4N93A

Alternative substrates of mycobacterium tuberculosis anthranilate phosphoribosyl transferase
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
347
structure length
346
Chain Sequence
b'VPSWPQILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPADTVPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARRSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANAAAVRAVLGGARGPVRDAVVLNAAGAIVAHAGLSSAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anthranilate phosphoribosyltransferase
publication title Alternative substrates reveal catalytic cycle and key binding events in the reaction catalysed by anthranilate phosphoribosyltransferase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 121
structure length 346
sequence length 347
chains with identical sequence B
ec nomenclature ec 2.4.2.18: Anthranilate phosphoribosyltransferase.
pdb deposition date 2013-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00591 Glycos_transf_3 Glycosyl transferase family, a/b domain
A PF02885 Glycos_trans_3N Glycosyl transferase family, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.970.10 Mainly Alpha Up-down Bundle Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3 Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 4n93A01
3.40.1030.10 Alpha Beta 3-Layer(aba) Sandwich Pyrimidine Nucleoside Phosphorylase; Chain A, domain 2 Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain 4n93A02
4YEKA 4OWQA 4N8QA 5C2LA 1ZYKA 5BO3A 4OWVA 1ZXYA 4GA5A 1O17A 2J0FA 1OTPA 2WK6A 1VQUA 4N93A 1ZVWA 4M0RA 2GVQA 4X5AA 4OWUA 4GIUA 1KHDA 5C1RA 4X5DA 1BRWA 4ZOJA 4ZTVA 4OWOA 4X59A 2ELCA 4ZOFA 2WK5A 5BO2A 4IJ1A 4ZOKA 4YYYA 4GTNA 4X46A 5BNEA 2BPQA 3R88A 3QQSA 5EY3A 1AZYA 4X58A 4GA6A 4LHMA 4YI7A 4EAFA 2DSJA 5C7SA 5BYTA 3R6CA 3TWPA 3UU1A 2TPTA 4EADA 3QR9A 4HKMA 1GXBA 1UOUA 4X5EA 4OWMA 4X5CA 4N5VA 1V8GA 3QS8A 4GKMA 4X5BA 4OWSA 4XR5A 1KGZA 4GA4A 5EP8A 4MUOA 3H5QA 4OWNA 3GBRA 3QSAA
chains in the Genus database with same CATH superfamily
4YEKA 4OWQA 4N8QA 5C2LA 1ZYKA 5BO3A 4OWVA 1ZXYA 4GA5A 1O17A 1OTPA 2J0FA 2WK6A 1VQUA 4N93A 1ZVWA 4M0RA 2GVQA 4X5AA 1RRZA 4OWUA 4GIUA 1KHDA 5C1RA 4X5DA 1BRWA 4ZOJA 1RF8B 4ZTVA 4OWOA 4X59A 2ELCA 4ZOFA 2WK5A 5BO2A 4IJ1A 4ZOKA 4YYYA 4GTNA 4X46A 5BNEA 2BPQA 4F3FC 3R88A 3QQSA 5EY3A 1AZYA 4GA6A 4X58A 4LHMA 4YI7A 4EAFA 2DSJA 5C7SA 5BYTA 3R6CA 3TWPA 3UU1A 2TPTA 4EADA 3QR9A 4HKMA 1GXBA 1UOUA 4X5EA 4OWMA 4X5CA 4N5VA 1V8GA 3QS8A 4GKMA 4X5BA 4OWSA 4XR5A 1KGZA 4GA4A 5EP8A 4MUOA 3H5QA 4OWNA 3GBRA 3QSAA
chains in the Genus database with same CATH topology
4YEKA 4OWQA 4N8QA 5C2LA 1ZYKA 5BO3A 4OWVA 1ZXYA 4GA5A 1O17A 2J0FA 1OTPA 2WK6A 1VQUA 4N93A 1ZVWA 4M0RA 2GVQA 4X5AA 4OWUA 4GIUA 1KHDA 5C1RA 4X5DA 1BRWA 4ZOJA 4ZTVA 4OWOA 4X59A 2ELCA 4ZOFA 2WK5A 5BO2A 4IJ1A 4ZOKA 4YYYA 4GTNA 4X46A 5BNEA 2BPQA 3R88A 3QQSA 5EY3A 1AZYA 4X58A 4GA6A 4LHMA 4YI7A 4EAFA 2DSJA 5C7SA 5BYTA 3R6CA 3TWPA 3UU1A 2TPTA 4EADA 3QR9A 4HKMA 1GXBA 1UOUA 4X5EA 4OWMA 4X5CA 4N5VA 1V8GA 3QS8A 4GKMA 4X5BA 4OWSA 4XR5A 1KGZA 4GA4A 5EP8A 4MUOA 3H5QA 4OWNA 3GBRA 3QSAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YEK A;  4OWQ A;  4N8Q A;  5C2L A;  1ZYK A;  5BO3 A;  4OWV A;  1ZXY A;  4GA5 A;  1O17 A;  2J0F A;  1OTP A;  2WK6 A;  1VQU A;  4N93 A;  1ZVW A;  4M0R A;  2GVQ A;  4X5A A;  4OWU A;  4GIU A;  1KHD A;  5C1R A;  4X5D A;  1BRW A;  4ZOJ A;  4ZTV A;  4OWO A;  4X59 A;  2ELC A;  4ZOF A;  2WK5 A;  5BO2 A;  4IJ1 A;  4ZOK A;  4YYY A;  4GTN A;  4X46 A;  5BNE A;  2BPQ A;  3R88 A;  3QQS A;  5EY3 A;  1AZY A;  4X58 A;  4GA6 A;  4LHM A;  4YI7 A;  4EAF A;  2DSJ A;  5C7S A;  5BYT A;  3R6C A;  3TWP A;  3UU1 A;  2TPT A;  4EAD A;  3QR9 A;  4HKM A;  1GXB A;  1UOU A;  4X5E A;  4OWM A;  4X5C A;  4N5V A;  1V8G A;  3QS8 A;  4GKM A;  4X5B A;  4OWS A;  4XR5 A;  1KGZ A;  4GA4 A;  5EP8 A;  4MUO A;  3H5Q A;  4OWN A;  3GBR A;  3QSA A; 
#chains in the Genus database with same CATH topology
 4YEK A;  4OWQ A;  4N8Q A;  5C2L A;  1ZYK A;  5BO3 A;  4OWV A;  1ZXY A;  4GA5 A;  1O17 A;  1OTP A;  2J0F A;  2WK6 A;  1VQU A;  4N93 A;  1ZVW A;  4M0R A;  2GVQ A;  4X5A A;  1RRZ A;  4OWU A;  4GIU A;  1KHD A;  5C1R A;  4X5D A;  1BRW A;  4ZOJ A;  1RF8 B;  4ZTV A;  4OWO A;  4X59 A;  2ELC A;  4ZOF A;  2WK5 A;  5BO2 A;  4IJ1 A;  4ZOK A;  4YYY A;  4GTN A;  4X46 A;  5BNE A;  2BPQ A;  4F3F C;  3R88 A;  3QQS A;  5EY3 A;  1AZY A;  4GA6 A;  4X58 A;  4LHM A;  4YI7 A;  4EAF A;  2DSJ A;  5C7S A;  5BYT A;  3R6C A;  3TWP A;  3UU1 A;  2TPT A;  4EAD A;  3QR9 A;  4HKM A;  1GXB A;  1UOU A;  4X5E A;  4OWM A;  4X5C A;  4N5V A;  1V8G A;  3QS8 A;  4GKM A;  4X5B A;  4OWS A;  4XR5 A;  1KGZ A;  4GA4 A;  5EP8 A;  4MUO A;  3H5Q A;  4OWN A;  3GBR A;  3QSA A; 
#chains in the Genus database with same CATH homology
 4YEK A;  4OWQ A;  4N8Q A;  5C2L A;  1ZYK A;  5BO3 A;  4OWV A;  1ZXY A;  4GA5 A;  1O17 A;  2J0F A;  1OTP A;  2WK6 A;  1VQU A;  4N93 A;  1ZVW A;  4M0R A;  2GVQ A;  4X5A A;  4OWU A;  4GIU A;  1KHD A;  5C1R A;  4X5D A;  1BRW A;  4ZOJ A;  4ZTV A;  4OWO A;  4X59 A;  2ELC A;  4ZOF A;  2WK5 A;  5BO2 A;  4IJ1 A;  4ZOK A;  4YYY A;  4GTN A;  4X46 A;  5BNE A;  2BPQ A;  3R88 A;  3QQS A;  5EY3 A;  1AZY A;  4X58 A;  4GA6 A;  4LHM A;  4YI7 A;  4EAF A;  2DSJ A;  5C7S A;  5BYT A;  3R6C A;  3TWP A;  3UU1 A;  2TPT A;  4EAD A;  3QR9 A;  4HKM A;  1GXB A;  1UOU A;  4X5E A;  4OWM A;  4X5C A;  4N5V A;  1V8G A;  3QS8 A;  4GKM A;  4X5B A;  4OWS A;  4XR5 A;  1KGZ A;  4GA4 A;  5EP8 A;  4MUO A;  3H5Q A;  4OWN A;  3GBR A;  3QSA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...