2EX2 A;  2Y59 A;  1ERQ A;  4FSF A;  5EVI B;  3SS3 A;  3DW0 A;  1FCO A;  5GHY A;  3IXD A;  4DE3 A;  3BYD A;  2HDR A;  4HES A;  4ZTK A;  5GLA A;  4C3Q A;  5CED A;  3VOZ A;  2C6W B;  5FQQ A;  1N9B A;  4PM9 A;  2ZC6 B;  3IF5 A;  2J9P A;  2Y2H A;  4X68 A;  3V3S A;  3WS2 A;  4IVK A;  2Y2O A;  4JBF A;  4K0W A;  4OLG A;  4RA7 A;  4JKT A;  5EVI A;  2IWD A;  4BLM A;  4DXB A;  3SOI A;  1PI5 A;  5BOH A;  3SH8 A;  4FH2 A;  4E3N A;  2IWB A;  1TVF A;  2XD5 A;  5FQK A;  3ZG9 B;  3RXW A;  5G18 A;  3VP2 A;  5F1F A;  1CI8 A;  1Q2Q A;  3MXS A;  1CK3 A;  2Y2K A;  1FR1 A;  1PI4 A;  3BFD A;  4WEL A;  5CGW A;  4R3J A;  2Q9M A;  3NI9 A;  5EVI C;  1IKG A;  4EV4 A;  4YFM A;  2V2F F;  4HEF A;  5KSC A;  1ESU A;  2V1Z A;  3FKW A;  2DRW A;  4KG5 A;  4EBP A;  5HAI A;  2WYX A;  2H5S A;  3GR2 A;  4MNR A;  3OPR A;  3AGD A;  3FYZ A;  4PM7 A;  1NXY A;  1K4E A;  2ZQ8 A;  1C3B A;  3C7V A;  5E2F A;  1LL5 A;  4IED A;  4BEN A;  3LO7 A;  1ERO A;  2OLV A;  1MXO A;  4RYE A;  3TSG A;  3W8K A;  4C75 A;  3NCK A;  4WBG A;  4PM6 A;  3G4P A;  3QNB A;  4DDS A;  3PBS A;  4E3L A;  3OPL A;  1XXM A;  3SS4 A;  2J9O A;  4OPR A;  3RXX A;  3HLW A;  5CHU A;  3NIA A;  3ZG5 A;  3HUO A;  4QY6 A;  5KMW A;  2C5W B;  3PBO A;  3IH9 A;  1J9M A;  4X6T A;  1K6R A;  2ZQD A;  3LY4 A;  1IYP A;  4DE0 A;  4ZBE A;  5HAR A;  1KDS A;  2ZC7 A;  3IXH A;  4X56 A;  5FAT A;  1KVL A;  3IF6 B;  5CHM A;  5EVI D;  3GRJ A;  2E8I A;  4WZ5 A;  5AQ7 A;  1PIO A;  4OP8 A;  3N4I A;  4JF6 A;  1ES5 A;  2XFT A;  5A92 A;  2Y2M A;  1LHY A;  4MEZ A;  4N9K A;  4R4S A;  1NJ4 A;  1GA0 A;  4S2P A;  4MBF A;  5FAQ A;  3MZD A;  2Y4A A;  1Y54 A;  4QD4 A;  3UO9 A;  3ITB A;  3P09 A;  3UDX A;  5D3O A;  1PWG A;  2EFX A;  1PWD A;  2J8Y A;  4S2J A;  1K55 A;  1NZU A;  1MWU A;  4KG2 A;  1W7F A;  2XH9 A;  3UDF A;  4S2L A;  1Q2P A;  2Y2Q A;  3N8R A;  2FFF B;  1KE0 A;  3IXG A;  4WM9 A;  4WMC A;  3IF6 A;  3Q82 A;  1K54 A;  4WZ5 C;  5TFQ A;  3OCN A;  3ZG7 B;  4OPY A;  5TGF A;  2HDQ A;  1XA7 A;  4KZ6 A;  3UPN A;  1MWR A;  3AGF A;  3HRE A;  4WEJ A;  5GLB A;  4PPR A;  4LCM A;  3M2J A;  1BZA A;  4KQO A;  5DTT A;  2ZM0 A;  3MZF A;  1K55 C;  4B88 A;  3LY3 A;  3OPP A;  1XKZ A;  5DVA A;  3UE0 A;  3D4F A;  3VMA A;  4N9L A;  3GSG A;  2WGV A;  3Q1F A;  5EPH A;  5TR7 A;  5CEC A;  4KZ9 A;  3UPO A;  1VQQ A;  4HBU A;  1FQG A;  4OQG A;  1K25 A;  1LL9 A;  5FQ9 A;  4KZ3 A;  2VGJ A;  4UA9 A;  2XD1 A;  3HLB A;  5E43 A;  3PAE A;  1ONG A;  3V5M A;  4QJG A;  3Q7V B;  4PM5 A;  3MKF A;  3MBZ A;  4XUX A;  1ES3 A;  4JXV A;  4JF4 A;  2Y55 A;  4BQM A;  4ZDX A;  1HZO A;  3C4P A;  1KE3 A;  2WGW B;  1H5X A;  5CER A;  5FQI A;  2EFU A;  4QY5 A;  4LV2 A;  4Q8I A;  4UAA A;  3WWX A;  4WYY A;  3VP4 A;  1NRF A;  5GHZ A;  1FSW A;  4HBT A;  3I7J A;  3HVF A;  3VSK A;  2BG1 A;  4ZJ2 A;  3NDG A;  4DF6 A;  1L2S A;  2Y91 A;  1DJB A;  4B4X A;  3V39 A;  3Q7V A;  3PBQ A;  3QNC A;  3WS4 A;  2WZX A;  2ZC3 B;  3PTE A;  4DRT A;  3ZGA B;  4OPQ A;  1YLT A;  5KZH A;  4WMC D;  2WGW A;  4OQ0 A;  1YLJ A;  1H8Y A;  2Y2P A;  4KEN B;  3BEC A;  3A3I A;  1MPL A;  3OZH A;  2R9W A;  3W4P A;  3Q7Z A;  1YQS A;  3CMZ A;  3UE3 A;  3BLS A;  1LLB A;  3NY4 A;  4R1G A;  1Z6F A;  4BJP A;  1IEM A;  2JBF A;  2WUQ A;  4FD8 A;  4U3T A;  4UA6 A;  1FCN A;  3SS5 A;  2XDM A;  1MWT A;  5J8X A;  1G6A A;  3UY6 A;  4P85 A;  5EOO A;  3WS0 A;  3UDI A;  3IHA A;  2QMI A;  1N4O A;  2PBY A;  2WK0 A;  3GQZ A;  3N8S A;  2RCX A;  3BFG A;  3E2L A;  3WRT A;  4C6Y A;  2XGN A;  1BUE A;  3JYI A;  1I2W A;  3C7U A;  1E4D A;  5DF9 A;  1JTD A;  4Y7P A;  4Y0U A;  3BFF A;  1BLC A;  3IWQ A;  4DXC A;  2ZC5 B;  3G34 A;  1HD8 A;  3ZFZ A;  2BLS A;  3PAG A;  4UA7 A;  1S0W A;  4EBN A;  1CEG A;  4KQQ A;  3O86 A;  1QME A;  4BL3 A;  4KZ5 A;  1DJC A;  2H10 A;  4EWF A;  1MKI A;  1CEF A;  1W8Q A;  1L0E A;  2WKI A;  5FDH A;  1LI0 A;  3ISG A;  2J7V A;  5HFO A;  3CZD A;  4OQI A;  2ZJ9 A;  4BD0 A;  2ZMA A;  2JE5 A;  2B5R A;  5F83 A;  1K38 A;  5JYP A;  3M2K A;  3CJM A;  4JPM A;  3O3V A;  3M6B A;  1KE4 A;  3RJU A;  2OV5 A;  1MY8 A;  5EVL A;  1L0G A;  1YLZ A;  2H0T A;  3PBT A;  1BLP A;  1ZG4 A;  4E3M A;  4CJN A;  4EBL A;  2ZM2 A;  1O07 A;  3VP3 A;  2Z2L B;  1HVB A;  4LV1 A;  3ZG0 A;  3Q81 A;  1W8Y A;  2XFS A;  4S2O A;  4BD1 A;  1K4F A;  1PW8 A;  3MKE A;  4N1H A;  4R0Q A;  5HW3 A;  2RL3 A;  1YLW A;  2EXA A;  2Y2G A;  3UNW A;  1PZO A;  4KG6 A;  2HDU A;  3HLF A;  4UHU A;  5AQB A;  2EX6 A;  3NBL A;  3V3R A;  5CHJ A;  5EE8 A;  3V50 A;  5FAS A;  2EX9 A;  3GVB A;  2XLN A;  3BM6 A;  5AQ9 A;  1E3U A;  2X71 A;  4OKP A;  4YIN A;  4RX2 A;  1BLS A;  3HLC A;  2WKE A;  2FFY A;  1IYQ A;  2PU4 A;  5FQM A;  4XXR A;  5A91 A;  4JXS A;  5A93 A;  3S22 A;  1RGZ A;  5CXW A;  4MBK A;  5HX9 A;  3QHY A;  4EUZ A;  2CC1 A;  1JVJ A;  3UN7 A;  4GD6 A;  2ZQ7 A;  4S2N A;  3DTM A;  3PBN A;  4GKU A;  1WYC A;  1SKF A;  1ES2 A;  3P98 A;  4DKI A;  5M18 A;  3BLM A;  4OOL A;  2OLU A;  4U0T A;  1GA9 A;  1XX2 A;  4X55 A;  5CTN A;  4M3K A;  3NDE A;  2DCF A;  3HUM A;  3IF6 C;  1K54 C;  2ZM8 A;  4KQR A;  4N92 A;  2X01 A;  3G31 A;  3VP1 A;  2WZZ A;  5FA7 A;  4R23 A;  1RCJ A;  5IHV A;  4GDB A;  2P74 A;  1H8Z A;  1BLH A;  4OH0 A;  4R3B A;  4BL2 A;  2ZD8 A;  4Z9Q A;  3SH9 A;  5FAP A;  1KDW A;  3FZC A;  4S2N C;  1NZO A;  2ZQC A;  1ERM A;  5GHX A;  4CPK A;  5CEB A;  1ZC2 A;  1ZG6 A;  3BFE A;  3ZVW A;  5DF7 A;  1M40 A;  4E3J A;  2HP9 A;  2Y2I A;  3MXR A;  4OOY A;  2WKH A;  3LEZ A;  1XGI A;  3GMW A;  4GB7 A;  3VFF A;  1ESI A;  5FI2 A;  3C5A A;  3ZHH A;  4ID4 A;  4ZJ1 A;  2UWX A;  4LV0 A;  1U60 A;  4MLL A;  4JLF A;  5E2H A;  1K56 D;  3HUN A;  3HLD A;  4S2K A;  1FSY A;  1E3U D;  5HL1 A;  4P87 A;  1YLY A;  1E25 A;  1DY6 A;  3TOI A;  3MZE A;  1L0F A;  3N8L A;  1EI5 A;  4NET A;  4GDN A;  5A90 A;  2Z2M B;  5U47 A;  4H8R A;  4NK3 A;  2ZLY A;  3S1Y A;  3S4X A;  3ZCZ A;  2HDS A;  3B3X A;  3IWI A;  4O7D A;  4DE2 A;  1JWV A;  4OP5 A;  1PW1 A;  1SDE A;  5DTS A;  3G35 A;  5FQJ A;  4OQH A;  3LCE A;  2I72 A;  1FCM A;  3C4O A;  4S2I A;  4OPZ A;  4ZAM A;  4FCF A;  3G2Y A;  4PMA A;  3IHB A;  1K57 A;  5GL9 A;  4K0X A;  1BUL A;  4IBR A;  2EX8 A;  4QB8 A;  3IWO A;  4FH4 A; 
#chains in the Genus database with same CATH topology
 3G32 A;  1GHP A;  1W5D A;  1K57 C;  2WAE A;  1PNE A;  2HP6 A;  3UB9 A;  2KLI A;  4QU3 A;  4LEN A;  1TDL A;  5F6A A;  1KGG A;  2XK1 A;  5CRF A;  3ZG8 B;  1S6R A;  3T4O A;  2A49 A;  2GDN A;  2XR0 A;  1YPR A;  3KX0 X;  3P7N A;  1ZTU A;  4X1L A;  1PWC A;  1UGU A;  4E6W A;  1O7E A;  4Q0I A;  3BQ8 A;  3IBJ A;  5DJU A;  1EWZ A;  2WAD A;  2XF3 A;  1HTZ A;  4Y0O A;  2QWS A;  5FEF A;  3UE1 A;  5F1G A;  2L0W A;  2A3U A;  3OC2 A;  1N9O A;  3T1R A;  1K56 A;  1YM1 A;  1ONH A;  3FV7 A;  3VFH A;  4X1M A;  4CLC C;  4RX3 A;  1YSP A;  2G2W A;  1OJ5 A;  3HLE A;  2P9V A;  2Y79 A;  3HLG A;  2WGI A;  1K6S A;  3DWZ A;  1BTL A;  5AVE A;  3K2N A;  3GTC A;  3R4K A;  1IKI A;  1FOF A;  3NUL A;  4RVA A;  1I2S A;  3FKV A;  5GLC A;  1IYO A;  1L0D A;  3N7W A;  3OCL A;  3WRZ A;  3GV9 A;  2PRF A;  3ITA A;  2V9A A;  1YMX A;  3G30 A;  2JKG A;  4U0X A;  3KYZ A;  3O87 A;  2JKR M;  3EQU A;  3ZVT A;  4X53 A;  2HPB A;  2XEP A;  3E2K A;  4PM8 A;  1BT5 A;  2IWC A;  4E6X A;  3A3D A;  3M6H A;  1EW0 A;  5EEC A;  3TG9 A;  4KZ7 A;  1LI9 A;  2Y59 A;  1FCO A;  4DE3 A;  2HGV A;  4HES A;  2B18 A;  4ZTK A;  3VE4 A;  5GLA A;  4C3Q A;  2KX6 A;  4I38 A;  5A8B A;  1N9B A;  1S67 L;  3IF5 A;  3PR6 A;  5C5K A;  4BLM A;  3SH8 A;  4FH2 A;  1TVF A;  2XD5 A;  1P9R A;  3VE3 A;  2V0U A;  1IFQ A;  1Q2Q A;  4WEL A;  5CGW A;  3W2Z A;  3QP5 A;  3NI9 A;  3CAX A;  1D7E A;  4YFM A;  2DRW A;  5HAI A;  3GR2 A;  2O99 A;  3C7V A;  1ERO A;  2OLV A;  4II7 A;  4RYE A;  3NCK A;  4MDZ A;  4E3L A;  2D01 A;  5FDS A;  2O9C A;  3HLW A;  3BW6 A;  3P01 A;  4R6L A;  4QY6 A;  5KMW A;  4R38 A;  2C5W B;  3IH9 A;  3T4L A;  4LRZ E;  2XRO A;  4MCW A;  1IYP A;  4DE0 A;  5HAR A;  1KDS A;  2ZC7 A;  3IXH A;  3LID A;  4ME4 A;  2E8I A;  5AQ7 A;  2K31 A;  2Y2M A;  5A92 A;  1NJ4 A;  1Y54 A;  3UO9 A;  3ITB A;  5D3O A;  2EFX A;  4ETX A;  4BMW A;  1K55 A;  2XA7 M;  1NZU A;  1MWU A;  4LPZ A;  3CUE C;  3UDF A;  1Q2P A;  3N8R A;  4WMC A;  3Q82 A;  4WZ5 C;  1YAX A;  4KUO A;  5TGF A;  4Y17 A;  5F5Y A;  5EV0 A;  3HRE A;  3QP6 A;  4LCM A;  3LY3 A;  5DVA A;  3UE0 A;  2INW A;  2H28 A;  3GSG A;  3MF0 A;  1VQQ A;  2VGL S;  3T1Q B;  2VGJ A;  3U2A A;  5L09 A;  2V1B A;  3Q7V B;  5L07 A;  2VEA A;  4JF4 A;  2Y55 A;  4BQM A;  4JGP A;  1HZO A;  3C4P A;  1KE3 A;  2AVX A;  2WGW B;  1GSV A;  4HOI A;  1NRF A;  2OWH A;  3NDG A;  4DF6 A;  1L2S A;  2PR5 A;  3V39 A;  3PBQ A;  3F1O A;  3OBF A;  1S4R A;  4DRT A;  1XJ6 A;  3UB5 P;  5KZH A;  4WMC D;  4HJ4 A;  3NEC A;  1H8Y A;  5HWW A;  3OZH A;  1AWI A;  3Q7Z A;  4EEP A;  4R1G A;  1Z6F A;  4BJP A;  1XFN A;  2JBF A;  1DP9 A;  1MWT A;  3LIF A;  5EOO A;  3IHA A;  3N8S A;  2RCX A;  3BFG A;  3L7H A;  1BUE A;  1TS6 A;  1E4D A;  5EM1 A;  1JTD A;  4Y7P A;  3IWQ A;  3LI9 A;  2BLS A;  3PAG A;  5J3W A;  4NEE D;  1CEG A;  1XJ2 A;  3O86 A;  1CJF A;  2ZL1 B;  4EET B;  1QME A;  3V67 A;  1MKI A;  5HPI A;  1STZ A;  1L0E A;  5HFO A;  4OQI A;  3T4T A;  5F83 A;  5JYP A;  3CJM A;  4JPM A;  3M6B A;  5EVL A;  1X0O A;  3L9K A;  4O0P A;  1BLP A;  1ZG4 A;  4E3M A;  4CJN A;  4EBL A;  3VP3 A;  5MC7 A;  2Z2L B;  1HVB A;  4LV1 A;  1OT6 A;  3ZG0 A;  2XFS A;  2OAP 1;  4N1H A;  1A0K A;  1YLW A;  2EXA A;  4HP9 A;  2HDU A;  3HLF A;  2PD8 A;  5AQB A;  2EWW A;  5CHJ A;  5EE8 A;  3VV4 A;  2XLN A;  3K3C A;  1E3U A;  2X71 A;  5DKL A;  4XXR A;  4EUZ A;  3KO6 A;  4DN0 A;  2ZQ7 A;  3DTM A;  3PBN A;  4GKU A;  1WYC A;  5FI6 A;  4HH3 A;  2DCF A;  4N92 A;  4I3I A;  2WZZ A;  4IHQ A;  1RCJ A;  2LB5 A;  3SW1 A;  1XFQ A;  3FZC A;  2QHK A;  5GHX A;  3MMH A;  1ZG6 A;  3EEA A;  1XGI A;  3VFF A;  5FI2 A;  3C8C A;  4WF0 A;  1UWP X;  2XSS A;  3HUN A;  3RFB A;  1F2K A;  1E3U D;  3C2W A;  2XRN A;  1EI5 A;  4NET A;  4NK3 A;  4DE2 A;  1LSW A;  4LLO B;  3C4O A;  5AJG A;  3G2Y A;  4PMA A;  2YKH A;  5DFY A;  3VP0 A;  4FOF A;  3IQA A;  3O88 A;  3IH8 A;  4F3L A;  4JGQ A;  4DJ2 A;  2O0Y A;  4JF5 A;  4WLA A;  1GCE A;  2VGK A;  3QP8 A;  4G3V A;  4P0M A;  5CGS A;  2G7U A;  5M19 A;  4GZB A;  4HHD A;  3ZNY A;  4K08 A;  4CLC B;  5HPF A;  4E3K A;  4NXG A;  4EES A;  5TJJ A;  1RGY A;  3H7W B;  2HV1 A;  1OJG A;  1DJA A;  2V8C A;  5I94 A;  2J3T C;  5CTM A;  4F94 A;  3RTY A;  2JCH A;  2KOI A;  4KZA A;  3IX4 A;  3A3F A;  4IJG A;  3IT9 A;  1JWP A;  4IBX A;  2FZ0 A;  2W1T B;  3A3J A;  4KZB A;  3WS1 A;  1WA9 A;  2V20 A;  2GJ3 A;  4LCL A;  3CG5 A;  4L9F A;  1L3L A;  1JWZ A;  4M4X A;  2O9B A;  1I5Q A;  4JXG A;  1SDN A;  4P6Z S;  4WUJ A;  4LRY C;  5F82 A;  1XA1 A;  1TDG A;  4BBU A;  2PU2 A;  1H0M A;  1YLP A;  3PBR A;  1W63 M;  4OOM A;  4OVD A;  2Y2L A;  2X02 A;  4YNR A;  4L9E A;  1VB6 A;  2M7U A;  3UB6 A;  1OTA A;  3EOI A;  4JGO A;  4WEK A;  5CGX A;  3BFC A;  3VOY A;  4GD8 A;  5L10 A;  1S1Z A;  3FPV A;  4JXW A;  1JTG A;  2Z6C A;  1JNU A;  4LRX C;  4B4Z A;  4L0L A;  1FR6 A;  2W3E A;  3CI6 A;  4Y0T A;  1SCW A;  1NY0 A;  2M7V A;  4I3A A;  2ZQA A;  5E2E A;  4FSF A;  1ERQ A;  2QJ7 A;  3T12 B;  3IXD A;  3MS6 A;  4F3L B;  5CED A;  5FEG A;  4PM9 A;  2J9P A;  3F1N A;  4HIA A;  3U4L P;  4K0W A;  4OLG A;  4XT2 B;  5FL3 A;  1KOU A;  4PAU A;  5HWT A;  2IWB A;  3H82 B;  3RXW A;  3VP2 A;  5IU1 A;  1CK3 A;  1PI4 A;  3BFD A;  4ARZ B;  2Q9M A;  2K7S A;  5EVI C;  4GW9 A;  2V2F F;  4HEF A;  4KG5 A;  4B93 A;  2WYX A;  3UB7 A;  1T18 A;  2YKF A;  1VEU B;  4PM7 A;  1NXY A;  2ZQ8 A;  5E2F A;  2I9V A;  4BEN A;  3LO7 A;  1OTE A;  4GHI B;  1MXO A;  3TSG A;  4WBG A;  2MJ6 A;  5HDS A;  2NUP C;  4OPR A;  3DTK A;  3HUO A;  5L8M A;  1K6R A;  4ZBE A;  5EVE A;  5FAT A;  1KVL A;  3IF6 B;  3LR4 A;  1MKM A;  3HJI A;  4JF6 A;  1ES5 A;  4MEZ A;  5HL6 A;  5FAQ A;  3T4K A;  4S2P A;  4MBF A;  3UE6 A;  3P09 A;  4NXF A;  3ZQ5 A;  4KG2 A;  1W7F A;  2FFF B;  3ZG7 B;  3CWF A;  4R70 A;  2HDQ A;  4KZ6 A;  3S7Q A;  3UPN A;  4LGW A;  5DTT A;  4B88 A;  1XKZ A;  3IX3 A;  4HP4 A;  5EPH A;  5CEC A;  2B02 A;  3SZT A;  5FQ9 A;  4KZ3 A;  4UA9 A;  3MQO A;  1D1J A;  1ONG A;  4PM5 A;  1Y4O A;  3MKF A;  2V1A A;  3MBZ A;  1ES3 A;  5G4Z A;  2NUT C;  5CER A;  3F1N B;  4Q8I A;  2J3W A;  3HVF A;  4ZJ2 A;  4EER A;  3Q7V A;  3QNC A;  3WS4 A;  1TS7 A;  3PTE A;  1YLT A;  2WGW A;  3BQA A;  1YLJ A;  2Y2P A;  2WKR A;  4KEN B;  3BEC A;  2K2N A;  1LT0 A;  3CMZ A;  5HZH A;  3BLS A;  1LLB A;  3NY4 A;  5TBM B;  5CX7 A;  2WUQ A;  4RQ9 A;  1FCN A;  1G6O A;  1G6A A;  3WS0 A;  2VV7 A;  3HCY A;  5J7E A;  2PBY A;  2WK0 A;  4FTX A;  2XGN A;  2L4R A;  4DMZ A;  1BLC A;  1SKO B;  3IS2 B;  4UA7 A;  4HY8 A;  4EBN A;  1CEF A;  2WKI A;  5FDH A;  1LI0 A;  2J7V A;  4MN6 A;  4BD0 A;  1NLZ A;  3LIE A;  4EXO A;  2ZL1 A;  3M2K A;  4P6Z M;  1L0G A;  4BWI A;  1O07 A;  3KSI A;  5DKK A;  1K4F A;  3MKE A;  3UB8 A;  3NBL A;  3V3R A;  1D06 A;  3F1P A;  4OKP A;  1BLS A;  3LIC A;  3HLC A;  1TD5 A;  2FFY A;  1IYQ A;  5FQM A;  4JXS A;  4E04 A;  5A93 A;  1RGZ A;  4MBK A;  4GD6 A;  1P97 A;  4DKI A;  1SKF A;  3P98 A;  3BLM A;  4OOL A;  5CTN A;  1GA9 A;  4X55 A;  4C6Y A;  4M3K A;  4NXE A;  3HUM A;  3IF6 C;  2ZM8 A;  3G31 A;  4R23 A;  2P74 A;  4OH0 A;  5HD3 A;  4R3B A;  1T1B A;  3SH9 A;  4HH2 A;  4S2N C;  5DF7 A;  1H8M A;  4E3J A;  1TS8 A;  2Y2I A;  3T4S A;  2WKH A;  4GB7 A;  3MR0 A;  1ESI A;  3KYE A;  4ID4 A;  4YWZ A;  3A0R A;  2W3D A;  3BWL A;  1J3W A;  1U60 A;  4JLF A;  1FSY A;  1S1Y A;  1E25 A;  1FIL A;  1VHM A;  1OTI A;  5A90 A;  5U47 A;  3ZCZ A;  4O7D A;  2HF6 A;  4EU0 A;  3OOV A;  4OP5 A;  1PW1 A;  5FQJ A;  3LI8 A;  3FPW A;  3LCE A;  4S2I A;  4OPZ A;  4ZAM A;  3IHB A;  1K57 A;  4K0X A;  3JVV A;  2PR6 A;  3T50 A;  3KSH A;  4I3J A;  3S7O A;  2B95 A;  1ES4 A;  3NJA A;  1YKD A;  4Q0H A;  1MBL A;  5FSR A;  1NYM A;  1W63 Q;  1TEM A;  1LSX A;  5DTK A;  4HNB A;  1RP5 A;  3S7P A;  1YMS A;  2ZQ9 A;  3C38 A;  3KSF A;  3E4O A;  4OON A;  1S66 L;  1XPB A;  1G5U A;  1KGE A;  3W4O A;  3W4Q A;  1W79 A;  3NOT C;  4FUW A;  1MWS A;  4Z1W A;  1H3Q A;  3SH7 A;  3F1P B;  4EUV A;  4R4R A;  3A0S A;  2JKT M;  1ALQ A;  4KZ4 A;  3TE8 A;  4CLC A;  3OLO A;  3C30 A;  4DE1 A;  3PHY A;  4WZ4 A;  3QP1 A;  4LV3 A;  3CHW P;  2ACG A;  5M1A A;  2QZ6 A;  4IVI A;  3A3E A;  3H7W A;  4Y15 A;  1ZKJ A;  1AXB A;  2VZW A;  3G6O A;  1BSG A;  1XGJ A;  3LEQ A;  3B42 A;  4PKY A;  3MFX A;  5GLD A;  1K0K A;  1M6K A;  2EXB A;  4QWO A;  3MFD A;  4IUK A;  1BYW A;  3NC8 A;  3UPP A;  4GN2 A;  2W1T A;  5FAO A;  1N9L A;  2A2L A;  1QMF A;  1NYY A;  4OLD A;  5HAQ A;  4HJ3 A;  4UEY A;  5AQA A;  1PRQ A;  4D2O A;  2G2U A;  3EGD C;  1CI9 A;  1YSQ A;  2V0W A;  3OPH A;  4E3O A;  4CLC D;  2J80 A;  5HAP A;  1IEL A;  3G2Z A;  3LR0 A;  4GS9 B;  5G4Y A;  1GSX A;  4EEU A;  3FG8 A;  2GZA A;  4S2M A;  3H9W A;  1PYY A;  5HSQ A;  3BEB A;  3VSL A;  3ZNT A;  4GNU A;  3LR5 A;  4ESP A;  1IYS A;  2DMW A;  1SHV A;  3O5Y A;  4E3I A;  5EVI B;  3SS3 A;  1S4S A;  2HDR A;  3S7N A;  1XJ3 A;  3RH8 B;  1F9I A;  3D72 A;  2C6W B;  4CQH A;  2Y2H A;  4X68 A;  3WS2 A;  4IVK A;  2Y2O A;  4JBF A;  4L9G A;  4RA7 A;  4JKT A;  2IWD A;  4DXB A;  3SOI A;  1CF0 A;  1NLY A;  4E3N A;  3MSH A;  4GJ4 A;  5F1F A;  2Y2K A;  3DTI A;  1FR1 A;  3NOP C;  3T4J A;  2HZ5 A;  4UQI S;  4XT2 A;  1IKG A;  4G3K A;  4EV4 A;  1ESU A;  2V1Z A;  3FKW A;  3KSG A;  4EBP A;  3E0Y A;  4H6J B;  3H82 A;  2M1C A;  4MNR A;  3OPR A;  5K5B A;  3AGD A;  3FYZ A;  4ARZ A;  4IED A;  3W8K A;  4PM6 A;  3QNB A;  4DDS A;  3PBS A;  4O8G A;  3OPL A;  2PHY A;  3VOL A;  3ZG5 A;  3MXQ A;  3PBO A;  2PAV P;  1VEU A;  4X6T A;  1SZV A;  4GHI A;  3CUE A;  3LIA A;  5CHM A;  4WL9 A;  2VGL M;  3GRJ A;  4WZ5 A;  1PIO A;  4OP8 A;  1LHY A;  4N9K A;  2Y8H A;  3MZD A;  2Y4A A;  2A24 B;  2EWV A;  2J8Y A;  4S2J A;  1LSV A;  2XH9 A;  4S2L A;  2Y2Q A;  4EQ1 A;  4WM9 A;  3IXG A;  5TFQ A;  3IF6 A;  1MC0 A;  2R78 A;  1MWR A;  5GLB A;  4KQD A;  4D60 A;  1BZA A;  4KQO A;  4ZRR A;  1K55 C;  3VMA A;  3D4F A;  2PDR A;  4N9L A;  2WGV A;  2VV6 A;  3B47 A;  5TR7 A;  4KZ9 A;  4HBU A;  1FQG A;  2VX8 A;  1K25 A;  2XD1 A;  3HLB A;  3V5M A;  4QJG A;  2VK3 A;  4XUX A;  5DJT A;  4JXV A;  2W27 A;  4QY5 A;  4LV2 A;  4UAA A;  3WWX A;  3BY8 A;  4WYY A;  1FSW A;  5KIZ A;  1DJB A;  2Z6D A;  2WKQ A;  3IX8 A;  2W0N A;  2WZX A;  2ZC3 B;  3ZGA B;  4OPQ A;  3BJN A;  3R7W B;  2W3F A;  3UMD A;  2GX5 A;  2PYR A;  1MPL A;  2R9W A;  3W4P A;  1YQS A;  1LL8 A;  1OPX A;  1IEM A;  3SS5 A;  1TF1 A;  4U3T A;  4UA6 A;  5J8X A;  3UY6 A;  4MN7 A;  2QMI A;  1N4O A;  3GQZ A;  3E2L A;  3WRT A;  4PHT A;  3B33 A;  3LFV A;  1I2W A;  5DFX A;  3C7U A;  3JYI A;  3UME A;  3CLO A;  3CPT A;  5TBM A;  4Y0U A;  4AFI A;  2V8F A;  2ZC5 B;  4G3W A;  1HD8 A;  3ZFZ A;  3MQQ A;  3DBA A;  3LUQ A;  1ACF A;  4KZ5 A;  1DJC A;  4EWF A;  4JGR A;  2E8J A;  5IS1 A;  1W8Q A;  1SKO A;  2ZJ9 A;  3IS2 A;  2B5R A;  1K38 A;  3QP4 A;  2OV5 A;  1YLZ A;  3QP2 A;  3E98 A;  2BTF P;  2ZM2 A;  2UV0 E;  4S2O A;  5HW3 A;  2RL3 A;  4CLC E;  3UNW A;  3V50 A;  5FAS A;  5AQ9 A;  4YIN A;  4RX2 A;  5EFW A;  4WN5 A;  2PU4 A;  4ETZ A;  5A91 A;  5CXW A;  3QHY A;  2CC1 A;  3LYX A;  1ES2 A;  3PYP A;  2JN7 A;  4EW7 A;  2ZOH A;  3NDE A;  3VP1 A;  1K54 C;  5FA7 A;  4GDB A;  1H8Z A;  4Z9Q A;  5FAP A;  1KDW A;  4PKY G;  2JKF A;  3ICY A;  1NZO A;  1VET B;  5CEB A;  3E4Q A;  3BFE A;  1M40 A;  2JKT I;  4OOY A;  2ZBB A;  3LEZ A;  4DJ3 A;  1P0Z A;  3C5A A;  3PXP A;  2VJW A;  4LV0 A;  3LGO A;  1K56 D;  4S2K A;  5IT5 A;  1DY6 A;  3TOI A;  4HQA A;  3K3D A;  4GDN A;  2JHE A;  4H8R A;  3S4X A;  4UQI M;  2EA9 A;  3EEH A;  2HDS A;  3B3X A;  3CPT B;  3IWI A;  1SDE A;  3G35 A;  4OQH A;  2I72 A;  1FCM A;  5HD5 A;  3IBR A;  5GL9 A;  1BUL A;  2VLG A;  4QB8 A;  2W3H A;  3IXB A;  4EQI A;  2BAS A;  4ZJ3 A;  3GDI A;  4MBH A;  1YT4 A;  3FWL A;  2QYB A;  4Y13 A;  2ZC4 B;  1PZP A;  2H0Y A;  3D9Y A;  3MQ0 A;  1T1A A;  3BY9 A;  2Q9N A;  5KSH A;  4KUK A;  2Y2J A;  3N6I A;  5AVF A;  1XJ4 A;  4BBV A;  4GOG A;  2Y2N A;  1N9N A;  3HBR A;  4X69 A;  1DP6 A;  1NRJ A;  2PYP A;  4K91 A;  1KVM A;  2WAF A;  2QPN A;  4A5R A;  2P9V B;  4MMN A;  3ZDJ A;  1T19 A;  1OME A;  3HL9 A;  5EOE A;  2HJE A;  1G68 A;  5FI7 A;  1WYB A;  5EUA A;  3BRM A;  2HP5 A;  2DNS A;  1Z09 A;  3NHQ A;  3AGE A;  1GSW A;  2R9X A;  3TRC A;  3DWK A;  1WE4 A;  1KGF A;  1GHM A;  3HJK A;  2QKP A;  2LB9 A;  3WS5 A;  2OSU A;  2ZMV A;  5DF8 A;  4QHC A;  3Q07 A;  2J3T D;  1XP4 A;  2D02 A;  3EQV A;  2L1M A;  4R3A A;  4KZ8 A;  3T1X A;  4B9O A;  2XQZ A;  4XUZ A;  4P6B A;  2PBD P;  4N1X A;  2PD7 A;  1DP8 A;  2P04 A;  1GHI A;  5L2F A;  1VM1 A;  2ZOI A;  1V9Y A;  2JC7 A;  4DDY A;  1FIK A;  5E2G A;  4I39 A;  3T4Q A;  5JYO A;  5LBR A;  4NG2 A;  2EX2 A;  4GS9 A;  3DW0 A;  5GHY A;  3BYD A;  3DTE A;  3VOZ A;  5FQQ A;  2ZC6 B;  3V3S A;  5EVI A;  4BBT A;  5HDC A;  1PI5 A;  5BOH A;  5FQK A;  3ZG9 B;  5G18 A;  1CI8 A;  3A0V A;  2OAQ 1;  3MXS A;  1Y28 A;  4R3J A;  5KSC A;  1G28 A;  5F69 A;  2H5S A;  1ZHH B;  4HJ6 A;  1K4E A;  1C3B A;  3GEC A;  1LL5 A;  2IA2 A;  3FC7 A;  4MN5 A;  4C75 A;  3G4P A;  1XXM A;  3SS4 A;  2J9O A;  1TS0 A;  3RXX A;  1P9W A;  5CHU A;  3NIA A;  4H6J A;  4Y2F A;  5I5L A;  1J9M A;  2ZQD A;  3LY4 A;  5EM0 A;  4X56 A;  5EVI D;  2WKP A;  3N4I A;  2XFT A;  4R4S A;  1GA0 A;  5J4E A;  4I5S A;  2QJ5 A;  4QD4 A;  3UDX A;  3DAV A;  1PWG A;  1F98 A;  2P7J A;  1PWD A;  3LR3 A;  1HLU P;  4QPR A;  2Q0O A;  1KE0 A;  1K54 A;  3OCN A;  4OPY A;  4GLQ A;  1XA7 A;  3AGF A;  4WEJ A;  4PPR A;  3M2J A;  2OWJ A;  2A24 A;  2ZM0 A;  3MZF A;  2VA0 A;  3OPP A;  1ODV A;  1OTB A;  3Q1F A;  3UPO A;  4OQG A;  3D3O A;  1LL9 A;  2HJ9 C;  4Y3I A;  5E43 A;  3PAE A;  3F1O B;  1IOU A;  4ZDX A;  1UWN X;  1H5X A;  5FQI A;  2EFU A;  3JPU A;  1T1C A;  3VP4 A;  5GHZ A;  5HDD A;  4HBT A;  3I7J A;  3VSK A;  2BG1 A;  2Y91 A;  4B4X A;  3TJZ C;  2PT7 A;  4OQ0 A;  2VV8 A;  3A3I A;  3CIT A;  4LFU A;  2W1R A;  3UE3 A;  4YOF A;  4NXB A;  2VKS A;  4IUH A;  4FD8 A;  1PFL A;  2XDM A;  2KDK A;  3R7W A;  4P85 A;  1NWZ A;  3UDI A;  5F68 A;  3TW8 A;  2P08 A;  3EWK A;  5DF9 A;  5HWV A;  1F5M A;  3BFF A;  4DXC A;  3G34 A;  4Y5F A;  4O01 A;  1S0W A;  3MJQ A;  4KQQ A;  4BL3 A;  2ZMF A;  2H10 A;  2JKR I;  2FH5 A;  3NOU C;  3ISG A;  3CZD A;  2ZMA A;  2JE5 A;  3O3V A;  1KE4 A;  3RJU A;  1MY8 A;  3KYQ A;  2GNX A;  2H0T A;  1MZU A;  3PBT A;  1CQA A;  3Q81 A;  1W8Y A;  4BD1 A;  1PW8 A;  4R0Q A;  2Y2G A;  1PZO A;  4KG6 A;  2OOL A;  4UHU A;  2EX6 A;  2EX9 A;  3GVB A;  3BM6 A;  2CMN A;  2WKE A;  4NKP A;  2O9A A;  4HI4 A;  3S22 A;  5HX9 A;  1JVJ A;  3ZYT A;  3UN7 A;  3LIB A;  2W3G A;  1OTD A;  4S2N A;  5M18 A;  2OLU A;  4U0T A;  1XX2 A;  4KQR A;  2X01 A;  5IHV A;  1BLH A;  3JVU A;  4BL2 A;  2ZD8 A;  3ULF A;  2ZQC A;  1ERM A;  4CPK A;  1ZC2 A;  2XA7 S;  3ZVW A;  1OT9 A;  3T1S A;  2HP9 A;  3MXR A;  3GMW A;  3ZHH A;  3E4P A;  4ZJ1 A;  2UWX A;  1DRM A;  1V9Z A;  1VET A;  4MLL A;  5E2H A;  3EGX C;  3HLD A;  5HL1 A;  4P87 A;  1YLY A;  3MZE A;  1L0F A;  3N8L A;  4GCZ A;  2Z2M B;  4X25 A;  3S1Y A;  2ZLY A;  4Q0J A;  1JWV A;  5DTS A;  4FCF A;  4IBR A;  2EX8 A;  3IWO A;  4FH4 A; 
#chains in the Genus database with same CATH homology
 1ES4 A;  3VP0 A;  3G32 A;  3IXB A;  4EQI A;  3IQA A;  4ZJ3 A;  1MBL A;  1GHP A;  5FSR A;  1NYM A;  1W5D A;  4MBH A;  1TEM A;  3O88 A;  1YT4 A;  3FWL A;  1K57 C;  2WAE A;  5DTK A;  1RP5 A;  3IH8 A;  2ZC4 B;  2HP6 A;  1YMS A;  1PZP A;  2H0Y A;  4QU3 A;  4LEN A;  2ZQ9 A;  4JF5 A;  1TDL A;  1GCE A;  2VGK A;  2Q9N A;  1KGG A;  4OON A;  4P0M A;  5KSH A;  5CGS A;  2Y2J A;  2XK1 A;  5CRF A;  1XPB A;  3N6I A;  3ZG8 B;  5M19 A;  1S6R A;  4GZB A;  3ZNY A;  2A49 A;  2GDN A;  4E3K A;  1KGE A;  2XR0 A;  3W4O A;  3W4Q A;  4GOG A;  1W79 A;  2Y2N A;  1PWC A;  1MWS A;  4E6W A;  3HBR A;  1O7E A;  3SH7 A;  1EWZ A;  4R4R A;  4X69 A;  2WAD A;  1RGY A;  1HTZ A;  2XF3 A;  1DJA A;  5I94 A;  4Y0O A;  5CTM A;  1ALQ A;  4KZ4 A;  4F94 A;  4K91 A;  3UE1 A;  2JCH A;  5F1G A;  1KVM A;  4KZA A;  2WAF A;  2QPN A;  2A3U A;  2P9V B;  4A5R A;  4WZ4 A;  3OC2 A;  4DE1 A;  3ZDJ A;  1OME A;  3A3F A;  3HL9 A;  1K56 A;  1YM1 A;  3IT9 A;  5EOE A;  1JWP A;  4IBX A;  1G68 A;  4LV3 A;  5FI7 A;  1WYB A;  1ONH A;  3FV7 A;  5EUA A;  5M1A A;  3VFH A;  2QZ6 A;  4IVI A;  3A3E A;  3BRM A;  3A3J A;  2HP5 A;  1ZKJ A;  2DNS A;  4KZB A;  1AXB A;  3WS1 A;  3AGE A;  1BSG A;  1XGJ A;  2V20 A;  4RX3 A;  2G2W A;  4LCL A;  3CG5 A;  3HLE A;  2P9V A;  2R9X A;  3DWK A;  5GLD A;  1WE4 A;  1JWZ A;  1M6K A;  2EXB A;  1I5Q A;  2WGI A;  1KGF A;  1GHM A;  1SDN A;  3HLG A;  4JXG A;  3MFD A;  5F82 A;  1K6S A;  3DWZ A;  3NC8 A;  3UPP A;  1BTL A;  2OSU A;  1XA1 A;  4GN2 A;  3WS5 A;  1TDG A;  5DF8 A;  3GTC A;  2PU2 A;  4QHC A;  3Q07 A;  5FAO A;  1IKI A;  1XP4 A;  1QMF A;  1FOF A;  1NYY A;  4RVA A;  1YLP A;  1I2S A;  3EQV A;  3FKV A;  3PBR A;  5GLC A;  4OLD A;  1IYO A;  4OOM A;  1L0D A;  3N7W A;  4KZ8 A;  4OVD A;  5AQA A;  2Y2L A;  5HAQ A;  3OCL A;  2XQZ A;  4D2O A;  2G2U A;  3WRZ A;  3GV9 A;  4XUZ A;  4P6B A;  1CI9 A;  2X02 A;  4N1X A;  3OPH A;  4E3O A;  3ITA A;  4WEK A;  5CGX A;  1YMX A;  5HAP A;  3G30 A;  1IEL A;  4U0X A;  3G2Z A;  1GHI A;  3BFC A;  5L2F A;  1VM1 A;  3O87 A;  3EQU A;  3VOY A;  4GD8 A;  3ZVT A;  2JC7 A;  4X53 A;  4DDY A;  2HPB A;  4S2M A;  2XEP A;  4JXW A;  3E2K A;  1JTG A;  4PM8 A;  1PYY A;  3BEB A;  5E2G A;  1BT5 A;  1FR6 A;  2IWC A;  4L0L A;  3VSL A;  3ZNT A;  4B4Z A;  5FI6 A;  4E6X A;  3A3D A;  3M6H A;  4GNU A;  4Y0T A;  1SCW A;  1NY0 A;  5EEC A;  1IYS A;  3TG9 A;  4KZ7 A;  5JYO A;  2ZQA A;  1SHV A;  5E2E A;  4E3I A;  1LI9 A;  2EX2 A;  2Y59 A;  1ERQ A;  4FSF A;  5EVI B;  3SS3 A;  3DW0 A;  1FCO A;  5GHY A;  3IXD A;  4DE3 A;  3BYD A;  2HDR A;  4HES A;  4ZTK A;  5GLA A;  4C3Q A;  5CED A;  3VOZ A;  2C6W B;  5FQQ A;  1N9B A;  4PM9 A;  2ZC6 B;  3IF5 A;  2J9P A;  2Y2H A;  4X68 A;  3V3S A;  3WS2 A;  4IVK A;  2Y2O A;  4JBF A;  4K0W A;  4OLG A;  4RA7 A;  4JKT A;  5EVI A;  2IWD A;  4BLM A;  4DXB A;  3SOI A;  1PI5 A;  5BOH A;  3SH8 A;  4FH2 A;  4E3N A;  2IWB A;  1TVF A;  2XD5 A;  5FQK A;  3ZG9 B;  3RXW A;  5G18 A;  3VP2 A;  5F1F A;  1CI8 A;  1Q2Q A;  3MXS A;  1CK3 A;  2Y2K A;  1FR1 A;  1PI4 A;  3BFD A;  4WEL A;  5CGW A;  4R3J A;  2Q9M A;  3NI9 A;  5EVI C;  1IKG A;  4EV4 A;  4YFM A;  2V2F F;  4HEF A;  5KSC A;  1ESU A;  2V1Z A;  3FKW A;  2DRW A;  4KG5 A;  4EBP A;  5HAI A;  2WYX A;  2H5S A;  3GR2 A;  4MNR A;  3OPR A;  3AGD A;  3FYZ A;  4PM7 A;  1NXY A;  1K4E A;  2ZQ8 A;  1C3B A;  3C7V A;  5E2F A;  1LL5 A;  4IED A;  4BEN A;  3LO7 A;  1ERO A;  2OLV A;  1MXO A;  4RYE A;  3TSG A;  3W8K A;  4C75 A;  3NCK A;  4WBG A;  4PM6 A;  3G4P A;  3QNB A;  4DDS A;  3PBS A;  4E3L A;  3OPL A;  1XXM A;  3SS4 A;  2J9O A;  4OPR A;  3RXX A;  3HLW A;  5CHU A;  3NIA A;  3ZG5 A;  3HUO A;  4QY6 A;  5KMW A;  2C5W B;  3PBO A;  3IH9 A;  1J9M A;  4X6T A;  1K6R A;  2ZQD A;  3LY4 A;  1IYP A;  4DE0 A;  4ZBE A;  5HAR A;  1KDS A;  2ZC7 A;  3IXH A;  4X56 A;  5FAT A;  1KVL A;  3IF6 B;  5CHM A;  5EVI D;  3GRJ A;  2E8I A;  4WZ5 A;  5AQ7 A;  1PIO A;  4OP8 A;  3N4I A;  4JF6 A;  1ES5 A;  2XFT A;  5A92 A;  2Y2M A;  1LHY A;  4MEZ A;  4N9K A;  4R4S A;  1NJ4 A;  1GA0 A;  4S2P A;  4MBF A;  5FAQ A;  3MZD A;  2Y4A A;  1Y54 A;  4QD4 A;  3UO9 A;  3ITB A;  3P09 A;  3UDX A;  5D3O A;  1PWG A;  2EFX A;  1PWD A;  2J8Y A;  4S2J A;  1K55 A;  1NZU A;  1MWU A;  4KG2 A;  1W7F A;  2XH9 A;  3UDF A;  4S2L A;  1Q2P A;  2Y2Q A;  3N8R A;  2FFF B;  1KE0 A;  3IXG A;  4WM9 A;  4WMC A;  3IF6 A;  3Q82 A;  1K54 A;  4WZ5 C;  5TFQ A;  3OCN A;  3ZG7 B;  4OPY A;  5TGF A;  2HDQ A;  1XA7 A;  4KZ6 A;  3UPN A;  1MWR A;  3AGF A;  3HRE A;  4WEJ A;  5GLB A;  4PPR A;  4LCM A;  3M2J A;  1BZA A;  4KQO A;  5DTT A;  2ZM0 A;  3MZF A;  1K55 C;  4B88 A;  3LY3 A;  3OPP A;  1XKZ A;  5DVA A;  3UE0 A;  3D4F A;  3VMA A;  4N9L A;  3GSG A;  2WGV A;  3Q1F A;  5EPH A;  5TR7 A;  5CEC A;  4KZ9 A;  3UPO A;  1VQQ A;  4HBU A;  1FQG A;  4OQG A;  1K25 A;  1LL9 A;  5FQ9 A;  4KZ3 A;  2VGJ A;  4UA9 A;  2XD1 A;  3HLB A;  5E43 A;  3PAE A;  1ONG A;  3V5M A;  4QJG A;  3Q7V B;  4PM5 A;  3MKF A;  3MBZ A;  4XUX A;  1ES3 A;  4JXV A;  4JF4 A;  2Y55 A;  4BQM A;  4ZDX A;  1HZO A;  3C4P A;  1KE3 A;  2WGW B;  1H5X A;  5CER A;  5FQI A;  2EFU A;  4QY5 A;  4LV2 A;  4Q8I A;  4UAA A;  3WWX A;  4WYY A;  3VP4 A;  1NRF A;  5GHZ A;  1FSW A;  4HBT A;  3I7J A;  3HVF A;  3VSK A;  2BG1 A;  4ZJ2 A;  3NDG A;  4DF6 A;  1L2S A;  2Y91 A;  1DJB A;  4B4X A;  3V39 A;  3Q7V A;  3PBQ A;  3QNC A;  3WS4 A;  2WZX A;  2ZC3 B;  3PTE A;  4DRT A;  3ZGA B;  4OPQ A;  1YLT A;  5KZH A;  4WMC D;  2WGW A;  4OQ0 A;  1YLJ A;  1H8Y A;  2Y2P A;  4KEN B;  3BEC A;  3A3I A;  1MPL A;  3OZH A;  2R9W A;  3W4P A;  3Q7Z A;  1YQS A;  3CMZ A;  3UE3 A;  3BLS A;  1LLB A;  3NY4 A;  4R1G A;  1Z6F A;  4BJP A;  1IEM A;  2JBF A;  2WUQ A;  4FD8 A;  4U3T A;  4UA6 A;  1FCN A;  3SS5 A;  2XDM A;  1MWT A;  5J8X A;  1G6A A;  3UY6 A;  4P85 A;  5EOO A;  3WS0 A;  3UDI A;  3IHA A;  2QMI A;  1N4O A;  2PBY A;  2WK0 A;  3GQZ A;  3N8S A;  2RCX A;  3BFG A;  3E2L A;  3WRT A;  4C6Y A;  2XGN A;  1BUE A;  3JYI A;  1I2W A;  3C7U A;  1E4D A;  5DF9 A;  1JTD A;  4Y7P A;  4Y0U A;  3BFF A;  1BLC A;  3IWQ A;  4DXC A;  2ZC5 B;  3G34 A;  1HD8 A;  3ZFZ A;  2BLS A;  3PAG A;  4UA7 A;  1S0W A;  4EBN A;  1CEG A;  4KQQ A;  3O86 A;  1QME A;  4BL3 A;  4KZ5 A;  1DJC A;  2H10 A;  4EWF A;  1MKI A;  1CEF A;  1W8Q A;  1L0E A;  2WKI A;  5FDH A;  1LI0 A;  3ISG A;  2J7V A;  5HFO A;  3CZD A;  4OQI A;  2ZJ9 A;  4BD0 A;  2ZMA A;  2JE5 A;  2B5R A;  5F83 A;  1K38 A;  5JYP A;  3M2K A;  3CJM A;  4JPM A;  3O3V A;  3M6B A;  1KE4 A;  3RJU A;  2OV5 A;  1MY8 A;  5EVL A;  1L0G A;  1YLZ A;  2H0T A;  3PBT A;  1BLP A;  1ZG4 A;  4E3M A;  4CJN A;  4EBL A;  2ZM2 A;  1O07 A;  3VP3 A;  2Z2L B;  1HVB A;  4LV1 A;  3ZG0 A;  3Q81 A;  1W8Y A;  2XFS A;  4S2O A;  4BD1 A;  1K4F A;  1PW8 A;  3MKE A;  4N1H A;  4R0Q A;  5HW3 A;  2RL3 A;  1YLW A;  2EXA A;  2Y2G A;  3UNW A;  1PZO A;  4KG6 A;  2HDU A;  3HLF A;  4UHU A;  5AQB A;  2EX6 A;  3NBL A;  3V3R A;  5CHJ A;  5EE8 A;  3V50 A;  5FAS A;  2EX9 A;  3GVB A;  2XLN A;  3BM6 A;  5AQ9 A;  1E3U A;  2X71 A;  4OKP A;  4YIN A;  4RX2 A;  1BLS A;  3HLC A;  2WKE A;  2FFY A;  1IYQ A;  2PU4 A;  5FQM A;  4XXR A;  5A91 A;  4JXS A;  5A93 A;  3S22 A;  1RGZ A;  5CXW A;  4MBK A;  5HX9 A;  3QHY A;  4EUZ A;  2CC1 A;  1JVJ A;  3UN7 A;  4GD6 A;  2ZQ7 A;  4S2N A;  3DTM A;  3PBN A;  4GKU A;  1WYC A;  1SKF A;  1ES2 A;  3P98 A;  4DKI A;  5M18 A;  3BLM A;  4OOL A;  2OLU A;  4U0T A;  1GA9 A;  1XX2 A;  4X55 A;  5CTN A;  4M3K A;  3NDE A;  2DCF A;  3HUM A;  3IF6 C;  1K54 C;  2ZM8 A;  4KQR A;  4N92 A;  2X01 A;  3G31 A;  3VP1 A;  2WZZ A;  5FA7 A;  4R23 A;  1RCJ A;  5IHV A;  4GDB A;  2P74 A;  1H8Z A;  1BLH A;  4OH0 A;  4R3B A;  4BL2 A;  2ZD8 A;  4Z9Q A;  3SH9 A;  5FAP A;  1KDW A;  3FZC A;  4S2N C;  1NZO A;  2ZQC A;  1ERM A;  5GHX A;  4CPK A;  5CEB A;  1ZC2 A;  1ZG6 A;  3BFE A;  3ZVW A;  5DF7 A;  1M40 A;  4E3J A;  2HP9 A;  2Y2I A;  3MXR A;  4OOY A;  2WKH A;  3LEZ A;  1XGI A;  3GMW A;  4GB7 A;  3VFF A;  1ESI A;  5FI2 A;  3C5A A;  3ZHH A;  4ID4 A;  4ZJ1 A;  2UWX A;  4LV0 A;  1U60 A;  4MLL A;  4JLF A;  5E2H A;  1K56 D;  3HUN A;  3HLD A;  4S2K A;  1FSY A;  1E3U D;  5HL1 A;  4P87 A;  1YLY A;  1E25 A;  1DY6 A;  3TOI A;  3MZE A;  1L0F A;  3N8L A;  1EI5 A;  4NET A;  4GDN A;  5A90 A;  2Z2M B;  5U47 A;  4H8R A;  4NK3 A;  2ZLY A;  3S1Y A;  3S4X A;  3ZCZ A;  2HDS A;  3B3X A;  3IWI A;  4O7D A;  4DE2 A;  1JWV A;  4OP5 A;  1PW1 A;  1SDE A;  5DTS A;  3G35 A;  5FQJ A;  4OQH A;  3LCE A;  2I72 A;  1FCM A;  3C4O A;  4S2I A;  4OPZ A;  4ZAM A;  4FCF A;  3G2Y A;  4PMA A;  3IHB A;  1K57 A;  5GL9 A;  4K0X A;  1BUL A;  4IBR A;  2EX8 A;  4QB8 A;  3IWO A;  4FH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...