4N92A

Crystal structure of beta-lactamse penp_e166s
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
256
structure length
256
Chain Sequence
b'DDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFSPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Perturbing the General Base Residue Glu166 in the Active Site of Class A beta-Lactamase Leads to Enhanced Carbapenem Binding and Acylation
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
total genus 90
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4n92A00
4E3LA 1W79A 1NZOA 1QMFA 1ERQA 3BRMA 1BLHA 4N1XA 1CEGA 5JYOA 2Y2KA 4S2KA 4GNUA 4E3MA 3GSGA 3BYDA 5TR7A 2EX2A 4QU3A 4JXSA 2Y55A 4KZ6A 1EROA 3M6BA 4JXGA 1IELA 2XFSA 4OOMA 3Q07A 3MKFA 1KDWA 5EVLA 5GLCA 1TDLA 1JWVA 2XQZA 3RJUA 1JWPA 3PBNA 1GCEA 2BLSA 5AQAA 1K38A 4Z9QA 3G30A 5CECA 1KE4A 2IWCA 3BFGA 2Q9NA 5E2EA 5D3OA 5GLBA 3NCKA 3C4OA 4PPRA 4X56A 2EX6A 4WZ4A 1ZG4A 2WGVA 2Y2QA 1KVLA 4U0TA 4WYYA 2XEPA 5FQMA 4Y0UA 5HW3A 4LV2A 2JBFA 1PWGA 1RP5A 5HARA 1PWDA 2IWBA 1ERMA 1XXMA 4O7DA 2Y2OA 2RL3A 2WZZA 4EUZA 5CHJA 4B4ZA 2B5RA 5CTNA 1MPLA 4JPMA 5CHMA 3UO9A 3M2KA 4K0XA 1N4OA 3PBSA 2H5SA 3O3VA 4X68A 2C5WB 2XD5A 2Z2MB 2P9VA 3NBLA 1JVJA 2ZM0A 3DW0A 1WE4A 5E2HA 4LCLA 2OSUA 1TEMA 3RXWA 4PM7A 1K57A 3IXDA 1DJAA 4E3KA 3GV9A 5EVIC 3HUMA 4S2MA 1S0WA 2EFUA 3C5AA 5J8XA 1BSGA 3HREA 3PBQA 4GKUA 4XXRA 2ZQ9A 2ZM2A 3A3EA 1FSWA 1XA7A 3LEZA 5I94A 2DRWA 1EI5A 4B4XA 1N9BA 5CERA 4U0XA 1PW8A 2HP6A 2JCHA 3CMZA 3QNCA 4RVAA 4WM9A 1YLPA 4X6TA 4DE0A 2XFTA 3HBRA 4PM5A 4KG6A 4KQOA 3V5MA 2EXAA 3PBTA 4YINA 5EVIB 4K91A 1ES2A 3BM6A 1ONHA 1PIOA 2GDNA 2A49A 2ZMAA 4WMCD 4ZAMA 1KGEA 5FI6A 2C6WB 2RCXA 5DF8A 5BOHA 1PI5A 5TFQA 5A90A 3VFHA 2HDSA 5DF9A 4DF6A 2WKHA 5EOEA 5FI2A 1K6RA 4C75A 1CEFA 4BL2A 2WADA 4LV0A 5KZHA 2XK1A 5GHYA 2J9OA 2ZC3B 5A93A 4IEDA 1K57C 4N9LA 2WYXA 5E2FA 1FCMA 2WKEA 2VGKA 5FQ9A 5A91A 1SCWA 5F82A 2ZM8A 2XDMA 3LY3A 4OPZA 2Y2NA 2V2FF 4R0QA 4X53A 3G35A 3NC8A 3HUNA 1XX2A 3IWOA 4M3KA 4MLLA 5FATA 1E4DA 4UA7A 1MBLA 1RGZA 3UN7A 1JTGA 3HLEA 4XUZA 4RYEA 1K56A 2ZQ7A 4C6YA 4D2OA 3ZG5A 4GDBA 5E43A 5FQJA 5A92A 2WZXA 2XR0A 3UE1A 3ITBA 4IVKA 3IF6B 3ZG8B 1ESIA 3MZEA 4WZ5A 5FAPA 2ZC7A 1PZPA 2H0TA 4A5RA 4JBFA 1ESUA 5FQKA 1IKGA 4HESA 4FCFA 1O7EA 1YLZA 4ZJ2A 3OC2A 2HPBA 1NY0A 1G68A 4IBXA 1C3BA 4DXCA 5EOOA 3N4IA 4PM8A 1RGYA 4JKTA 5DVAA 3IXGA 3SH9A 4LV1A 4KZBA 5EVIA 4WBGA 2P74A 4OQIA 2Y91A 3IH8A 3QHYA 3N8SA 4GDNA 2V1ZA 4PM9A 4PMAA 3VMAA 1E3UD 3ZDJA 4BD0A 2EXBA 3NI9A 3OPRA 3UPOA 4UHUA 5JYPA 3HLCA 1YMXA 4OLDA 3VP0A 3UDXA 3SOIA 3C7UA 4C3QA 3IHBA 1XP4A 3ISGA 4L0LA 3G2ZA 3P09A 1PI4A 5GHXA 1Q2PA 4HEFA 4E3IA 4EBLA 3ITAA 4EBPA 1DJCA 1NYMA 2WGWB 4OVDA 4KZ9A 1XKZA 2HP9A 3VP2A 3VOZA 4S2OA 1YLWA 3RXXA 5CXWA 5DTKA 2WUQA 3FZCA 2JE5A 2J9PA 4P87A 1KVMA 5M19A 1FOFA 4GOGA 4ZBEA 2FFYA 5HFOA 1HZOA 3FKVA 3O86A 1SHVA 3PBOA 4KZ5A 5E2GA 5GLDA 3S22A 5HL1A 1FQGA 2WAFA 4UAAA 3VOYA 3G2YA 3GMWA 1XGIA 2XLNA 5M1AA 1LI0A 5FSRA 2HDRA 4NK3A 5HAIA 3A3FA 4DDYA 4LCMA 4WZ5C 4FH2A 1M40A 1HVBA 5FQIA 4BL3A 3WS2A 2DNSA 2QMIA 4X69A 2Y2MA 1KE0A 3V39A 1PYYA 1GHMA 5M18A 1DJBA 2XH9A 5FASA 4E3NA 1XPBA 5CEBA 5CRFA 3GRJA 2ZQAA 4LENA 4S2LA 1LHYA 2WKIA 3IF6A 5EECA 4U3TA 1MWUA 1MY8A 4BD1A 3HLBA 4DRTA 4OONA 3NDEA 1Q2QA 1ZKJA 4KENB 5EUAA 2H10A 3VP1A 2OLUA 4BENA 3IH9A 1JTDA 1FR6A 3O88A 4MBFA 3HLWA 1YQSA 4ZJ1A 3WS1A 1WYBA 4KQQA 5F1GA 3V3RA 1BULA 3BLSA 5KMWA 1EWZA 4EBNA 2ZC6B 2X71A 3M6HA 2Y2HA 4ZJ3A 1NRFA 2DCFA 3EQUA 2Y2GA 1MWSA 5FDHA 2Z2LB 1TVFA 2BG1A 3MKEA 4JXVA 3N8LA 4KZ8A 1I2WA 4EV4A 3SS5A 2ZLYA 4IVIA 1VM1A 3VP3A 4QY5A 2WGWA 3MXSA 2Q9MA 4CPKA 3AGEA 1FSYA 3W4PA 3V50A 1Y54A 2EX9A 3OPPA 3UPNA 2PU2A 2HDQA 3WS0A 3A3IA 2PBYA 4MNRA 5EVID 1BLCA 4QY6A 2PU4A 1S6RA 3G32A 2ZQ8A 4FD8A 4ZDXA 2XD1A 3UE0A 1GA9A 1AXBA 3UNWA 3E2KA 2WAEA 4HBTA 1LLBA 4OP5A 3PAGA 5CHUA 4GD6A 1TDGA 5CEDA 3N6IA 2CC1A 1GA0A 4BJPA 3IF6C 1BLSA 1LL9A 3PBRA 4S2IA 4JF6A 1ZG6A 2A3UA 1KGFA 4JF4A 5CGWA 3EQVA 4RX3A 4KZ7A 4X55A 1KDSA 3BFFA 3PAEA 1IYOA 1H8YA 4OPRA 1K55A 1BZAA 1CK3A 4OQ0A 1LL5A 1J9MA 1L0FA 4NETA 4WEJA 3TG9A 4EQIA 3GQZA 3NY4A 3DTMA 3BFDA 4IBRA 3LO7A 4H8RA 3Q7ZA 2ZQCA 1QMEA 1XGJA 5EE8A 4S2NA 3IHAA 5FI7A 2ZJ9A 4WELA 4Y0TA 4KQRA 5TGFA 2Y59A 3Q7VA 5CGSA 4UA9A 3OPHA 5FQQA 2OV5A 4OPYA 2R9XA 2J7VA 3IWQA 1L0EA 1XA1A 1U60A 1DY6A 3ZG9B 1L2SA 4R23A 1ALQA 1BTLA 3Q81A 3GR2A 4OKPA 1GHIA 1IYPA 4N9KA 3A3DA 4QB8A 4MBHA 4QD4A 5AQBA 5HAPA 2HP5A 5KSHA 1ONGA 3WRTA 4DKIA 3MXRA 4GZBA 3GVBA 3C4PA 2XF3A 1NZUA 1YLTA 4MBKA 4N92A 2E8IA 3OPLA 1JWZA 4ZTKA 2IWDA 1MKIA 1WYCA 3BEBA 2ZD8A 3ZVTA 4F94A 3HLGA 4WMCA 4LV3A 3VP4A 4E6WA 4KG2A 1ZC2A 3IF5A 1W8YA 1BT5A 4DE2A 3Q1FA 2HDUA 5HX9A 3ZGAB 2FFFB 3ZG0A 4ID4A 2R9WA 4Q8IA 4OH0A 1YT4A 3BECA 1O07A 5CTMA 1K25A 1L0DA 3SH7A 1E25A 1K55C 2G2UA 4P6BA 5KSCA 3HL9A 4OQHA 3IXBA 3FWLA 3VSLA 1IYQA 1ES3A 4OPQA 4JF5A 5GL9A 3HUOA 1ES4A 3IWIA 4S2NC 4RX2A 3NIAA 4BLMA 1NXYA 1PZOA 1YLYA 3C7VA 4KZ3A 4OOLA 3G34A 3BFEA 5CGXA 4R4RA 3DWKA 4N1HA 3TSGA 4DXBA 4E3JA 3M2JA 3MZFA 3ZFZA 3PTEA 2J8YA 1SDNA 2H0YA 3WS5A 1OMEA 3LCEA 4FH4A 3AGFA 3W4QA 2JC7A 3IXHA 3MZDA 3Q82A 4KZAA 2Y2IA 2WGIA 4R4SA 1W7FA 3Q7VB 3OZHA 4KG5A 3IT9A 3WS4A 3ZVWA 3MBZA 4K0WA 1K54C 4GD8A 3ZHHA 2X02A 5U47A 3UE3A 1IEMA 3WRZA 4OQGA 5AQ7A 5FA7A 4OOYA 1K56D 1K6SA 3N8RA 4UA6A 2WK0A 3UPPA 5F1FA 3S4XA 3QNBA 3ZNYA 5F83A 4RA7A 2UWXA 3OCLA 1I2SA 1G6AA 3VFFA 3W4OA 2Y2LA 4P0MA 1PWCA 2ZC5B 1E3UA 2Y4AA 3FKWA 4R1GA 1HTZA 3B3XA 1SDEA 1KGGA 3A3JA 4DDSA 1LI9A 2G2WA 1K4EA 3CZDA 3ZG7B 4R3JA 1CI8A 1YMSA 3E2LA 3MFDA 2ZQDA 3P98A 1MWTA 3G4PA 5FAQA 1W5DA 3VSKA 4FSFA 1NJ4A 1MWRA 3UDIA 4DE1A 4JLFA 3GTCA 1IKIA 2Y2JA 3HLFA 5GHZA 3SS3A 2XGNA 1YM1A 5FAOA 2I72A 5IHVA 3SS4A 3NDGA 4EWFA 4QHCA 5DF7A 1BUEA 1KE3A 1YLJA 1MXOA 1VQQA 1FR1A 1W8QA 3N7WA 1CI9A 2Y2PA 2QZ6A 5GLAA 1SKFA 3BLMA 3ZNTA 5G18A 4B88A 3CJMA 3HVFA 4E6XA 3I7JA 2X01A 3O87A 4MEZA 4P85A 3DWZA 3WWXA 3TOIA 4CJNA 1H8ZA 1FCOA 4OLGA 4BQMA 2V20A 1FCNA 5EPHA 4S2JA 4HBUA 4JXWA 4R3BA 1M6KA 1L0GA 5L2FA 3FYZA 3OCNA 4DE3A 1Z6FA 1NYYA 1H5XA 3BFCA 4PM6A 3SH8A 1HD8A 2EFXA 2VGJA 4KZ4A 5AQ9A 1ES5A 3D4FA 4GB7A 3LY4A 1BLPA 4Y7PA 2OLVA 3W8KA 4Y0OA 2P9VB 1GHPA 1RCJA 2ZC4B 3CG5A 3UY6A 3ZCZA 1I5QA 2EX8A 1K4FA 4S2PA 4WEKA 4XUXA 2QPNA 3AGDA 3HLDA 3JYIA 3S1YA 5HAQA 4E3OA 3G31A 3UDFA 4GN2A 5DTTA 3V3SA 4QJGA 1IYSA 1K54A 4YFMA 3FV7A 3IQAA 5DTSA 1PW1A 4OP8A
chains in the Genus database with same CATH superfamily
4X25A 1W79A 1NZOA 1P0ZA 2W3DA 2H28A 4N1XA 4WN5A 1D06A 4GNUA 5EFWA 4JXSA 4EEPA 3M6BA 1IELA 5G4YA 3H7WA 5GLCA 2Y79A 2P7JA 3T4TA 3FPWA 3G30A 3BFGA 2Q9NA 3NCKA 3C8CA 2W1TA 2EX6A 4WZ4A 2XA7S 2WGVA 1KVLA 4U0TA 4WYYA 2XEPA 3QP6A 4Y0UA 2JBFA 3T4LA 1ZHHB 2IWBA 2QHKA 4O7DA 2RL3A 2WZZA 4EUZA 4B4ZA 2B5RA 5CTNA 1MPLA 5CHMA 3UO9A 2C5WB 2P9VA 3NBLA 3DW0A 4LCLA 3RXWA 1DJAA 4E3KA 1S0WA 3C5AA 2V1BA 3KSHA 3PBQA 2ZQ9A 2V9AA 3PHYA 4I39A 3NULA 1EI5A 4B4XA 5DKKA 2HP6A 4WM9A 4X6TA 4KG6A 5EVIB 2Q0OA 3BM6A 3VE3A 3CITA 4ZAMA 3D72A 5FI6A 2RCXA 5A90A 2HDSA 5DF9A 5FI2A 1K6RA 4KQDA 2OWHA 4N9LA 2WYXA 4BBUA 1FCMA 1YAXA 2VGKA 5FQ9A 3UB8A 3ZYTA 1SCWA 5F82A 3K3CA 4X53A 2KLIA 3HUNA 1XX2A 4M3KA 4MLLA 1E4DA 4RYEA 1ODVA 1K56A 5FQJA 5A92A 2L0WA 3ITBA 4IVKA 3T4QA 3UB7A 1T18A 4WZ5A 1PZPA 2H0TA 1SKOA 4A5RA 3OC2A 1H3QA 4PM8A 5DVAA 4WBGA 1XFNA 5F6AA 3IH8A 3ZDJA 4GDNA 4BD0A 4UHUA 3VP0A 3SOIA 2A2LA 3C7UA 3CUEC 3IHBA 3ISGA 3T50A 2W3HA 1G28A 3ITAA 4I3JA 4KZ9A 3LIFA 2KX6A 4S2OA 1YLWA 2WUQA 2HJEA 4PAUA 4GOGA 1FQGA 4EETB 5EM0A 4UAAA 1D7EA 3HJIA 3LIBA 3GMWA 4ESPA 5FSRA 2HDRA 3A3FA 3OLOA 5TBMB 1Y4OA 5FQIA 2QMIA 4X69A 4BBTA 1GHMA 2WKRA 2JKGA 5M18A 4EUVA 5CRFA 3CLOA 1SZVA 4DJ2A 4KUOA 1MWUA 4KENB 2HGVA 3MFXA 2OLUA 1GSXA 1VETB 2HV1A 3HLWA 2FH5A 3JVUA 3WS1A 3MJQA 5KMWA 2X71A 3E4OA 3LEQA 3C2WA 3F1PA 4Y13A 1T19A 5FDHA 1TVFA 4CLCE 4GCZA 3SS5A 2ZLYA 5DKLA 2I9VA 3VP3A 4I3IA 2WGWA 4MNRA 3MMHA 2HZ5A 5A8BA 1S6RA 2PRFA 3UE0A 3UNWA 3E2KA 5HWVA 4HBTA 4OP5A 3DBAA 4WUJA 4GD6A 2CC1A 4BJPA 1FIKA 3EQVA 1WA9A 2K2NA 3TJZC 3PAEA 1BZAA 4OQ0A 1LL5A 1L0FA 5HZHA 3NY4A 3DTMA 2ZQCA 1XGJA 4Y0TA 2ZJ9A 4WELA 4KQRA 3S7PA 5HSQA 1DP6A 4H6JB 5FQQA 1L3LA 2J7VA 3IWQA 4LFUA 4O0PA 1DY6A 3BQ8A 3LFVA 2ZMVA 3ZG9B 4NKPA 1L2SA 5J7EA 3Q81A 1ACFA 4QB8A 3WRTA 1TF1A 4GZBA 3GVBA 2XF3A 3CI6A 4MBKA 3LR3A 4ZTKA 2IWDA 3BEBA 2ZD8A 1P9RA 4ARZA 4QPRA 4KG2A 1Y28A 3IF5A 1W8YA 3Q1FA 5HX9A 3ZGAB 1XJ2A 4Q8IA 2M7UA 1YT4A 1O07A 1H0MA 1E25A 1K55C 4P6BA 3IXBA 4UQIS 1OTBA 4JF5A 3HUOA 1ES4A 4S2NC 4GHIA 4RX2A 4RQ9A 3H82B 5CGXA 1OT9A 3DWKA 4DXBA 3MZFA 3CPTB 3T1XA 2H0YA 2JC7A 2B18A 4KZAA 2Y2IA 3LR4A 3Q7VB 3R4KA 4KG5A 3EGDC 3ZHHA 5U47A 4X1MA 2XROA 3N8RA 2WK0A 3A0RA 2L1MA 3QNBA 5F83A 2UWXA 1I2SA 1G6AA 1HLUP 4R1GA 2Y4AA 3FKWA 3GDIA 1K4EA 2OWJA 2Z6DA 4BWIA 1IKIA 2Y2JA 5GHZA 5IHVA 2I72A 2INWA 4F3LA 1OTEA 1KE3A 1YLJA 5IT5A 2MJ6A 5HPFA 3T1SA 1CI9A 2Y2PA 2JKRI 4B88A 3OBFA 3HVFA 3R7WA 4E6XA 5HDCA 3F1OB 1H8ZA 4OLGA 4R70A 5EPHA 2QKPA 1M6KA 3E98A 4PM6A 3SH8A 1HD8A 4Y2FA 5AQ9A 3IBRA 1NLZA 3LY4A 2VKSA 3CG5A 4M4XA 4WLAA 4WEKA 4XUXA 5F5YA 3S1YA 5HAQA 3LR5A 4GN2A 5DTTA 4QJGA 2BASA 1PW1A 4E3LA 4LRXC 4GS9A 4EEUA 3IX4A 3BRMA 3TRCA 2Y2KA 3BYDA 4QU3A 2ZL1A 4JXGA 4JGOA 4OOMA 3Q07A 3MKFA 1KDWA 5EVLA 1TDLA 3FPVA 2XQZA 3RJUA 3PBNA 5AQAA 1XJ3A 5CECA 1KE4A 1PFLA 3C4OA 4X56A 2Y2QA 5HW3A 2ZOIA 1XXMA 2Y2OA 2EA9A 2VV8A 1W63M 4JPMA 1N4OA 1TS7A 2H5SA 3O3VA 2XD5A 2Z2MB 3EEHA 4PM7A 3IX8A 1V9ZA 4G3WA 3TE8A 4S2MA 4MN5A 3MSHA 1OTAA 5J8XA 3UMEA 1BSGA 3HREA 2QWSA 3MQOA 5IS1A 1FSWA 1XA7A 4CLCA 2VV6A 1N9BA 4RVAA 4DE0A 2XFTA 2EXAA 2W0NA 4K91A 1ES2A 1ONHA 5I5LA 2GDNA 2ZMAA 1W63Q 4IUHA 5EV0A 5DF8A 1K0KA 3VFHA 4B93A 4DF6A 2WKHA 2VX8A 1CEFA 4BL2A 2WADA 2J9OA 5EM1A 5A93A 1LSVA 1K57C 4Y17A 1VHMA 5LBRA 2ZM8A 3LY3A 3MR0A 2V2FF 4R0QA 3G35A 5HDDA 3NC8A 5FATA 5FDSA 3HLEA 4XUZA 2ZQ7A 4D2OA 4GDBA 2WZXA 1NWZA 5L07A 1BYWA 4JBFA 4P6ZM 4FCFA 4ZJ2A 2HPBA 1NY0A 2QJ5A 1G68A 4IBXA 1TS0A 1F2KA 3N4IA 1RGYA 1N9NA 4JKTA 3IXGA 2Y91A 3MQ0A 2Y8HA 2VJWA 1E3UD 3F1NB 2EXBA 3OPRA 5JYPA 3UDXA 2Z6CA 1CJFA 1YKDA 2PHYA 4L0LA 4CLCD 3VE4A 4OVDA 1IFQA 2HJ9C 5CXWA 5L8MA 3KYZA 5M19A 3E4PA 5HFOA 2FFYA 3RTYA 3FKVA 3O86A 1N9LA 5E2GA 5HL1A 1UWNX 1KOUA 5MC7A 1XGIA 2XLNA 1LI0A 5HAIA 4DJ3A 2J3WA 5FEFA 2DNSA 1KE0A 4AFIA 1PYYA 4Y5FA 5FASA 2QJ7A 4LENA 4S2LA 2WKIA 3IF6A 1ZTUA 1MY8A 2EWVA 4DRTA 1FR6A 1YQSA 2VGLS 5F1GA 4EBNA 2ZC6B 2W1RA 1NRFA 2Y2GA 2W27A 3MKEA 4JXVA 4IJGA 4D60A 1OT6A 1A0KA 1VM1A 4L9GA 4MCWA 2Q9MA 3LIDA 1FSYA 3V50A 3WS0A 3A3IA 2PBYA 3OOVA 4R6LA 4ME4A 1BLCA 5J3WA 4QY6A 1YSQA 3G32A 4FD8A 1AXBA 2WAEA 5CEDA 3BWLA 1GA0A 4S2IA 1LL9A 2V0UA 2A3UA 1KDSA 2YKFA 1S1YA 1J9MA 3CPTA 4WEJA 3TG9A 3BFDA 4H8RA 1XJ4A 5FI7A 5TGFA 3HJKA 2Y59A 3Q7VA 2OV5A 4OPYA 2R9XA 2M1CA 5HAPA 3A3DA 1H8MA 5AQBA 4DKIA 3MXRA 2PYRA 4PKYA 1NZUA 4N92A 2E8IA 3OPLA 1JWZA 1WYCA 3ZVTA 4F94A 3T4KA 4WMCA 2PYPA 1JNUA 4DE2A 3LIAA 1VEUA 2R9WA 3H9WA 3EGXC 5CTMA 1L0DA 4NG2A 3IS2B 4OQHA 3E0YA 3U2AA 4OPQA 4HHDA 3IWIA 3NECA 4BLMA 1NXYA 1YLYA 3C7VA 4KZ3A 3G34A 4EXOA 5CX7A 3T4SA 4E3JA 5DFXA 1SDNA 1OJGA 4JGRA 1OMEA 3AGFA 3IXHA 3L7HA 5HPIA 2A24A 3OZHA 3IT9A 3MBZA 1G6OA 4K0WA 4HIAA 3DTEA 4LGWA 5AQ7A 1K56D 1K6SA 4UA6A 3S4XA 3ZNYA 4ETZA 4RA7A 5FL3A 3VFFA 1SDEA 3T1QB 3CZDA 4CQHA 2ZQDA 3P98A 1NRJA 3G4PA 5FAQA 1W5DA 4B9OA 3K2NA 1YM1A 1IOUA 4EWFA 4QHCA 1BUEA 3H7WB 3UB6A 3G6OA 1W8QA 3N7WA 1S4SA 3ZNTA 2PT7A 2O9AA 1G5UA 4DN0A 1STZA 2W1TB 3B47A 3LYXA 5HD5A 1UWPX 1FCOA 3SZTA 2V20A 1FCNA 4HBUA 4R3BA 3KYEA 1L0GA 3K3DA 5L2FA 3LICA 4DE3A 1Z6FA 3BFCA 2EFXA 4GB7A 4CLCC 4Y7PA 3W8KA 2P9VB 1GHPA 2ZC4B 3UY6A 2JKRM 3G31A 3V3SA 1K54A 4YFMA 3IQAA 3LUQA 4BMWA 4OP8A 5AVEA 4JGQA 1ERQA 1P9WA 3BY8A 4EU0A 1CEGA 4S2KA 3GSGA 5TR7A 2EX2A 1MZUA 1TS6A 1N9OA 1JWVA 1FILA 5L09A 5F69A 2JKTI 2BLSA 4LPZA 1K38A 4Z9QA 4KUKA 2IWCA 5E2EA 4HOIA 4PPRA 5F68A 3LI9A 4LV2A 1PWGA 1RP5A 5HARA 1PWDA 1ERMA 3RH8B 1EW0A 4K0XA 2ZM0A 2O99A 1TEMA 3IXDA 4L9FA 1DRMA 3GV9A 4Q0HA 3HUMA 2EFUA 4GKUA 1SKOB 2ZM2A 3A3EA 5DJUA 5I94A 2DRWA 4U0XA 2JCHA 3CMZA 3QNCA 4DMZA 4KQOA 3V5MA 3IBJA 3PBTA 4YINA 2GJ3A 3F1NA 1PIOA 1KGEA 3W2ZA 2PD8A 2KOIA 5BOHA 1PI5A 3KO6A 5EOEA 4C75A 1TD5A 4LV0A 2YKHA 2AVXA 3PXPA 2XK1A 3CUEA 4IEDA 4IHQA 5E2FA 2WKEA 5A91A 2G7UA 2XDMA 1PNEA 5J4EA 3UN7A 3ICYA 4C6YA 1S1ZA 3UE1A 3ZG8B 1ESIA 3MZEA 5FAPA 2ZC7A 3DTKA 4R38A 4FTXA 5FQKA 5EVEA 2PDRA 3FC7A 2PAVP 4GW9A 3SH9A 5EVIA 3F1PB 4OQIA 3QHYA 4PM9A 3N8SA 2V1ZA 3NI9A 3UPOA 1P97A 2CMNA 4OLDA 1YMXA 4C3QA 1XP4A 1Q2PA 4HEFA 4E3IA 4EBLA 1D1JA 2WGWB 5HD3A 1XKZA 5HDSA 3VP2A 3VOZA 5DTKA 2JE5A 2J9PA 1KVMA 1FOFA 4ZBEA 3EWKA 3PBOA 2P08A 5GLDA 2WAFA 3VOYA 3G2YA 4DDYA 4LCMA 4WZ5C 4FH2A 2IA2A 3T4OA 3V39A 1GSWA 1DJBA 5CEBA 2ZQAA 1LHYA 1LT0A 4U3TA 4XT2B 4OONA 3NDEA 1Q2QA 1ZKJA 5EUAA 2XSSA 3VP1A 4BENA 5KIZA 3IH9A 1XJ6A 3O88A 4ZJ1A 5DFYA 1YPRA 1WYBA 2FZ0A 3V3RA 1BULA 4ZJ3A 1DP8A 3EQUA 1MWSA 4KZ8A 3UB5P 4ARZB 1OTIA 3MXSA 4CPKA 3AGEA 3OPPA 3UE6A 2PU2A 2HDQA 5EVID 4MDZA 2PU4A 4ZDXA 1CF0A 1GA9A 3P7NA 5CHUA 1TDGA 1PRQA 4P6ZS 2L4RA 4HJ4A 1V9YA 2VZWA 4GHIB 4JF4A 4KZ7A 1F9IA 5TBMA 2O0YA 3T4JA 4NXBA 1IYOA 4OPRA 2O9CA 1K55A 4PHTA 4MMNA 3NOPC 5EE8A 4ZRRA 4S2NA 3IHAA 3T12B 2OAQ1 4HH2A 4GLQA 1XFQA 4UA9A 5TJJA 1VETA 4NXGA 4E04A 1U60A 3NHQA 2ZMFA 1BTLA 3GR2A 1GHIA 1Z09A 4MBHA 2HP5A 5KSHA 1ONGA 1YLTA 2R78A 3A0SA 2B02A 2J80A 1MKIA 3HLGA 4Z1WA 3SW1A 4MN7A 3VP4A 4MN6A 5L10A 5C5KA 2V8CA 1BT5A 4HY8A 1T1AA 2HDUA 3S7QA 1NLYA 3ZG0A 1J3WA 4ID4A 2VLGA 4HQAA 4OH0A 2K7SA 3BECA 4II7A 3SH7A 1AWIA 4GJ4A 5KSCA 2K31A 3FWLA 3VSLA 1ES3A 4F3LB 2V1AA 3NIAA 4OOLA 3ZQ5A 4R4RA 3LGOA 3TSGA 3R7WB 3PTEA 3WS5A 4FH4A 2ACGA 3Q82A 4R4SA 3MF0A 4H6JA 1W7FA 3ZVWA 3WS4A 4WL9A 3VV4A 1K54C 2X02A 4K08A 3UE3A 5FA7A 4OOYA 3UPPA 3TW8A 5F1FA 3O5YA 2XA7M 4HNBA 4P0MA 2W3EA 1HTZA 3B3XA 3A3JA 4O8GA 2G2WA 3ZG7B 2PBDP 4R3JA 3MFDA 1MWTA 3KSFA 4GS9B 2WKPA 2V8FA 1MWRA 3UDIA 4DE1A 4JLFA 3HLFA 3SS3A 2XGNA 2M7VA 5FAOA 2DMWA 2ZL1B 5DF7A 1OTDA 3MS6A 1VQQA 2D01A 2OOLA 1SKFA 3H82A 2WKQA 5G18A 3CJMA 2VGLM 4Q0IA 4MEZA 3MXQA 3DWZA 4YOFA 2LB9A 4QWOA 3TOIA 4CJNA 3RFBA 4S2JA 4JXWA 4O01A 3OCNA 1NYYA 4KZ4A 5DJTA 4X1LA 3D4FA 1BLPA 1F5MA 3E4QA 3S7OA 1I5QA 1K4FA 2QPNA 3AGDA 3HLDA 3JYIA 3CAXA 2NUTC 3NJAA 3UDFA 3UB9A 2HF6A 4CLCB 3L9KA 1QMFA 1BLHA 3JVVA 5JYOA 4HI4A 4HJ3A 2D02A 4E3MA 2Y55A 3VOLA 4KZ6A 3UMDA 1EROA 2XFSA 4EESA 1JWPA 1GCEA 5D3OA 5GLBA 4YNRA 4ETXA 3CHWP 1ZG4A 3F1OA 5FQMA 2JHEA 2GNXA 1TS8A 2XRNA 3EEAA 3QP5A 3LIEA 5CHJA 3IX3A 3M2KA 3PBSA 4X68A 1JVJA 2JKTM 3P01A 1WE4A 5E2HA 2OSUA 1K57A 2W3GA 2J3TD 5EVIC 2VEAA 4XXRA 4Q0JA 3LEZA 5CERA 1PW8A 1YLPA 3HBRA 4I5SA 4PM5A 2ZBBA 3LI8A 2A49A 4WMCD 1YSPA 4BBVA 2C6WB 5TFQA 3QP4A 4HH3A 2BTFP 2PR6A 4NEED 4HJ6A 1CQAA 3KX0X 5KZHA 3PR6A 5GHYA 4EERA 2ZC3B 4L9EA 4OPZA 3NOUC 2Y2NA 3IWOA 4UA7A 1MBLA 1RGZA 2P04A 1JTGA 4G3KA 3ZG5A 5E43A 1OPXA 1UGUA 2XR0A 3IF6B 4XT2A 3MQQA 1LL8A 1ESUA 1IKGA 4HESA 1O7EA 1YLZA 1DP9A 1C3BA 4DXCA 5EOOA 4LV1A 4KZBA 2P74A 4IUKA 4PMAA 3VMAA 3HLCA 3G2ZA 3FG8A 1PI4A 3P09A 5GHXA 4PKYG 4EBPA 1DJCA 1NYMA 5AJGA 2HP9A 3RXXA 3PYPA 2PD7A 5HWTA 3FZCA 4P87A 3EOIA 3D9YA 4EW7A 4R3AA 2JKFA 1HZOA 3BW6A 1SHVA 4KZ5A 2VA0A 3S22A 2EWWA 5M1AA 4NK3A 1M40A 2GZAA 1HVBA 4BL3A 3WS2A 1VB6A 2Y2MA 2XH9A 4E3NA 1XPBA 3GRJA 5EECA 4BD1A 3HLBA 1X0OA 4UQIM 2H10A 3U4LP 1JTDA 4MBFA 4KQQA 4LRZE 3BLSA 1EWZA 3M6HA 2Y2HA 2DCFA 4NXEA 3BJNA 2V0WA 2Z2LB 2BG1A 3N8LA 3QP8A 1I2WA 3DAVA 4EV4A 1F98A 4IVIA 2B95A 5HWWA 4QY5A 3JPUA 3W4PA 1Y54A 2EX9A 2LB5A 3UPNA 1LSXA 4HP9A 4UEYA 2VK3A 1VEUB 1T1CA 2KDKA 3QP2A 5IU1A 2ZQ8A 2XD1A 4Y3IA 4Y15A 3BY9A 4I38A 1LLBA 3PAGA 3N6IA 3IF6C 1BLSA 3PBRA 5CGWA 4JF6A 1ZG6A 1KGFA 4RX3A 4X55A 1GSVA 3BFFA 4HP4A 1H8YA 1CK3A 2JN7A 4NETA 4EQIA 3GQZA 4IBRA 3LO7A 3Q7ZA 1T1BA 1QMEA 2A24B 3LR0A 5CGSA 3OPHA 1L0EA 1XA1A 3CWFA 4R23A 1ALQA 4OKPA 1S67L 1IYPA 4N9KA 4QD4A 3C4PA 3BQAA 4LV3A 4E6WA 4FUWA 1ZC2A 2FFFB 3C30A 3KYQA 5K5BA 2O9BA 1K25A 3B33A 2G2UA 3B42A 3HL9A 3ULFA 1IYQA 5GL9A 2J3TC 4I3AA 1PZOA 3BFEA 1S4RA 3T1RA 3KSGA 4N1HA 3M2JA 3ZFZA 1OJ5A 2J8YA 3LCEA 4EQ1A 3W4QA 1LSWA 3MZDA 3QP1A 2WGIA 5AVFA 4GD8A 1IEMA 3WRZA 3A0VA 4OQGA 2NUPC 4LLOB 2ZOHA 3OCLA 3W4OA 4G3VA 2Y2LA 4WF0A 1PWCA 2ZC5B 1MKMA 1E3UA 4LRYC 3V67A 1KGGA 4DDSA 1LI9A 1CI8A 1YMSA 3E2LA 5FEGA 3VSKA 4FSFA 2PR5A 2UV0E 1NJ4A 3GTCA 3IS2A 5G4ZA 3SS4A 3NDGA 4YWZA 2OAP1 2GX5A 2W3FA 1MC0A 3KSIA 3S7NA 1MXOA 1FR1A 1S66L 2QZ6A 3C38A 3BLMA 5GLAA 2VV7A 5HL6A 3I7JA 3HCYA 3O87A 2X01A 4P85A 3WWXA 4BQMA 3D3OA 3FYZA 1H5XA 2VGJA 1ES5A 4FOFA 4JGPA 2OLVA 4Y0OA 1RCJA 4NXFA 2QYBA 3ZCZA 2EX8A 3NOTC 4S2PA 3GECA 4E3OA 1IYSA 3FV7A 3DTIA 5DTSA 2E8JA
chains in the Genus database with same CATH topology
4E3LA 1W79A 1NZOA 1QMFA 1ERQA 3BRMA 1BLHA 4N1XA 1CEGA 5JYOA 2Y2KA 4S2KA 4GNUA 4E3MA 3GSGA 3BYDA 5TR7A 2EX2A 4QU3A 4JXSA 2Y55A 4KZ6A 1EROA 3M6BA 4JXGA 1IELA 2XFSA 4OOMA 3Q07A 3MKFA 1KDWA 5EVLA 5GLCA 1TDLA 1JWVA 2XQZA 3RJUA 1JWPA 3PBNA 1GCEA 2BLSA 5AQAA 1K38A 4Z9QA 3G30A 5CECA 1KE4A 2IWCA 3BFGA 2Q9NA 5E2EA 5D3OA 5GLBA 3NCKA 3C4OA 4PPRA 4X56A 2EX6A 4WZ4A 1ZG4A 2WGVA 2Y2QA 1KVLA 4U0TA 4WYYA 2XEPA 5FQMA 4Y0UA 5HW3A 4LV2A 2JBFA 1PWGA 1RP5A 5HARA 1PWDA 2IWBA 1ERMA 1XXMA 4O7DA 2Y2OA 2RL3A 2WZZA 4EUZA 5CHJA 4B4ZA 2B5RA 5CTNA 1MPLA 4JPMA 5CHMA 3UO9A 3M2KA 4K0XA 1N4OA 3PBSA 2H5SA 3O3VA 4X68A 2C5WB 2XD5A 2Z2MB 2P9VA 3NBLA 1JVJA 2ZM0A 3DW0A 1WE4A 5E2HA 4LCLA 2OSUA 1TEMA 3RXWA 4PM7A 1K57A 3IXDA 1DJAA 4E3KA 3GV9A 5EVIC 3HUMA 4S2MA 1S0WA 2EFUA 3C5AA 5J8XA 1BSGA 3HREA 3PBQA 4GKUA 4XXRA 2ZQ9A 2ZM2A 3A3EA 1FSWA 1XA7A 3LEZA 5I94A 2DRWA 1EI5A 4B4XA 1N9BA 5CERA 4U0XA 1PW8A 2HP6A 2JCHA 3CMZA 3QNCA 4RVAA 4WM9A 1YLPA 4X6TA 4DE0A 2XFTA 3HBRA 4PM5A 4KG6A 4KQOA 3V5MA 2EXAA 3PBTA 4YINA 5EVIB 4K91A 1ES2A 3BM6A 1ONHA 1PIOA 2GDNA 2A49A 2ZMAA 4WMCD 4ZAMA 1KGEA 5FI6A 2C6WB 2RCXA 5DF8A 5BOHA 1PI5A 5TFQA 5A90A 3VFHA 2HDSA 5DF9A 4DF6A 2WKHA 5EOEA 5FI2A 1K6RA 4C75A 1CEFA 4BL2A 2WADA 4LV0A 5KZHA 2XK1A 5GHYA 2J9OA 2ZC3B 5A93A 4IEDA 1K57C 4N9LA 2WYXA 5E2FA 1FCMA 2WKEA 2VGKA 5FQ9A 5A91A 1SCWA 5F82A 2ZM8A 2XDMA 3LY3A 4OPZA 2Y2NA 2V2FF 4R0QA 4X53A 3G35A 3NC8A 3HUNA 1XX2A 3IWOA 4M3KA 4MLLA 5FATA 1E4DA 4UA7A 1MBLA 1RGZA 3UN7A 1JTGA 3HLEA 4XUZA 4RYEA 1K56A 2ZQ7A 4C6YA 4D2OA 3ZG5A 4GDBA 5E43A 5FQJA 5A92A 2WZXA 2XR0A 3UE1A 3ITBA 4IVKA 3IF6B 3ZG8B 1ESIA 3MZEA 4WZ5A 5FAPA 2ZC7A 1PZPA 2H0TA 4A5RA 4JBFA 1ESUA 5FQKA 1IKGA 4HESA 4FCFA 1O7EA 1YLZA 4ZJ2A 3OC2A 2HPBA 1NY0A 1G68A 4IBXA 1C3BA 4DXCA 5EOOA 3N4IA 4PM8A 1RGYA 4JKTA 5DVAA 3IXGA 3SH9A 4LV1A 4KZBA 5EVIA 4WBGA 2P74A 4OQIA 2Y91A 3IH8A 3QHYA 3N8SA 4GDNA 2V1ZA 4PM9A 4PMAA 3VMAA 1E3UD 3ZDJA 4BD0A 2EXBA 3NI9A 3OPRA 3UPOA 4UHUA 5JYPA 3HLCA 1YMXA 4OLDA 3VP0A 3UDXA 3SOIA 3C7UA 4C3QA 3IHBA 1XP4A 3ISGA 4L0LA 3G2ZA 3P09A 1PI4A 5GHXA 1Q2PA 4HEFA 4E3IA 4EBLA 3ITAA 4EBPA 1DJCA 1NYMA 2WGWB 4OVDA 4KZ9A 1XKZA 2HP9A 3VP2A 3VOZA 4S2OA 1YLWA 3RXXA 5CXWA 5DTKA 2WUQA 3FZCA 2JE5A 2J9PA 4P87A 1KVMA 5M19A 1FOFA 4GOGA 4ZBEA 2FFYA 5HFOA 1HZOA 3FKVA 3O86A 1SHVA 3PBOA 4KZ5A 5E2GA 5GLDA 3S22A 5HL1A 1FQGA 2WAFA 4UAAA 3VOYA 3G2YA 3GMWA 1XGIA 2XLNA 5M1AA 1LI0A 5FSRA 2HDRA 4NK3A 5HAIA 3A3FA 4DDYA 4LCMA 4WZ5C 4FH2A 1M40A 1HVBA 5FQIA 4BL3A 3WS2A 2DNSA 2QMIA 4X69A 2Y2MA 1KE0A 3V39A 1PYYA 1GHMA 5M18A 1DJBA 2XH9A 5FASA 4E3NA 1XPBA 5CEBA 5CRFA 3GRJA 2ZQAA 4LENA 4S2LA 1LHYA 2WKIA 3IF6A 5EECA 4U3TA 1MWUA 1MY8A 4BD1A 3HLBA 4DRTA 4OONA 3NDEA 1Q2QA 1ZKJA 4KENB 5EUAA 2H10A 3VP1A 2OLUA 4BENA 3IH9A 1JTDA 1FR6A 3O88A 4MBFA 3HLWA 1YQSA 4ZJ1A 3WS1A 1WYBA 4KQQA 5F1GA 3V3RA 1BULA 3BLSA 5KMWA 1EWZA 4EBNA 2ZC6B 2X71A 3M6HA 2Y2HA 4ZJ3A 1NRFA 2DCFA 3EQUA 2Y2GA 1MWSA 5FDHA 2Z2LB 1TVFA 2BG1A 3MKEA 4JXVA 3N8LA 4KZ8A 1I2WA 4EV4A 3SS5A 2ZLYA 4IVIA 1VM1A 3VP3A 4QY5A 2WGWA 3MXSA 2Q9MA 4CPKA 3AGEA 1FSYA 3W4PA 3V50A 1Y54A 2EX9A 3OPPA 3UPNA 2PU2A 2HDQA 3WS0A 3A3IA 2PBYA 4MNRA 5EVID 1BLCA 4QY6A 2PU4A 1S6RA 3G32A 2ZQ8A 4FD8A 4ZDXA 2XD1A 3UE0A 1GA9A 1AXBA 3UNWA 3E2KA 2WAEA 4HBTA 1LLBA 4OP5A 3PAGA 5CHUA 4GD6A 1TDGA 5CEDA 3N6IA 2CC1A 1GA0A 4BJPA 3IF6C 1BLSA 1LL9A 3PBRA 4S2IA 4JF6A 1ZG6A 2A3UA 1KGFA 4JF4A 5CGWA 3EQVA 4RX3A 4KZ7A 4X55A 1KDSA 3BFFA 3PAEA 1IYOA 1H8YA 4OPRA 1K55A 1BZAA 1CK3A 4OQ0A 1LL5A 1J9MA 1L0FA 4NETA 4WEJA 3TG9A 4EQIA 3GQZA 3NY4A 3DTMA 3BFDA 4IBRA 3LO7A 4H8RA 3Q7ZA 2ZQCA 1QMEA 1XGJA 5EE8A 4S2NA 3IHAA 5FI7A 2ZJ9A 4WELA 4Y0TA 4KQRA 5TGFA 2Y59A 3Q7VA 5CGSA 4UA9A 3OPHA 5FQQA 2OV5A 4OPYA 2R9XA 2J7VA 3IWQA 1L0EA 1XA1A 1U60A 1DY6A 3ZG9B 1L2SA 4R23A 1ALQA 1BTLA 3Q81A 3GR2A 4OKPA 1GHIA 1IYPA 4N9KA 3A3DA 4QB8A 4MBHA 4QD4A 5AQBA 5HAPA 2HP5A 5KSHA 1ONGA 3WRTA 4DKIA 3MXRA 4GZBA 3GVBA 3C4PA 2XF3A 1NZUA 1YLTA 4MBKA 4N92A 2E8IA 3OPLA 1JWZA 4ZTKA 2IWDA 1MKIA 1WYCA 3BEBA 2ZD8A 3ZVTA 4F94A 3HLGA 4WMCA 4LV3A 3VP4A 4E6WA 4KG2A 1ZC2A 3IF5A 1W8YA 1BT5A 4DE2A 3Q1FA 2HDUA 5HX9A 3ZGAB 2FFFB 3ZG0A 4ID4A 2R9WA 4Q8IA 4OH0A 1YT4A 3BECA 1O07A 5CTMA 1K25A 1L0DA 3SH7A 1E25A 1K55C 2G2UA 4P6BA 5KSCA 3HL9A 4OQHA 3IXBA 3FWLA 3VSLA 1IYQA 1ES3A 4OPQA 4JF5A 5GL9A 3HUOA 1ES4A 3IWIA 4S2NC 4RX2A 3NIAA 4BLMA 1NXYA 1PZOA 1YLYA 3C7VA 4KZ3A 4OOLA 3G34A 3BFEA 5CGXA 4R4RA 3DWKA 4N1HA 3TSGA 4DXBA 4E3JA 3M2JA 3MZFA 3ZFZA 3PTEA 2J8YA 1SDNA 2H0YA 3WS5A 1OMEA 3LCEA 4FH4A 3AGFA 3W4QA 2JC7A 3IXHA 3MZDA 3Q82A 4KZAA 2Y2IA 2WGIA 4R4SA 1W7FA 3Q7VB 3OZHA 4KG5A 3IT9A 3WS4A 3ZVWA 3MBZA 4K0WA 1K54C 4GD8A 3ZHHA 2X02A 5U47A 3UE3A 1IEMA 3WRZA 4OQGA 5AQ7A 5FA7A 4OOYA 1K56D 1K6SA 3N8RA 4UA6A 2WK0A 3UPPA 5F1FA 3S4XA 3QNBA 3ZNYA 5F83A 4RA7A 2UWXA 3OCLA 1I2SA 1G6AA 3VFFA 3W4OA 2Y2LA 4P0MA 1PWCA 2ZC5B 1E3UA 2Y4AA 3FKWA 4R1GA 1HTZA 3B3XA 1SDEA 1KGGA 3A3JA 4DDSA 1LI9A 2G2WA 1K4EA 3CZDA 3ZG7B 4R3JA 1CI8A 1YMSA 3E2LA 3MFDA 2ZQDA 3P98A 1MWTA 3G4PA 5FAQA 1W5DA 3VSKA 4FSFA 1NJ4A 1MWRA 3UDIA 4DE1A 4JLFA 3GTCA 1IKIA 2Y2JA 3HLFA 5GHZA 3SS3A 2XGNA 1YM1A 5FAOA 2I72A 5IHVA 3SS4A 3NDGA 4EWFA 4QHCA 5DF7A 1BUEA 1KE3A 1YLJA 1MXOA 1VQQA 1FR1A 1W8QA 3N7WA 1CI9A 2Y2PA 2QZ6A 5GLAA 1SKFA 3BLMA 3ZNTA 5G18A 4B88A 3CJMA 3HVFA 4E6XA 3I7JA 2X01A 3O87A 4MEZA 4P85A 3DWZA 3WWXA 3TOIA 4CJNA 1H8ZA 1FCOA 4OLGA 4BQMA 2V20A 1FCNA 5EPHA 4S2JA 4HBUA 4JXWA 4R3BA 1M6KA 1L0GA 5L2FA 3FYZA 3OCNA 4DE3A 1Z6FA 1NYYA 1H5XA 3BFCA 4PM6A 3SH8A 1HD8A 2EFXA 2VGJA 4KZ4A 5AQ9A 1ES5A 3D4FA 4GB7A 3LY4A 1BLPA 4Y7PA 2OLVA 3W8KA 4Y0OA 2P9VB 1GHPA 1RCJA 2ZC4B 3CG5A 3UY6A 3ZCZA 1I5QA 2EX8A 1K4FA 4S2PA 4WEKA 4XUXA 2QPNA 3AGDA 3HLDA 3JYIA 3S1YA 5HAQA 4E3OA 3G31A 3UDFA 4GN2A 5DTTA 3V3SA 4QJGA 1IYSA 1K54A 4YFMA 3FV7A 3IQAA 5DTSA 1PW1A 4OP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E3L A;  1W79 A;  1NZO A;  1QMF A;  1ERQ A;  3BRM A;  1BLH A;  4N1X A;  1CEG A;  5JYO A;  2Y2K A;  4S2K A;  4GNU A;  4E3M A;  3GSG A;  3BYD A;  5TR7 A;  2EX2 A;  4QU3 A;  4JXS A;  2Y55 A;  4KZ6 A;  1ERO A;  3M6B A;  4JXG A;  1IEL A;  2XFS A;  4OOM A;  3Q07 A;  3MKF A;  1KDW A;  5EVL A;  5GLC A;  1TDL A;  1JWV A;  2XQZ A;  3RJU A;  1JWP A;  3PBN A;  1GCE A;  2BLS A;  5AQA A;  1K38 A;  4Z9Q A;  3G30 A;  5CEC A;  1KE4 A;  2IWC A;  3BFG A;  2Q9N A;  5E2E A;  5D3O A;  5GLB A;  3NCK A;  3C4O A;  4PPR A;  4X56 A;  2EX6 A;  4WZ4 A;  1ZG4 A;  2WGV A;  2Y2Q A;  1KVL A;  4U0T A;  4WYY A;  2XEP A;  5FQM A;  4Y0U A;  5HW3 A;  4LV2 A;  2JBF A;  1PWG A;  1RP5 A;  5HAR A;  1PWD A;  2IWB A;  1ERM A;  1XXM A;  4O7D A;  2Y2O A;  2RL3 A;  2WZZ A;  4EUZ A;  5CHJ A;  4B4Z A;  2B5R A;  5CTN A;  1MPL A;  4JPM A;  5CHM A;  3UO9 A;  3M2K A;  4K0X A;  1N4O A;  3PBS A;  2H5S A;  3O3V A;  4X68 A;  2C5W B;  2XD5 A;  2Z2M B;  2P9V A;  3NBL A;  1JVJ A;  2ZM0 A;  3DW0 A;  1WE4 A;  5E2H A;  4LCL A;  2OSU A;  1TEM A;  3RXW A;  4PM7 A;  1K57 A;  3IXD A;  1DJA A;  4E3K A;  3GV9 A;  5EVI C;  3HUM A;  4S2M A;  1S0W A;  2EFU A;  3C5A A;  5J8X A;  1BSG A;  3HRE A;  3PBQ A;  4GKU A;  4XXR A;  2ZQ9 A;  2ZM2 A;  3A3E A;  1FSW A;  1XA7 A;  3LEZ A;  5I94 A;  2DRW A;  1EI5 A;  4B4X A;  1N9B A;  5CER A;  4U0X A;  1PW8 A;  2HP6 A;  2JCH A;  3CMZ A;  3QNC A;  4RVA A;  4WM9 A;  1YLP A;  4X6T A;  4DE0 A;  2XFT A;  3HBR A;  4PM5 A;  4KG6 A;  4KQO A;  3V5M A;  2EXA A;  3PBT A;  4YIN A;  5EVI B;  4K91 A;  1ES2 A;  3BM6 A;  1ONH A;  1PIO A;  2GDN A;  2A49 A;  2ZMA A;  4WMC D;  4ZAM A;  1KGE A;  5FI6 A;  2C6W B;  2RCX A;  5DF8 A;  5BOH A;  1PI5 A;  5TFQ A;  5A90 A;  3VFH A;  2HDS A;  5DF9 A;  4DF6 A;  2WKH A;  5EOE A;  5FI2 A;  1K6R A;  4C75 A;  1CEF A;  4BL2 A;  2WAD A;  4LV0 A;  5KZH A;  2XK1 A;  5GHY A;  2J9O A;  2ZC3 B;  5A93 A;  4IED A;  1K57 C;  4N9L A;  2WYX A;  5E2F A;  1FCM A;  2WKE A;  2VGK A;  5FQ9 A;  5A91 A;  1SCW A;  5F82 A;  2ZM8 A;  2XDM A;  3LY3 A;  4OPZ A;  2Y2N A;  2V2F F;  4R0Q A;  4X53 A;  3G35 A;  3NC8 A;  3HUN A;  1XX2 A;  3IWO A;  4M3K A;  4MLL A;  5FAT A;  1E4D A;  4UA7 A;  1MBL A;  1RGZ A;  3UN7 A;  1JTG A;  3HLE A;  4XUZ A;  4RYE A;  1K56 A;  2ZQ7 A;  4C6Y A;  4D2O A;  3ZG5 A;  4GDB A;  5E43 A;  5FQJ A;  5A92 A;  2WZX A;  2XR0 A;  3UE1 A;  3ITB A;  4IVK A;  3IF6 B;  3ZG8 B;  1ESI A;  3MZE A;  4WZ5 A;  5FAP A;  2ZC7 A;  1PZP A;  2H0T A;  4A5R A;  4JBF A;  1ESU A;  5FQK A;  1IKG A;  4HES A;  4FCF A;  1O7E A;  1YLZ A;  4ZJ2 A;  3OC2 A;  2HPB A;  1NY0 A;  1G68 A;  4IBX A;  1C3B A;  4DXC A;  5EOO A;  3N4I A;  4PM8 A;  1RGY A;  4JKT A;  5DVA A;  3IXG A;  3SH9 A;  4LV1 A;  4KZB A;  5EVI A;  4WBG A;  2P74 A;  4OQI A;  2Y91 A;  3IH8 A;  3QHY A;  3N8S A;  4GDN A;  2V1Z A;  4PM9 A;  4PMA A;  3VMA A;  1E3U D;  3ZDJ A;  4BD0 A;  2EXB A;  3NI9 A;  3OPR A;  3UPO A;  4UHU A;  5JYP A;  3HLC A;  1YMX A;  4OLD A;  3VP0 A;  3UDX A;  3SOI A;  3C7U A;  4C3Q A;  3IHB A;  1XP4 A;  3ISG A;  4L0L A;  3G2Z A;  3P09 A;  1PI4 A;  5GHX A;  1Q2P A;  4HEF A;  4E3I A;  4EBL A;  3ITA A;  4EBP A;  1DJC A;  1NYM A;  2WGW B;  4OVD A;  4KZ9 A;  1XKZ A;  2HP9 A;  3VP2 A;  3VOZ A;  4S2O A;  1YLW A;  3RXX A;  5CXW A;  5DTK A;  2WUQ A;  3FZC A;  2JE5 A;  2J9P A;  4P87 A;  1KVM A;  5M19 A;  1FOF A;  4GOG A;  4ZBE A;  2FFY A;  5HFO A;  1HZO A;  3FKV A;  3O86 A;  1SHV A;  3PBO A;  4KZ5 A;  5E2G A;  5GLD A;  3S22 A;  5HL1 A;  1FQG A;  2WAF A;  4UAA A;  3VOY A;  3G2Y A;  3GMW A;  1XGI A;  2XLN A;  5M1A A;  1LI0 A;  5FSR A;  2HDR A;  4NK3 A;  5HAI A;  3A3F A;  4DDY A;  4LCM A;  4WZ5 C;  4FH2 A;  1M40 A;  1HVB A;  5FQI A;  4BL3 A;  3WS2 A;  2DNS A;  2QMI A;  4X69 A;  2Y2M A;  1KE0 A;  3V39 A;  1PYY A;  1GHM A;  5M18 A;  1DJB A;  2XH9 A;  5FAS A;  4E3N A;  1XPB A;  5CEB A;  5CRF A;  3GRJ A;  2ZQA A;  4LEN A;  4S2L A;  1LHY A;  2WKI A;  3IF6 A;  5EEC A;  4U3T A;  1MWU A;  1MY8 A;  4BD1 A;  3HLB A;  4DRT A;  4OON A;  3NDE A;  1Q2Q A;  1ZKJ A;  4KEN B;  5EUA A;  2H10 A;  3VP1 A;  2OLU A;  4BEN A;  3IH9 A;  1JTD A;  1FR6 A;  3O88 A;  4MBF A;  3HLW A;  1YQS A;  4ZJ1 A;  3WS1 A;  1WYB A;  4KQQ A;  5F1G A;  3V3R A;  1BUL A;  3BLS A;  5KMW A;  1EWZ A;  4EBN A;  2ZC6 B;  2X71 A;  3M6H A;  2Y2H A;  4ZJ3 A;  1NRF A;  2DCF A;  3EQU A;  2Y2G A;  1MWS A;  5FDH A;  2Z2L B;  1TVF A;  2BG1 A;  3MKE A;  4JXV A;  3N8L A;  4KZ8 A;  1I2W A;  4EV4 A;  3SS5 A;  2ZLY A;  4IVI A;  1VM1 A;  3VP3 A;  4QY5 A;  2WGW A;  3MXS A;  2Q9M A;  4CPK A;  3AGE A;  1FSY A;  3W4P A;  3V50 A;  1Y54 A;  2EX9 A;  3OPP A;  3UPN A;  2PU2 A;  2HDQ A;  3WS0 A;  3A3I A;  2PBY A;  4MNR A;  5EVI D;  1BLC A;  4QY6 A;  2PU4 A;  1S6R A;  3G32 A;  2ZQ8 A;  4FD8 A;  4ZDX A;  2XD1 A;  3UE0 A;  1GA9 A;  1AXB A;  3UNW A;  3E2K A;  2WAE A;  4HBT A;  1LLB A;  4OP5 A;  3PAG A;  5CHU A;  4GD6 A;  1TDG A;  5CED A;  3N6I A;  2CC1 A;  1GA0 A;  4BJP A;  3IF6 C;  1BLS A;  1LL9 A;  3PBR A;  4S2I A;  4JF6 A;  1ZG6 A;  2A3U A;  1KGF A;  4JF4 A;  5CGW A;  3EQV A;  4RX3 A;  4KZ7 A;  4X55 A;  1KDS A;  3BFF A;  3PAE A;  1IYO A;  1H8Y A;  4OPR A;  1K55 A;  1BZA A;  1CK3 A;  4OQ0 A;  1LL5 A;  1J9M A;  1L0F A;  4NET A;  4WEJ A;  3TG9 A;  4EQI A;  3GQZ A;  3NY4 A;  3DTM A;  3BFD A;  4IBR A;  3LO7 A;  4H8R A;  3Q7Z A;  2ZQC A;  1QME A;  1XGJ A;  5EE8 A;  4S2N A;  3IHA A;  5FI7 A;  2ZJ9 A;  4WEL A;  4Y0T A;  4KQR A;  5TGF A;  2Y59 A;  3Q7V A;  5CGS A;  4UA9 A;  3OPH A;  5FQQ A;  2OV5 A;  4OPY A;  2R9X A;  2J7V A;  3IWQ A;  1L0E A;  1XA1 A;  1U60 A;  1DY6 A;  3ZG9 B;  1L2S A;  4R23 A;  1ALQ A;  1BTL A;  3Q81 A;  3GR2 A;  4OKP A;  1GHI A;  1IYP A;  4N9K A;  3A3D A;  4QB8 A;  4MBH A;  4QD4 A;  5AQB A;  5HAP A;  2HP5 A;  5KSH A;  1ONG A;  3WRT A;  4DKI A;  3MXR A;  4GZB A;  3GVB A;  3C4P A;  2XF3 A;  1NZU A;  1YLT A;  4MBK A;  4N92 A;  2E8I A;  3OPL A;  1JWZ A;  4ZTK A;  2IWD A;  1MKI A;  1WYC A;  3BEB A;  2ZD8 A;  3ZVT A;  4F94 A;  3HLG A;  4WMC A;  4LV3 A;  3VP4 A;  4E6W A;  4KG2 A;  1ZC2 A;  3IF5 A;  1W8Y A;  1BT5 A;  4DE2 A;  3Q1F A;  2HDU A;  5HX9 A;  3ZGA B;  2FFF B;  3ZG0 A;  4ID4 A;  2R9W A;  4Q8I A;  4OH0 A;  1YT4 A;  3BEC A;  1O07 A;  5CTM A;  1K25 A;  1L0D A;  3SH7 A;  1E25 A;  1K55 C;  2G2U A;  4P6B A;  5KSC A;  3HL9 A;  4OQH A;  3IXB A;  3FWL A;  3VSL A;  1IYQ A;  1ES3 A;  4OPQ A;  4JF5 A;  5GL9 A;  3HUO A;  1ES4 A;  3IWI A;  4S2N C;  4RX2 A;  3NIA A;  4BLM A;  1NXY A;  1PZO A;  1YLY A;  3C7V A;  4KZ3 A;  4OOL A;  3G34 A;  3BFE A;  5CGX A;  4R4R A;  3DWK A;  4N1H A;  3TSG A;  4DXB A;  4E3J A;  3M2J A;  3MZF A;  3ZFZ A;  3PTE A;  2J8Y A;  1SDN A;  2H0Y A;  3WS5 A;  1OME A;  3LCE A;  4FH4 A;  3AGF A;  3W4Q A;  2JC7 A;  3IXH A;  3MZD A;  3Q82 A;  4KZA A;  2Y2I A;  2WGI A;  4R4S A;  1W7F A;  3Q7V B;  3OZH A;  4KG5 A;  3IT9 A;  3WS4 A;  3ZVW A;  3MBZ A;  4K0W A;  1K54 C;  4GD8 A;  3ZHH A;  2X02 A;  5U47 A;  3UE3 A;  1IEM A;  3WRZ A;  4OQG A;  5AQ7 A;  5FA7 A;  4OOY A;  1K56 D;  1K6S A;  3N8R A;  4UA6 A;  2WK0 A;  3UPP A;  5F1F A;  3S4X A;  3QNB A;  3ZNY A;  5F83 A;  4RA7 A;  2UWX A;  3OCL A;  1I2S A;  1G6A A;  3VFF A;  3W4O A;  2Y2L A;  4P0M A;  1PWC A;  2ZC5 B;  1E3U A;  2Y4A A;  3FKW A;  4R1G A;  1HTZ A;  3B3X A;  1SDE A;  1KGG A;  3A3J A;  4DDS A;  1LI9 A;  2G2W A;  1K4E A;  3CZD A;  3ZG7 B;  4R3J A;  1CI8 A;  1YMS A;  3E2L A;  3MFD A;  2ZQD A;  3P98 A;  1MWT A;  3G4P A;  5FAQ A;  1W5D A;  3VSK A;  4FSF A;  1NJ4 A;  1MWR A;  3UDI A;  4DE1 A;  4JLF A;  3GTC A;  1IKI A;  2Y2J A;  3HLF A;  5GHZ A;  3SS3 A;  2XGN A;  1YM1 A;  5FAO A;  2I72 A;  5IHV A;  3SS4 A;  3NDG A;  4EWF A;  4QHC A;  5DF7 A;  1BUE A;  1KE3 A;  1YLJ A;  1MXO A;  1VQQ A;  1FR1 A;  1W8Q A;  3N7W A;  1CI9 A;  2Y2P A;  2QZ6 A;  5GLA A;  1SKF A;  3BLM A;  3ZNT A;  5G18 A;  4B88 A;  3CJM A;  3HVF A;  4E6X A;  3I7J A;  2X01 A;  3O87 A;  4MEZ A;  4P85 A;  3DWZ A;  3WWX A;  3TOI A;  4CJN A;  1H8Z A;  1FCO A;  4OLG A;  4BQM A;  2V20 A;  1FCN A;  5EPH A;  4S2J A;  4HBU A;  4JXW A;  4R3B A;  1M6K A;  1L0G A;  5L2F A;  3FYZ A;  3OCN A;  4DE3 A;  1Z6F A;  1NYY A;  1H5X A;  3BFC A;  4PM6 A;  3SH8 A;  1HD8 A;  2EFX A;  2VGJ A;  4KZ4 A;  5AQ9 A;  1ES5 A;  3D4F A;  4GB7 A;  3LY4 A;  1BLP A;  4Y7P A;  2OLV A;  3W8K A;  4Y0O A;  2P9V B;  1GHP A;  1RCJ A;  2ZC4 B;  3CG5 A;  3UY6 A;  3ZCZ A;  1I5Q A;  2EX8 A;  1K4F A;  4S2P A;  4WEK A;  4XUX A;  2QPN A;  3AGD A;  3HLD A;  3JYI A;  3S1Y A;  5HAQ A;  4E3O A;  3G31 A;  3UDF A;  4GN2 A;  5DTT A;  3V3S A;  4QJG A;  1IYS A;  1K54 A;  4YFM A;  3FV7 A;  3IQA A;  5DTS A;  1PW1 A;  4OP8 A; 
#chains in the Genus database with same CATH topology
 4X25 A;  1W79 A;  1NZO A;  1P0Z A;  2W3D A;  2H28 A;  4N1X A;  4WN5 A;  1D06 A;  4GNU A;  5EFW A;  4JXS A;  4EEP A;  3M6B A;  1IEL A;  5G4Y A;  3H7W A;  5GLC A;  2Y79 A;  2P7J A;  3T4T A;  3FPW A;  3G30 A;  3BFG A;  2Q9N A;  3NCK A;  3C8C A;  2W1T A;  2EX6 A;  4WZ4 A;  2XA7 S;  2WGV A;  1KVL A;  4U0T A;  4WYY A;  2XEP A;  3QP6 A;  4Y0U A;  2JBF A;  3T4L A;  1ZHH B;  2IWB A;  2QHK A;  4O7D A;  2RL3 A;  2WZZ A;  4EUZ A;  4B4Z A;  2B5R A;  5CTN A;  1MPL A;  5CHM A;  3UO9 A;  2C5W B;  2P9V A;  3NBL A;  3DW0 A;  4LCL A;  3RXW A;  1DJA A;  4E3K A;  1S0W A;  3C5A A;  2V1B A;  3KSH A;  3PBQ A;  2ZQ9 A;  2V9A A;  3PHY A;  4I39 A;  3NUL A;  1EI5 A;  4B4X A;  5DKK A;  2HP6 A;  4WM9 A;  4X6T A;  4KG6 A;  5EVI B;  2Q0O A;  3BM6 A;  3VE3 A;  3CIT A;  4ZAM A;  3D72 A;  5FI6 A;  2RCX A;  5A90 A;  2HDS A;  5DF9 A;  5FI2 A;  1K6R A;  4KQD A;  2OWH A;  4N9L A;  2WYX A;  4BBU A;  1FCM A;  1YAX A;  2VGK A;  5FQ9 A;  3UB8 A;  3ZYT A;  1SCW A;  5F82 A;  3K3C A;  4X53 A;  2KLI A;  3HUN A;  1XX2 A;  4M3K A;  4MLL A;  1E4D A;  4RYE A;  1ODV A;  1K56 A;  5FQJ A;  5A92 A;  2L0W A;  3ITB A;  4IVK A;  3T4Q A;  3UB7 A;  1T18 A;  4WZ5 A;  1PZP A;  2H0T A;  1SKO A;  4A5R A;  3OC2 A;  1H3Q A;  4PM8 A;  5DVA A;  4WBG A;  1XFN A;  5F6A A;  3IH8 A;  3ZDJ A;  4GDN A;  4BD0 A;  4UHU A;  3VP0 A;  3SOI A;  2A2L A;  3C7U A;  3CUE C;  3IHB A;  3ISG A;  3T50 A;  2W3H A;  1G28 A;  3ITA A;  4I3J A;  4KZ9 A;  3LIF A;  2KX6 A;  4S2O A;  1YLW A;  2WUQ A;  2HJE A;  4PAU A;  4GOG A;  1FQG A;  4EET B;  5EM0 A;  4UAA A;  1D7E A;  3HJI A;  3LIB A;  3GMW A;  4ESP A;  5FSR A;  2HDR A;  3A3F A;  3OLO A;  5TBM B;  1Y4O A;  5FQI A;  2QMI A;  4X69 A;  4BBT A;  1GHM A;  2WKR A;  2JKG A;  5M18 A;  4EUV A;  5CRF A;  3CLO A;  1SZV A;  4DJ2 A;  4KUO A;  1MWU A;  4KEN B;  2HGV A;  3MFX A;  2OLU A;  1GSX A;  1VET B;  2HV1 A;  3HLW A;  2FH5 A;  3JVU A;  3WS1 A;  3MJQ A;  5KMW A;  2X71 A;  3E4O A;  3LEQ A;  3C2W A;  3F1P A;  4Y13 A;  1T19 A;  5FDH A;  1TVF A;  4CLC E;  4GCZ A;  3SS5 A;  2ZLY A;  5DKL A;  2I9V A;  3VP3 A;  4I3I A;  2WGW A;  4MNR A;  3MMH A;  2HZ5 A;  5A8B A;  1S6R A;  2PRF A;  3UE0 A;  3UNW A;  3E2K A;  5HWV A;  4HBT A;  4OP5 A;  3DBA A;  4WUJ A;  4GD6 A;  2CC1 A;  4BJP A;  1FIK A;  3EQV A;  1WA9 A;  2K2N A;  3TJZ C;  3PAE A;  1BZA A;  4OQ0 A;  1LL5 A;  1L0F A;  5HZH A;  3NY4 A;  3DTM A;  2ZQC A;  1XGJ A;  4Y0T A;  2ZJ9 A;  4WEL A;  4KQR A;  3S7P A;  5HSQ A;  1DP6 A;  4H6J B;  5FQQ A;  1L3L A;  2J7V A;  3IWQ A;  4LFU A;  4O0P A;  1DY6 A;  3BQ8 A;  3LFV A;  2ZMV A;  3ZG9 B;  4NKP A;  1L2S A;  5J7E A;  3Q81 A;  1ACF A;  4QB8 A;  3WRT A;  1TF1 A;  4GZB A;  3GVB A;  2XF3 A;  3CI6 A;  4MBK A;  3LR3 A;  4ZTK A;  2IWD A;  3BEB A;  2ZD8 A;  1P9R A;  4ARZ A;  4QPR A;  4KG2 A;  1Y28 A;  3IF5 A;  1W8Y A;  3Q1F A;  5HX9 A;  3ZGA B;  1XJ2 A;  4Q8I A;  2M7U A;  1YT4 A;  1O07 A;  1H0M A;  1E25 A;  1K55 C;  4P6B A;  3IXB A;  4UQI S;  1OTB A;  4JF5 A;  3HUO A;  1ES4 A;  4S2N C;  4GHI A;  4RX2 A;  4RQ9 A;  3H82 B;  5CGX A;  1OT9 A;  3DWK A;  4DXB A;  3MZF A;  3CPT B;  3T1X A;  2H0Y A;  2JC7 A;  2B18 A;  4KZA A;  2Y2I A;  3LR4 A;  3Q7V B;  3R4K A;  4KG5 A;  3EGD C;  3ZHH A;  5U47 A;  4X1M A;  2XRO A;  3N8R A;  2WK0 A;  3A0R A;  2L1M A;  3QNB A;  5F83 A;  2UWX A;  1I2S A;  1G6A A;  1HLU P;  4R1G A;  2Y4A A;  3FKW A;  3GDI A;  1K4E A;  2OWJ A;  2Z6D A;  4BWI A;  1IKI A;  2Y2J A;  5GHZ A;  5IHV A;  2I72 A;  2INW A;  4F3L A;  1OTE A;  1KE3 A;  1YLJ A;  5IT5 A;  2MJ6 A;  5HPF A;  3T1S A;  1CI9 A;  2Y2P A;  2JKR I;  4B88 A;  3OBF A;  3HVF A;  3R7W A;  4E6X A;  5HDC A;  3F1O B;  1H8Z A;  4OLG A;  4R70 A;  5EPH A;  2QKP A;  1M6K A;  3E98 A;  4PM6 A;  3SH8 A;  1HD8 A;  4Y2F A;  5AQ9 A;  3IBR A;  1NLZ A;  3LY4 A;  2VKS A;  3CG5 A;  4M4X A;  4WLA A;  4WEK A;  4XUX A;  5F5Y A;  3S1Y A;  5HAQ A;  3LR5 A;  4GN2 A;  5DTT A;  4QJG A;  2BAS A;  1PW1 A;  4E3L A;  4LRX C;  4GS9 A;  4EEU A;  3IX4 A;  3BRM A;  3TRC A;  2Y2K A;  3BYD A;  4QU3 A;  2ZL1 A;  4JXG A;  4JGO A;  4OOM A;  3Q07 A;  3MKF A;  1KDW A;  5EVL A;  1TDL A;  3FPV A;  2XQZ A;  3RJU A;  3PBN A;  5AQA A;  1XJ3 A;  5CEC A;  1KE4 A;  1PFL A;  3C4O A;  4X56 A;  2Y2Q A;  5HW3 A;  2ZOI A;  1XXM A;  2Y2O A;  2EA9 A;  2VV8 A;  1W63 M;  4JPM A;  1N4O A;  1TS7 A;  2H5S A;  3O3V A;  2XD5 A;  2Z2M B;  3EEH A;  4PM7 A;  3IX8 A;  1V9Z A;  4G3W A;  3TE8 A;  4S2M A;  4MN5 A;  3MSH A;  1OTA A;  5J8X A;  3UME A;  1BSG A;  3HRE A;  2QWS A;  3MQO A;  5IS1 A;  1FSW A;  1XA7 A;  4CLC A;  2VV6 A;  1N9B A;  4RVA A;  4DE0 A;  2XFT A;  2EXA A;  2W0N A;  4K91 A;  1ES2 A;  1ONH A;  5I5L A;  2GDN A;  2ZMA A;  1W63 Q;  4IUH A;  5EV0 A;  5DF8 A;  1K0K A;  3VFH A;  4B93 A;  4DF6 A;  2WKH A;  2VX8 A;  1CEF A;  4BL2 A;  2WAD A;  2J9O A;  5EM1 A;  5A93 A;  1LSV A;  1K57 C;  4Y17 A;  1VHM A;  5LBR A;  2ZM8 A;  3LY3 A;  3MR0 A;  2V2F F;  4R0Q A;  3G35 A;  5HDD A;  3NC8 A;  5FAT A;  5FDS A;  3HLE A;  4XUZ A;  2ZQ7 A;  4D2O A;  4GDB A;  2WZX A;  1NWZ A;  5L07 A;  1BYW A;  4JBF A;  4P6Z M;  4FCF A;  4ZJ2 A;  2HPB A;  1NY0 A;  2QJ5 A;  1G68 A;  4IBX A;  1TS0 A;  1F2K A;  3N4I A;  1RGY A;  1N9N A;  4JKT A;  3IXG A;  2Y91 A;  3MQ0 A;  2Y8H A;  2VJW A;  1E3U D;  3F1N B;  2EXB A;  3OPR A;  5JYP A;  3UDX A;  2Z6C A;  1CJF A;  1YKD A;  2PHY A;  4L0L A;  4CLC D;  3VE4 A;  4OVD A;  1IFQ A;  2HJ9 C;  5CXW A;  5L8M A;  3KYZ A;  5M19 A;  3E4P A;  5HFO A;  2FFY A;  3RTY A;  3FKV A;  3O86 A;  1N9L A;  5E2G A;  5HL1 A;  1UWN X;  1KOU A;  5MC7 A;  1XGI A;  2XLN A;  1LI0 A;  5HAI A;  4DJ3 A;  2J3W A;  5FEF A;  2DNS A;  1KE0 A;  4AFI A;  1PYY A;  4Y5F A;  5FAS A;  2QJ7 A;  4LEN A;  4S2L A;  2WKI A;  3IF6 A;  1ZTU A;  1MY8 A;  2EWV A;  4DRT A;  1FR6 A;  1YQS A;  2VGL S;  5F1G A;  4EBN A;  2ZC6 B;  2W1R A;  1NRF A;  2Y2G A;  2W27 A;  3MKE A;  4JXV A;  4IJG A;  4D60 A;  1OT6 A;  1A0K A;  1VM1 A;  4L9G A;  4MCW A;  2Q9M A;  3LID A;  1FSY A;  3V50 A;  3WS0 A;  3A3I A;  2PBY A;  3OOV A;  4R6L A;  4ME4 A;  1BLC A;  5J3W A;  4QY6 A;  1YSQ A;  3G32 A;  4FD8 A;  1AXB A;  2WAE A;  5CED A;  3BWL A;  1GA0 A;  4S2I A;  1LL9 A;  2V0U A;  2A3U A;  1KDS A;  2YKF A;  1S1Y A;  1J9M A;  3CPT A;  4WEJ A;  3TG9 A;  3BFD A;  4H8R A;  1XJ4 A;  5FI7 A;  5TGF A;  3HJK A;  2Y59 A;  3Q7V A;  2OV5 A;  4OPY A;  2R9X A;  2M1C A;  5HAP A;  3A3D A;  1H8M A;  5AQB A;  4DKI A;  3MXR A;  2PYR A;  4PKY A;  1NZU A;  4N92 A;  2E8I A;  3OPL A;  1JWZ A;  1WYC A;  3ZVT A;  4F94 A;  3T4K A;  4WMC A;  2PYP A;  1JNU A;  4DE2 A;  3LIA A;  1VEU A;  2R9W A;  3H9W A;  3EGX C;  5CTM A;  1L0D A;  4NG2 A;  3IS2 B;  4OQH A;  3E0Y A;  3U2A A;  4OPQ A;  4HHD A;  3IWI A;  3NEC A;  4BLM A;  1NXY A;  1YLY A;  3C7V A;  4KZ3 A;  3G34 A;  4EXO A;  5CX7 A;  3T4S A;  4E3J A;  5DFX A;  1SDN A;  1OJG A;  4JGR A;  1OME A;  3AGF A;  3IXH A;  3L7H A;  5HPI A;  2A24 A;  3OZH A;  3IT9 A;  3MBZ A;  1G6O A;  4K0W A;  4HIA A;  3DTE A;  4LGW A;  5AQ7 A;  1K56 D;  1K6S A;  4UA6 A;  3S4X A;  3ZNY A;  4ETZ A;  4RA7 A;  5FL3 A;  3VFF A;  1SDE A;  3T1Q B;  3CZD A;  4CQH A;  2ZQD A;  3P98 A;  1NRJ A;  3G4P A;  5FAQ A;  1W5D A;  4B9O A;  3K2N A;  1YM1 A;  1IOU A;  4EWF A;  4QHC A;  1BUE A;  3H7W B;  3UB6 A;  3G6O A;  1W8Q A;  3N7W A;  1S4S A;  3ZNT A;  2PT7 A;  2O9A A;  1G5U A;  4DN0 A;  1STZ A;  2W1T B;  3B47 A;  3LYX A;  5HD5 A;  1UWP X;  1FCO A;  3SZT A;  2V20 A;  1FCN A;  4HBU A;  4R3B A;  3KYE A;  1L0G A;  3K3D A;  5L2F A;  3LIC A;  4DE3 A;  1Z6F A;  3BFC A;  2EFX A;  4GB7 A;  4CLC C;  4Y7P A;  3W8K A;  2P9V B;  1GHP A;  2ZC4 B;  3UY6 A;  2JKR M;  3G31 A;  3V3S A;  1K54 A;  4YFM A;  3IQA A;  3LUQ A;  4BMW A;  4OP8 A;  5AVE A;  4JGQ A;  1ERQ A;  1P9W A;  3BY8 A;  4EU0 A;  1CEG A;  4S2K A;  3GSG A;  5TR7 A;  2EX2 A;  1MZU A;  1TS6 A;  1N9O A;  1JWV A;  1FIL A;  5L09 A;  5F69 A;  2JKT I;  2BLS A;  4LPZ A;  1K38 A;  4Z9Q A;  4KUK A;  2IWC A;  5E2E A;  4HOI A;  4PPR A;  5F68 A;  3LI9 A;  4LV2 A;  1PWG A;  1RP5 A;  5HAR A;  1PWD A;  1ERM A;  3RH8 B;  1EW0 A;  4K0X A;  2ZM0 A;  2O99 A;  1TEM A;  3IXD A;  4L9F A;  1DRM A;  3GV9 A;  4Q0H A;  3HUM A;  2EFU A;  4GKU A;  1SKO B;  2ZM2 A;  3A3E A;  5DJU A;  5I94 A;  2DRW A;  4U0X A;  2JCH A;  3CMZ A;  3QNC A;  4DMZ A;  4KQO A;  3V5M A;  3IBJ A;  3PBT A;  4YIN A;  2GJ3 A;  3F1N A;  1PIO A;  1KGE A;  3W2Z A;  2PD8 A;  2KOI A;  5BOH A;  1PI5 A;  3KO6 A;  5EOE A;  4C75 A;  1TD5 A;  4LV0 A;  2YKH A;  2AVX A;  3PXP A;  2XK1 A;  3CUE A;  4IED A;  4IHQ A;  5E2F A;  2WKE A;  5A91 A;  2G7U A;  2XDM A;  1PNE A;  5J4E A;  3UN7 A;  3ICY A;  4C6Y A;  1S1Z A;  3UE1 A;  3ZG8 B;  1ESI A;  3MZE A;  5FAP A;  2ZC7 A;  3DTK A;  4R38 A;  4FTX A;  5FQK A;  5EVE A;  2PDR A;  3FC7 A;  2PAV P;  4GW9 A;  3SH9 A;  5EVI A;  3F1P B;  4OQI A;  3QHY A;  4PM9 A;  3N8S A;  2V1Z A;  3NI9 A;  3UPO A;  1P97 A;  2CMN A;  4OLD A;  1YMX A;  4C3Q A;  1XP4 A;  1Q2P A;  4HEF A;  4E3I A;  4EBL A;  1D1J A;  2WGW B;  5HD3 A;  1XKZ A;  5HDS A;  3VP2 A;  3VOZ A;  5DTK A;  2JE5 A;  2J9P A;  1KVM A;  1FOF A;  4ZBE A;  3EWK A;  3PBO A;  2P08 A;  5GLD A;  2WAF A;  3VOY A;  3G2Y A;  4DDY A;  4LCM A;  4WZ5 C;  4FH2 A;  2IA2 A;  3T4O A;  3V39 A;  1GSW A;  1DJB A;  5CEB A;  2ZQA A;  1LHY A;  1LT0 A;  4U3T A;  4XT2 B;  4OON A;  3NDE A;  1Q2Q A;  1ZKJ A;  5EUA A;  2XSS A;  3VP1 A;  4BEN A;  5KIZ A;  3IH9 A;  1XJ6 A;  3O88 A;  4ZJ1 A;  5DFY A;  1YPR A;  1WYB A;  2FZ0 A;  3V3R A;  1BUL A;  4ZJ3 A;  1DP8 A;  3EQU A;  1MWS A;  4KZ8 A;  3UB5 P;  4ARZ B;  1OTI A;  3MXS A;  4CPK A;  3AGE A;  3OPP A;  3UE6 A;  2PU2 A;  2HDQ A;  5EVI D;  4MDZ A;  2PU4 A;  4ZDX A;  1CF0 A;  1GA9 A;  3P7N A;  5CHU A;  1TDG A;  1PRQ A;  4P6Z S;  2L4R A;  4HJ4 A;  1V9Y A;  2VZW A;  4GHI B;  4JF4 A;  4KZ7 A;  1F9I A;  5TBM A;  2O0Y A;  3T4J A;  4NXB A;  1IYO A;  4OPR A;  2O9C A;  1K55 A;  4PHT A;  4MMN A;  3NOP C;  5EE8 A;  4ZRR A;  4S2N A;  3IHA A;  3T12 B;  2OAQ 1;  4HH2 A;  4GLQ A;  1XFQ A;  4UA9 A;  5TJJ A;  1VET A;  4NXG A;  4E04 A;  1U60 A;  3NHQ A;  2ZMF A;  1BTL A;  3GR2 A;  1GHI A;  1Z09 A;  4MBH A;  2HP5 A;  5KSH A;  1ONG A;  1YLT A;  2R78 A;  3A0S A;  2B02 A;  2J80 A;  1MKI A;  3HLG A;  4Z1W A;  3SW1 A;  4MN7 A;  3VP4 A;  4MN6 A;  5L10 A;  5C5K A;  2V8C A;  1BT5 A;  4HY8 A;  1T1A A;  2HDU A;  3S7Q A;  1NLY A;  3ZG0 A;  1J3W A;  4ID4 A;  2VLG A;  4HQA A;  4OH0 A;  2K7S A;  3BEC A;  4II7 A;  3SH7 A;  1AWI A;  4GJ4 A;  5KSC A;  2K31 A;  3FWL A;  3VSL A;  1ES3 A;  4F3L B;  2V1A A;  3NIA A;  4OOL A;  3ZQ5 A;  4R4R A;  3LGO A;  3TSG A;  3R7W B;  3PTE A;  3WS5 A;  4FH4 A;  2ACG A;  3Q82 A;  4R4S A;  3MF0 A;  4H6J A;  1W7F A;  3ZVW A;  3WS4 A;  4WL9 A;  3VV4 A;  1K54 C;  2X02 A;  4K08 A;  3UE3 A;  5FA7 A;  4OOY A;  3UPP A;  3TW8 A;  5F1F A;  3O5Y A;  2XA7 M;  4HNB A;  4P0M A;  2W3E A;  1HTZ A;  3B3X A;  3A3J A;  4O8G A;  2G2W A;  3ZG7 B;  2PBD P;  4R3J A;  3MFD A;  1MWT A;  3KSF A;  4GS9 B;  2WKP A;  2V8F A;  1MWR A;  3UDI A;  4DE1 A;  4JLF A;  3HLF A;  3SS3 A;  2XGN A;  2M7V A;  5FAO A;  2DMW A;  2ZL1 B;  5DF7 A;  1OTD A;  3MS6 A;  1VQQ A;  2D01 A;  2OOL A;  1SKF A;  3H82 A;  2WKQ A;  5G18 A;  3CJM A;  2VGL M;  4Q0I A;  4MEZ A;  3MXQ A;  3DWZ A;  4YOF A;  2LB9 A;  4QWO A;  3TOI A;  4CJN A;  3RFB A;  4S2J A;  4JXW A;  4O01 A;  3OCN A;  1NYY A;  4KZ4 A;  5DJT A;  4X1L A;  3D4F A;  1BLP A;  1F5M A;  3E4Q A;  3S7O A;  1I5Q A;  1K4F A;  2QPN A;  3AGD A;  3HLD A;  3JYI A;  3CAX A;  2NUT C;  3NJA A;  3UDF A;  3UB9 A;  2HF6 A;  4CLC B;  3L9K A;  1QMF A;  1BLH A;  3JVV A;  5JYO A;  4HI4 A;  4HJ3 A;  2D02 A;  4E3M A;  2Y55 A;  3VOL A;  4KZ6 A;  3UMD A;  1ERO A;  2XFS A;  4EES A;  1JWP A;  1GCE A;  5D3O A;  5GLB A;  4YNR A;  4ETX A;  3CHW P;  1ZG4 A;  3F1O A;  5FQM A;  2JHE A;  2GNX A;  1TS8 A;  2XRN A;  3EEA A;  3QP5 A;  3LIE A;  5CHJ A;  3IX3 A;  3M2K A;  3PBS A;  4X68 A;  1JVJ A;  2JKT M;  3P01 A;  1WE4 A;  5E2H A;  2OSU A;  1K57 A;  2W3G A;  2J3T D;  5EVI C;  2VEA A;  4XXR A;  4Q0J A;  3LEZ A;  5CER A;  1PW8 A;  1YLP A;  3HBR A;  4I5S A;  4PM5 A;  2ZBB A;  3LI8 A;  2A49 A;  4WMC D;  1YSP A;  4BBV A;  2C6W B;  5TFQ A;  3QP4 A;  4HH3 A;  2BTF P;  2PR6 A;  4NEE D;  4HJ6 A;  1CQA A;  3KX0 X;  5KZH A;  3PR6 A;  5GHY A;  4EER A;  2ZC3 B;  4L9E A;  4OPZ A;  3NOU C;  2Y2N A;  3IWO A;  4UA7 A;  1MBL A;  1RGZ A;  2P04 A;  1JTG A;  4G3K A;  3ZG5 A;  5E43 A;  1OPX A;  1UGU A;  2XR0 A;  3IF6 B;  4XT2 A;  3MQQ A;  1LL8 A;  1ESU A;  1IKG A;  4HES A;  1O7E A;  1YLZ A;  1DP9 A;  1C3B A;  4DXC A;  5EOO A;  4LV1 A;  4KZB A;  2P74 A;  4IUK A;  4PMA A;  3VMA A;  3HLC A;  3G2Z A;  3FG8 A;  1PI4 A;  3P09 A;  5GHX A;  4PKY G;  4EBP A;  1DJC A;  1NYM A;  5AJG A;  2HP9 A;  3RXX A;  3PYP A;  2PD7 A;  5HWT A;  3FZC A;  4P87 A;  3EOI A;  3D9Y A;  4EW7 A;  4R3A A;  2JKF A;  1HZO A;  3BW6 A;  1SHV A;  4KZ5 A;  2VA0 A;  3S22 A;  2EWW A;  5M1A A;  4NK3 A;  1M40 A;  2GZA A;  1HVB A;  4BL3 A;  3WS2 A;  1VB6 A;  2Y2M A;  2XH9 A;  4E3N A;  1XPB A;  3GRJ A;  5EEC A;  4BD1 A;  3HLB A;  1X0O A;  4UQI M;  2H10 A;  3U4L P;  1JTD A;  4MBF A;  4KQQ A;  4LRZ E;  3BLS A;  1EWZ A;  3M6H A;  2Y2H A;  2DCF A;  4NXE A;  3BJN A;  2V0W A;  2Z2L B;  2BG1 A;  3N8L A;  3QP8 A;  1I2W A;  3DAV A;  4EV4 A;  1F98 A;  4IVI A;  2B95 A;  5HWW A;  4QY5 A;  3JPU A;  3W4P A;  1Y54 A;  2EX9 A;  2LB5 A;  3UPN A;  1LSX A;  4HP9 A;  4UEY A;  2VK3 A;  1VEU B;  1T1C A;  2KDK A;  3QP2 A;  5IU1 A;  2ZQ8 A;  2XD1 A;  4Y3I A;  4Y15 A;  3BY9 A;  4I38 A;  1LLB A;  3PAG A;  3N6I A;  3IF6 C;  1BLS A;  3PBR A;  5CGW A;  4JF6 A;  1ZG6 A;  1KGF A;  4RX3 A;  4X55 A;  1GSV A;  3BFF A;  4HP4 A;  1H8Y A;  1CK3 A;  2JN7 A;  4NET A;  4EQI A;  3GQZ A;  4IBR A;  3LO7 A;  3Q7Z A;  1T1B A;  1QME A;  2A24 B;  3LR0 A;  5CGS A;  3OPH A;  1L0E A;  1XA1 A;  3CWF A;  4R23 A;  1ALQ A;  4OKP A;  1S67 L;  1IYP A;  4N9K A;  4QD4 A;  3C4P A;  3BQA A;  4LV3 A;  4E6W A;  4FUW A;  1ZC2 A;  2FFF B;  3C30 A;  3KYQ A;  5K5B A;  2O9B A;  1K25 A;  3B33 A;  2G2U A;  3B42 A;  3HL9 A;  3ULF A;  1IYQ A;  5GL9 A;  2J3T C;  4I3A A;  1PZO A;  3BFE A;  1S4R A;  3T1R A;  3KSG A;  4N1H A;  3M2J A;  3ZFZ A;  1OJ5 A;  2J8Y A;  3LCE A;  4EQ1 A;  3W4Q A;  1LSW A;  3MZD A;  3QP1 A;  2WGI A;  5AVF A;  4GD8 A;  1IEM A;  3WRZ A;  3A0V A;  4OQG A;  2NUP C;  4LLO B;  2ZOH A;  3OCL A;  3W4O A;  4G3V A;  2Y2L A;  4WF0 A;  1PWC A;  2ZC5 B;  1MKM A;  1E3U A;  4LRY C;  3V67 A;  1KGG A;  4DDS A;  1LI9 A;  1CI8 A;  1YMS A;  3E2L A;  5FEG A;  3VSK A;  4FSF A;  2PR5 A;  2UV0 E;  1NJ4 A;  3GTC A;  3IS2 A;  5G4Z A;  3SS4 A;  3NDG A;  4YWZ A;  2OAP 1;  2GX5 A;  2W3F A;  1MC0 A;  3KSI A;  3S7N A;  1MXO A;  1FR1 A;  1S66 L;  2QZ6 A;  3C38 A;  3BLM A;  5GLA A;  2VV7 A;  5HL6 A;  3I7J A;  3HCY A;  3O87 A;  2X01 A;  4P85 A;  3WWX A;  4BQM A;  3D3O A;  3FYZ A;  1H5X A;  2VGJ A;  1ES5 A;  4FOF A;  4JGP A;  2OLV A;  4Y0O A;  1RCJ A;  4NXF A;  2QYB A;  3ZCZ A;  2EX8 A;  3NOT C;  4S2P A;  3GEC A;  4E3O A;  1IYS A;  3FV7 A;  3DTI A;  5DTS A;  2E8J A; 
#chains in the Genus database with same CATH homology
 4E3L A;  1W79 A;  1NZO A;  1QMF A;  1ERQ A;  3BRM A;  1BLH A;  4N1X A;  1CEG A;  5JYO A;  2Y2K A;  4S2K A;  4GNU A;  4E3M A;  3GSG A;  3BYD A;  5TR7 A;  2EX2 A;  4QU3 A;  4JXS A;  2Y55 A;  4KZ6 A;  1ERO A;  3M6B A;  4JXG A;  1IEL A;  2XFS A;  4OOM A;  3Q07 A;  3MKF A;  1KDW A;  5EVL A;  5GLC A;  1TDL A;  1JWV A;  2XQZ A;  3RJU A;  1JWP A;  3PBN A;  1GCE A;  2BLS A;  5AQA A;  1K38 A;  4Z9Q A;  3G30 A;  5CEC A;  1KE4 A;  2IWC A;  3BFG A;  2Q9N A;  5E2E A;  5D3O A;  5GLB A;  3NCK A;  3C4O A;  4PPR A;  4X56 A;  2EX6 A;  4WZ4 A;  1ZG4 A;  2WGV A;  2Y2Q A;  1KVL A;  4U0T A;  4WYY A;  2XEP A;  5FQM A;  4Y0U A;  5HW3 A;  4LV2 A;  2JBF A;  1PWG A;  1RP5 A;  5HAR A;  1PWD A;  2IWB A;  1ERM A;  1XXM A;  4O7D A;  2Y2O A;  2RL3 A;  2WZZ A;  4EUZ A;  5CHJ A;  4B4Z A;  2B5R A;  5CTN A;  1MPL A;  4JPM A;  5CHM A;  3UO9 A;  3M2K A;  4K0X A;  1N4O A;  3PBS A;  2H5S A;  3O3V A;  4X68 A;  2C5W B;  2XD5 A;  2Z2M B;  2P9V A;  3NBL A;  1JVJ A;  2ZM0 A;  3DW0 A;  1WE4 A;  5E2H A;  4LCL A;  2OSU A;  1TEM A;  3RXW A;  4PM7 A;  1K57 A;  3IXD A;  1DJA A;  4E3K A;  3GV9 A;  5EVI C;  3HUM A;  4S2M A;  1S0W A;  2EFU A;  3C5A A;  5J8X A;  1BSG A;  3HRE A;  3PBQ A;  4GKU A;  4XXR A;  2ZQ9 A;  2ZM2 A;  3A3E A;  1FSW A;  1XA7 A;  3LEZ A;  5I94 A;  2DRW A;  1EI5 A;  4B4X A;  1N9B A;  5CER A;  4U0X A;  1PW8 A;  2HP6 A;  2JCH A;  3CMZ A;  3QNC A;  4RVA A;  4WM9 A;  1YLP A;  4X6T A;  4DE0 A;  2XFT A;  3HBR A;  4PM5 A;  4KG6 A;  4KQO A;  3V5M A;  2EXA A;  3PBT A;  4YIN A;  5EVI B;  4K91 A;  1ES2 A;  3BM6 A;  1ONH A;  1PIO A;  2GDN A;  2A49 A;  2ZMA A;  4WMC D;  4ZAM A;  1KGE A;  5FI6 A;  2C6W B;  2RCX A;  5DF8 A;  5BOH A;  1PI5 A;  5TFQ A;  5A90 A;  3VFH A;  2HDS A;  5DF9 A;  4DF6 A;  2WKH A;  5EOE A;  5FI2 A;  1K6R A;  4C75 A;  1CEF A;  4BL2 A;  2WAD A;  4LV0 A;  5KZH A;  2XK1 A;  5GHY A;  2J9O A;  2ZC3 B;  5A93 A;  4IED A;  1K57 C;  4N9L A;  2WYX A;  5E2F A;  1FCM A;  2WKE A;  2VGK A;  5FQ9 A;  5A91 A;  1SCW A;  5F82 A;  2ZM8 A;  2XDM A;  3LY3 A;  4OPZ A;  2Y2N A;  2V2F F;  4R0Q A;  4X53 A;  3G35 A;  3NC8 A;  3HUN A;  1XX2 A;  3IWO A;  4M3K A;  4MLL A;  5FAT A;  1E4D A;  4UA7 A;  1MBL A;  1RGZ A;  3UN7 A;  1JTG A;  3HLE A;  4XUZ A;  4RYE A;  1K56 A;  2ZQ7 A;  4C6Y A;  4D2O A;  3ZG5 A;  4GDB A;  5E43 A;  5FQJ A;  5A92 A;  2WZX A;  2XR0 A;  3UE1 A;  3ITB A;  4IVK A;  3IF6 B;  3ZG8 B;  1ESI A;  3MZE A;  4WZ5 A;  5FAP A;  2ZC7 A;  1PZP A;  2H0T A;  4A5R A;  4JBF A;  1ESU A;  5FQK A;  1IKG A;  4HES A;  4FCF A;  1O7E A;  1YLZ A;  4ZJ2 A;  3OC2 A;  2HPB A;  1NY0 A;  1G68 A;  4IBX A;  1C3B A;  4DXC A;  5EOO A;  3N4I A;  4PM8 A;  1RGY A;  4JKT A;  5DVA A;  3IXG A;  3SH9 A;  4LV1 A;  4KZB A;  5EVI A;  4WBG A;  2P74 A;  4OQI A;  2Y91 A;  3IH8 A;  3QHY A;  3N8S A;  4GDN A;  2V1Z A;  4PM9 A;  4PMA A;  3VMA A;  1E3U D;  3ZDJ A;  4BD0 A;  2EXB A;  3NI9 A;  3OPR A;  3UPO A;  4UHU A;  5JYP A;  3HLC A;  1YMX A;  4OLD A;  3VP0 A;  3UDX A;  3SOI A;  3C7U A;  4C3Q A;  3IHB A;  1XP4 A;  3ISG A;  4L0L A;  3G2Z A;  3P09 A;  1PI4 A;  5GHX A;  1Q2P A;  4HEF A;  4E3I A;  4EBL A;  3ITA A;  4EBP A;  1DJC A;  1NYM A;  2WGW B;  4OVD A;  4KZ9 A;  1XKZ A;  2HP9 A;  3VP2 A;  3VOZ A;  4S2O A;  1YLW A;  3RXX A;  5CXW A;  5DTK A;  2WUQ A;  3FZC A;  2JE5 A;  2J9P A;  4P87 A;  1KVM A;  5M19 A;  1FOF A;  4GOG A;  4ZBE A;  2FFY A;  5HFO A;  1HZO A;  3FKV A;  3O86 A;  1SHV A;  3PBO A;  4KZ5 A;  5E2G A;  5GLD A;  3S22 A;  5HL1 A;  1FQG A;  2WAF A;  4UAA A;  3VOY A;  3G2Y A;  3GMW A;  1XGI A;  2XLN A;  5M1A A;  1LI0 A;  5FSR A;  2HDR A;  4NK3 A;  5HAI A;  3A3F A;  4DDY A;  4LCM A;  4WZ5 C;  4FH2 A;  1M40 A;  1HVB A;  5FQI A;  4BL3 A;  3WS2 A;  2DNS A;  2QMI A;  4X69 A;  2Y2M A;  1KE0 A;  3V39 A;  1PYY A;  1GHM A;  5M18 A;  1DJB A;  2XH9 A;  5FAS A;  4E3N A;  1XPB A;  5CEB A;  5CRF A;  3GRJ A;  2ZQA A;  4LEN A;  4S2L A;  1LHY A;  2WKI A;  3IF6 A;  5EEC A;  4U3T A;  1MWU A;  1MY8 A;  4BD1 A;  3HLB A;  4DRT A;  4OON A;  3NDE A;  1Q2Q A;  1ZKJ A;  4KEN B;  5EUA A;  2H10 A;  3VP1 A;  2OLU A;  4BEN A;  3IH9 A;  1JTD A;  1FR6 A;  3O88 A;  4MBF A;  3HLW A;  1YQS A;  4ZJ1 A;  3WS1 A;  1WYB A;  4KQQ A;  5F1G A;  3V3R A;  1BUL A;  3BLS A;  5KMW A;  1EWZ A;  4EBN A;  2ZC6 B;  2X71 A;  3M6H A;  2Y2H A;  4ZJ3 A;  1NRF A;  2DCF A;  3EQU A;  2Y2G A;  1MWS A;  5FDH A;  2Z2L B;  1TVF A;  2BG1 A;  3MKE A;  4JXV A;  3N8L A;  4KZ8 A;  1I2W A;  4EV4 A;  3SS5 A;  2ZLY A;  4IVI A;  1VM1 A;  3VP3 A;  4QY5 A;  2WGW A;  3MXS A;  2Q9M A;  4CPK A;  3AGE A;  1FSY A;  3W4P A;  3V50 A;  1Y54 A;  2EX9 A;  3OPP A;  3UPN A;  2PU2 A;  2HDQ A;  3WS0 A;  3A3I A;  2PBY A;  4MNR A;  5EVI D;  1BLC A;  4QY6 A;  2PU4 A;  1S6R A;  3G32 A;  2ZQ8 A;  4FD8 A;  4ZDX A;  2XD1 A;  3UE0 A;  1GA9 A;  1AXB A;  3UNW A;  3E2K A;  2WAE A;  4HBT A;  1LLB A;  4OP5 A;  3PAG A;  5CHU A;  4GD6 A;  1TDG A;  5CED A;  3N6I A;  2CC1 A;  1GA0 A;  4BJP A;  3IF6 C;  1BLS A;  1LL9 A;  3PBR A;  4S2I A;  4JF6 A;  1ZG6 A;  2A3U A;  1KGF A;  4JF4 A;  5CGW A;  3EQV A;  4RX3 A;  4KZ7 A;  4X55 A;  1KDS A;  3BFF A;  3PAE A;  1IYO A;  1H8Y A;  4OPR A;  1K55 A;  1BZA A;  1CK3 A;  4OQ0 A;  1LL5 A;  1J9M A;  1L0F A;  4NET A;  4WEJ A;  3TG9 A;  4EQI A;  3GQZ A;  3NY4 A;  3DTM A;  3BFD A;  4IBR A;  3LO7 A;  4H8R A;  3Q7Z A;  2ZQC A;  1QME A;  1XGJ A;  5EE8 A;  4S2N A;  3IHA A;  5FI7 A;  2ZJ9 A;  4WEL A;  4Y0T A;  4KQR A;  5TGF A;  2Y59 A;  3Q7V A;  5CGS A;  4UA9 A;  3OPH A;  5FQQ A;  2OV5 A;  4OPY A;  2R9X A;  2J7V A;  3IWQ A;  1L0E A;  1XA1 A;  1U60 A;  1DY6 A;  3ZG9 B;  1L2S A;  4R23 A;  1ALQ A;  1BTL A;  3Q81 A;  3GR2 A;  4OKP A;  1GHI A;  1IYP A;  4N9K A;  3A3D A;  4QB8 A;  4MBH A;  4QD4 A;  5AQB A;  5HAP A;  2HP5 A;  5KSH A;  1ONG A;  3WRT A;  4DKI A;  3MXR A;  4GZB A;  3GVB A;  3C4P A;  2XF3 A;  1NZU A;  1YLT A;  4MBK A;  4N92 A;  2E8I A;  3OPL A;  1JWZ A;  4ZTK A;  2IWD A;  1MKI A;  1WYC A;  3BEB A;  2ZD8 A;  3ZVT A;  4F94 A;  3HLG A;  4WMC A;  4LV3 A;  3VP4 A;  4E6W A;  4KG2 A;  1ZC2 A;  3IF5 A;  1W8Y A;  1BT5 A;  4DE2 A;  3Q1F A;  2HDU A;  5HX9 A;  3ZGA B;  2FFF B;  3ZG0 A;  4ID4 A;  2R9W A;  4Q8I A;  4OH0 A;  1YT4 A;  3BEC A;  1O07 A;  5CTM A;  1K25 A;  1L0D A;  3SH7 A;  1E25 A;  1K55 C;  2G2U A;  4P6B A;  5KSC A;  3HL9 A;  4OQH A;  3IXB A;  3FWL A;  3VSL A;  1IYQ A;  1ES3 A;  4OPQ A;  4JF5 A;  5GL9 A;  3HUO A;  1ES4 A;  3IWI A;  4S2N C;  4RX2 A;  3NIA A;  4BLM A;  1NXY A;  1PZO A;  1YLY A;  3C7V A;  4KZ3 A;  4OOL A;  3G34 A;  3BFE A;  5CGX A;  4R4R A;  3DWK A;  4N1H A;  3TSG A;  4DXB A;  4E3J A;  3M2J A;  3MZF A;  3ZFZ A;  3PTE A;  2J8Y A;  1SDN A;  2H0Y A;  3WS5 A;  1OME A;  3LCE A;  4FH4 A;  3AGF A;  3W4Q A;  2JC7 A;  3IXH A;  3MZD A;  3Q82 A;  4KZA A;  2Y2I A;  2WGI A;  4R4S A;  1W7F A;  3Q7V B;  3OZH A;  4KG5 A;  3IT9 A;  3WS4 A;  3ZVW A;  3MBZ A;  4K0W A;  1K54 C;  4GD8 A;  3ZHH A;  2X02 A;  5U47 A;  3UE3 A;  1IEM A;  3WRZ A;  4OQG A;  5AQ7 A;  5FA7 A;  4OOY A;  1K56 D;  1K6S A;  3N8R A;  4UA6 A;  2WK0 A;  3UPP A;  5F1F A;  3S4X A;  3QNB A;  3ZNY A;  5F83 A;  4RA7 A;  2UWX A;  3OCL A;  1I2S A;  1G6A A;  3VFF A;  3W4O A;  2Y2L A;  4P0M A;  1PWC A;  2ZC5 B;  1E3U A;  2Y4A A;  3FKW A;  4R1G A;  1HTZ A;  3B3X A;  1SDE A;  1KGG A;  3A3J A;  4DDS A;  1LI9 A;  2G2W A;  1K4E A;  3CZD A;  3ZG7 B;  4R3J A;  1CI8 A;  1YMS A;  3E2L A;  3MFD A;  2ZQD A;  3P98 A;  1MWT A;  3G4P A;  5FAQ A;  1W5D A;  3VSK A;  4FSF A;  1NJ4 A;  1MWR A;  3UDI A;  4DE1 A;  4JLF A;  3GTC A;  1IKI A;  2Y2J A;  3HLF A;  5GHZ A;  3SS3 A;  2XGN A;  1YM1 A;  5FAO A;  2I72 A;  5IHV A;  3SS4 A;  3NDG A;  4EWF A;  4QHC A;  5DF7 A;  1BUE A;  1KE3 A;  1YLJ A;  1MXO A;  1VQQ A;  1FR1 A;  1W8Q A;  3N7W A;  1CI9 A;  2Y2P A;  2QZ6 A;  5GLA A;  1SKF A;  3BLM A;  3ZNT A;  5G18 A;  4B88 A;  3CJM A;  3HVF A;  4E6X A;  3I7J A;  2X01 A;  3O87 A;  4MEZ A;  4P85 A;  3DWZ A;  3WWX A;  3TOI A;  4CJN A;  1H8Z A;  1FCO A;  4OLG A;  4BQM A;  2V20 A;  1FCN A;  5EPH A;  4S2J A;  4HBU A;  4JXW A;  4R3B A;  1M6K A;  1L0G A;  5L2F A;  3FYZ A;  3OCN A;  4DE3 A;  1Z6F A;  1NYY A;  1H5X A;  3BFC A;  4PM6 A;  3SH8 A;  1HD8 A;  2EFX A;  2VGJ A;  4KZ4 A;  5AQ9 A;  1ES5 A;  3D4F A;  4GB7 A;  3LY4 A;  1BLP A;  4Y7P A;  2OLV A;  3W8K A;  4Y0O A;  2P9V B;  1GHP A;  1RCJ A;  2ZC4 B;  3CG5 A;  3UY6 A;  3ZCZ A;  1I5Q A;  2EX8 A;  1K4F A;  4S2P A;  4WEK A;  4XUX A;  2QPN A;  3AGD A;  3HLD A;  3JYI A;  3S1Y A;  5HAQ A;  4E3O A;  3G31 A;  3UDF A;  4GN2 A;  5DTT A;  3V3S A;  4QJG A;  1IYS A;  1K54 A;  4YFM A;  3FV7 A;  3IQA A;  5DTS A;  1PW1 A;  4OP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...