4N9HA

Crystal structure of transcription regulation protein crp
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
201
structure length
201
Chain Sequence
PTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of inactive CRP species reveal the atomic details of the allosteric transition that discriminates cyclic nucleotide second messengers.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
molecule keywords Catabolite gene activator
total genus 55
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4n9hA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4n9hA01
3RPQA 2TDXA 2V1DA 2GQQA 1R58A 2HKOA 5HLGA 1BBYA 2QM3A 4AVBA 5CLSA 4UNOA 1S6LA 2OYZA 2EK5A 3BJ6A 2YX4A 1R5HA 2BNOA 1UCXA 1IZ1A 3ZMTA 5LHGA 4KIBA 3JAMZ 1FXZA 4M71A 3ECHA 4MGKE 4YIIA 3KSCA 1FSHA 1HQCA 2CYYA 4WVZA 4QM9A 4MTDA 4Q47A 4HBLA 2H6BA 3KMHA 3HT1A 1H1MA 1O5UA 3LFKA 1LR5A 1XMKA 4LLLA 3DEUA 3ZMSA 4Q29A 5F6FA 5F64A 1SFNA 4ZU4A 1YQAA 5J3UA 3RI4A 5LGUA 2PAMA 5HI0A 2K7LA 1F1ZA 3P9KA 3LA3A 2BYVE 3P9CA 2MH9A 2MH2A 5HOOA 4U0YA 1BC8C 3S2WA 1G3WA 3DQVC 2Z3YA 3DXJF 3J81Z 2IRFG 4E2QA 4DQ2A 2FNPA 2A6EF 1UHWA 4G8XA 4CICA 2CAVA 2BV6A 5CVVA 3USSA 1DGRA 4AWXB 3KZZA 5FD5A 1V4RA 4CO8A 3BPXA 3H8UA 4UXAA 1SAXA 4MEYF 2P7VB 2H94A 5JI6A 2H6CA 1XGOA 4HV6A 1GHCA 3W6KB 1TW2A 3CUQA 1YFYA 2XKOA 2OQRA 1PM7A 1ZGJA 3QU6A 1Z91A 4MGYE 5BMZA 3ACLA 4BXUA 4MX3A 3BALA 5KHJA 2M45A 4IJAA 2XROA 2F2EA 1R1UA 4TV7A 1Y0UA 5DD8A 2W84A 3GWZA 1U3EM 3ZMUA 3CO2A 2QQAA 1HBXG 3H1WA 1IXCA 1FP2A 1KQ8A 5I8TA 5J7MA 4FBFA 2CFXA 3SZTA 3DV8A 3JTHA 2ETEA 5FD6A 1CF7A 2NRAC 3EBRA 4I09A 4P96A 2UY9A 1HW1A 2Z69A 2HDCA 4PGHA 1U8RA 1YYVA 4LTAA 1J3RA 2V6CA 3N4MA 3Q9SA 1CAXB 1DUXC 3EDPA 4BQAA 1ZZ6A 3UKTA 1VP6A 4ASNA 2L01A 1RL3A 1XSXA 3WTSC 1S7AA 1ON2A 3TO6A 4EV0A 1YS6A 1WGPA 2PHLA 2EV5A 4QMAA 4A6EA 2UZKA 1LDJA 2JZYA 4M9XA 3TOBA 3TDZC 3MZHA 4D0PA 2XL9A 1B9MA 4QWQA 1QXJA 1LRHA 4P9FA 3ZMVA 5D4SA 2EFWA 3GFLA 2VOOA 2BBYA 5C8WA 3VODA 4UBHA 4LG0A 3F8MA 5ICEA 2PBIA 1Q3EA 3SCHA 4ZYEA 2FMLA 3GYHX 2ZO4A 3EUHA 5LBQA 3ERED 4ESBA 4N9IA 1P92A 3DPLC 1FC3A 1MJAA 5DEQA 3F6VA 4HX7A 3L9FA 2PJPA 1IPKA 1YFUA 3CJXA 2GU9A 2O8QA 3LA2A 3H1MA 5LLQA 1SFUA 2Q1ZB 2DPDA 3ES4A 2WWYA 4NB5A 3V4GA 5D6EA 2PQQA 2UXXA 3KP7A 1OMIA 3GVAA 4HBNA 3F8CA 4PJYA 3K1MA 2NNNA 3E6CC 1L0OC 3R0JA 5I8SA 3KLOA 3EYIA 1XSDA 3ABUA 2XVCA 1O3RA 2A5YB 4HF0A 3WGGA 2B0LA 3I53A 2HOEA 1REPC 3M3IA 5FDBA 2A68F 4CYDA 4AXOA 3KEOA 1B9NA 2XLAA 4U0WA 1QNTA 2FU4A 1FNNA 1Z9CA 4JV4A 1W7PB 2NS0A 2R7DA 5A2QK 2PAKA 5FGMA 1KYWA 1E2XA 5I91A 2VBWA 3M9AA 2IP2A 4LMYA 4G7ZF 1IXSB 2VC1A 2ZNZA 1XE7A 1K78B 1V3FA 1WA4A 4OIRF 4OFGA 3GBFA 2GAUA 4ZZLA 2IW5A 1J75A 2IXLA 2XUBA 2OZ6A 5HVQC 2OU2A 3SZPA 2OAZA 1G3YA 1B6AA 4OINF 3H92A 1T98A 4FX4A 2YR2A 4UVAA 4EROA 2W24A 1FSEA 5E1RA 4D7SA 1TQPA 1ZZ8A 5E18F 4BH9A 3FWEA 1FLIA 2G9WA 3LQRA 4OMZA 4GCVA 1U78A 3GW2A 5I0SA 4Y13A 1YFWA 1UD1A 3HRTA 1SMYF 5FLHA 4WXDA 1Q1HA 1UHMA 2CAUA 2F5EA 2A61A 5CVIA 1QXRA 2PYTA 2VE8A 2MA3A 2AXLA 3CTAA 1ZARA 3Q5FA 5JHUA 1R1VA 1J58A 1R23A 3D0SA 3L09A 5DV5A 2EAAA 5ICFA 5BS6A 1J59A 4HF1A 3OOPA 2GC1A 3O2PE 1BI2A 5E20A 2A07F 3HRSA 3S7EA 1FBUA 3ML6A 1AOYA 1JE8A 1UIKA 5AONA 2VT2A 5LGTA 2XAJA 2FBKA 3KGZA 4IEQA 1I1GA 1GQGA 4WZCA 3KP2A 1HXDA 1ZRDA 3K9TA 2PG4A 2VE9A 3QPHA 1ZRRA 2EV0A 4KFCA 1Z6RA 3RJPA 5E8GA 4BAYA 3WE2A 3HTSB 1MJ9A 2MNGA 3TGNA 3BB6A 2DW4A 3I0TA 5EEGA 2IC1A 3MDPA 4XRFA 3PQKA 2EWNA 5L3DA 5AVPA 1FT9A 2H27A 4A6DA 4XFGA 4GGGA 1O5LA 3C18A 3HRMA 2L3DA 2D1HA 3M70A 4OMYA 2QNKA 1W7PD 2A3SA 2V1UA 3WG9A 1FBQA 4HLXA 2D1VA 1ODDA 4YIFA 5ILSA 1VR3A 3T5XA 3QU3A 1C0WA 1DDNA 4EGZA 4X6QB 3RYKA 1IAWA 1KU9A 3J81K 1UCRA 5LEKA 4WWCA 1RZ4A 1J5YA 1ZREA 4WCGA 1STZA 2KJCA 3RIRA 4IEWA 2QWWA 3LA7A 3MPBA 2K27A 2HZTA 3V8JA 5ILVA 5BQTA 1Z7UA 3MZYA 5BPXA 5JSRA 2LDUA 3RDIA 5JSPA 2HGCA 2KJBA 1IN8A 1YW8A 2O6GE 1DP7P 1K6OA 3SMHA 3TKYA 4RGRA 3HOSA 1J3QA 1B59A 4KDPA 2K86A 4LJZF 1I1SA 3O3KA 1YW9A 1SEFA 1IN4A 2FMYA 2E1NA 3EQLF 3RZZA 2VBXA 4JTNA 2YU3A 5D5UB 1FP1D 3J7AO 4O9EA 2QVOA 5HDGA 2ACJA 4O5VA 1X8EA 1YUDA 4GO1A 4ON0A 1BN5A 4AVPA 3QP5A 5JFRA 2DPUA 4L5IA 4LK0F 4Z82A 5ED4A 3C7JA 1K7AA 1KGSA 5LEJA 1KU3A 3L2CA 4Q4ZF 2NNYA 1D8JA 2V1XA 3ZN1A 3NKTA 2DT5A 4MGRA 2ESNA 2PQ8A 4HX4A 4BYYA 1GXQA 4HOBA 4WK8F 3ROUA 1LB2A 4I02A 2Q0OA 5CJ9A 2EA2A 3L2HA 4DINB 4YNIA 5FB2A 2XV4S 1I6XA 3CLOA 1P6RA 2KRFA 2XHKA 1IN7A 3V7RA 2DU9A 5L3BA 4IESA 2G7HA 1S7OA 1EH6A 3BJOA 4JK1X 4AVCA 3IC7A 2VPVA 4LA3A 4KWJA 3KP5A 4LB6B 1EY2A 2KIUA 3LAPA 4XF4A 2V9VA 3KFWX 4ENMA 1EH7A 3NW4A 1CAWB 3IIAA 2QQBA 1DPRA 3F3XA 4Q48A 2DO7A 3GZ6A 2P5LC 1HKSA 2O03A 3I59B 1O3TA 4JQFA 3DN7A 5BOXA 3IL2A 5BXXA 2K0GA 4UV9A 1WKMA 2PFBA 5I8YA 3GX4X 2UWMA 3S0MA 3PFIA 2W25A 1XGMA 4I0AA 4WBBA 1TQIA 3BPVA 4EJWA 4CZZA 2MHFA 4G9YA 4AD9A 3IBMA 3GLXA 2MLGA 4P55A 3PVBB 4GYGA 3HUGA 4HX8A 4HN0A 4A5MA 4XF3A 3E6BA 2BGCA 5DYMA 3REOA 1HKQA 1BOAA 1LDKB 3OCPA 4Y15A 1R5GA 2RN7A 2PLYA 2EVXA 2HS5A 4BHCA 3OV8A 3RYPA 2O61A 2HYFA 1DPUA 4YARA 2X0LA 1H0MA 5DD4A 3TDUC 3V7SA 4PIZA 2P8TA 5ICGA 2QZ8A 3BZ6A 4LUMA 3JAMK 4YFXF 4IERA 1ZLKA 2GWRA 3L00A 3EJKA 4ORFA 4MNUA 2HKXA 1IRGA 4BNCA 4S04A 3RKYA 2FF4A 2HR3A 4L9VA 1OPCA 2MLKA 3L7WA 3E5XA 4HSJA 4ZYHA 3MWMA 1W5SA 2NAZA 3WODF 3CUOA 4JVAA 4KN7X 3WW2A 2B8MA 2KKOA 1Z1DA 5ICCA 2EFOA 2JSCA 4RGUA 4R8HA 4XFCA 3ES1A 4U88A 3TO9A 4RGSA 3MQ0A 3FMRA 1U5TC 4Q5SF 4L0ZB 4I2OA 2EB7A 1SFXA 4MHGA 1YO5C 4UVBA 3M8FA 1VJ2A 3G73A 1PP8F 1XMAA 1QO0D 1Y3TA 1IN6A 1R36A 3KE2A 1P4XA 1L3LA 2M8EA 1F4KA 3VOEA 1LEBA 3U11A 2PAEA 5H20A 3O14A 4IEPA 3IDBB 2D40A 5D8LB 2P17A 3KGLA 5CADA 2K4BA 4OU0A 5KHKA 2STWA 5CVRA 1MZBA 3RKXA 2VOPA 4KMFA 3U1DA 5KHIA 1ZAOA 1PP7U 1XN7A 3JW4A 3RPUA 4PZJA 3KCCA 3KZYA 2F5CA 5LGNA 3EHKA 3TNPB 2M30A 2XRNA 2K9ZA 1UFMA 1Y9QA 2QBYA 3UKNA 2C0ZA 3C3VA 1ONVA 5E16A 4M72A 5KHHA 2QCSB 4TLFA 2GXGA 1J9IA 3C1DA 4UBGA 4UUVA 4F8AA 2P6TA 2FQPA 4GXOA 4XLPF 4IPAA 1F9NA 2EFPA 3IKTA 4A0YA 4L5JA 2Z99A 4I7HA 3F23A 3EQEA 2PI0A 3WGHA 1G3SA 4XETA 3WTUC 1HW2A 5K5OA 4HMZA 2VT3A 3I58A 1G3TA 4QGNA 2UYBA 3GYDA 1S3JA 3FHIB 4MEXF 5FLXZ 4M73A 4A12A 4L18B 3MFKA 1OR7A 2B5HA 4PGGA 2VQAA 2Z2SB 3BDDA 2VODA 1RGSA 3M8EA 5FQ0A 1CAUA 1D3YA 1CAVB 1RIOH 2Y0OA 3D0JA 2LF8A 4HA8A 1Z6TA 5J8FA 1BIBA 2FXAA 2OZUA 3NRVA 2CGPA 2MD5A 1W5TA 3GO5A 3V8LA 1QGPA 4U7DA 3JZVA 2OBPA 2FRHA 2E7WA 1W7PA 2RKHA 1YG2A 3IHUA 2QDRA 2L54A 4XSXF 4Z07A 1SMTA 5JCTA 3G7DA 4YSFA 1QWRA 3D82A 3ZPLA 2HWVA 3VB2A 4ZU5A 1AWCA 1EV7A 1NYWA 5I93A 2DLLA 3K1PA 1EP0A 4IHSA 4EJUA 2V79A 4S05A 3LSTA 5ILUA 4AIKA 2GZWA 4KA4A 4HVOA 2VBYA 5CU1A 5D5XB 4A0XA 1XD7A 3DL3A 4E2GA 5JSOA 4PCQA 4HW0A 2OZJA 3ABTA 1LKNA 5KHGA 1CAWA 2IA0A 5E1WA 3QP6A 1GXPA 2OPKA 3COAC 2EFQA 3QRFF 1IF1A 4GULA 4L9JA 3V8KA 5L3EA 1BIAA 4HVQA 4L9TA 1WWXA 2QUFA 1K79A 3ZMDA 1CF7B 3ELNA 4MQVA 3NL1A 2F5DA 1T2KA 3ISPA 3O6BB 4XF1A 3U2RA 1O4TA 1U6GA 2ATFA 3FHZA 1ZZBA 2M87A 3JSPA 2Q0AA 2EV6A 3RNSA 3AAFA 2N7GA 3NQOA 3B02A 4WXHA 4BHBA 5EEHA 3VEPA 5EFUA 5IT3A 4JTOA 1YFXA 4I3PA 5DUIA 5HLIA 2FE3A 3TNQA 5C6CA 1ZLJA 4O6JA 2R7FA 5J48A 5DCMB 1QY4A 3DF8A 1GVJA 3EO6A 3MAJA 4YFNF 4ZYGA 2PFWA 1TNSA 4XSZF 1I27A 5J6XA 5JVTA 1SD4A 4GYIA 1T39A 4IEUA 2OA4A 5BV6A 1U12A 1YWKA 1FYMA 3C3WA 4UXNA 2V09A 1Z05A 2FNAA 2GA1A 1J7KA 3HSRA 3M7GA 1NZCA 1SD6A 4WF2A 3S7IA 3WE3A 5J8CA 4H0EA 4U7BA 2IPQX 4UHTA 2WFPA 1LDDA 4LG0B 4XFFA 2JTVA 2ZMEA 5AIQA 3BWGA 2VC0A 1NE6A 2L02A 2PN6A 3FX3A 3UKVA 4I0BA 5DUKA 3P9IA 4Q0SA 3TOAA 2CWEA 1BI1A 1CX4A 2BEOA 4IHTA 1ZNPA 3GFIA 4PIYA 1BI3A 1LJ9A 4RB0A 3LQQA 3ELKA 2DQLA 2P7CB 2A69F 3F8NA 3MYXA 3DPTA 2O3FA 1S8NA 1LEAA 1P4AA 2P4WA 4YG2F 3I71A 1XE8A 1HSJA 5BPIA 2QVSB 5HDNA 5D5WB 2GC3A 3H7YA 3WW4A 3VHRA 2CV6A 2FQ3A 2GIVA 1B4AA 1BI0A 4E2SA 4FAGA 2P5VA 3CEWA 4CHUA 4R1HA 2FSWA 5FO5A 4HVRA 4G7OF 1QBJA 4RAZA 1OI6A 3QAHA 3QACA 2G7UA 3IWZA 2J5PA 4P9UA 1U5TB 5TRDA 3DP7A 2UY8A 4HF2A 4IEYA 1MJBA 3NSTA 4ZU7A 2YX7A 2IXHA 1PDNC 2ZNYA 3T0YA 4AQ2A 3BJAA 4P9GA 1F5TA 2FBHA 4KIFA 1ZZ9A 2Y48A 2ET7A 4DNCA 1JHFA 1XDUA 2JPBA 4FT8A 5FCCA 3CDHA 1ON1A 2I45A 3ULQB 1BC7C 1RC6A 1OYWA 2DI3A 2KIFA 3ETQA 4KWLA 4NHJA 3HHHA 3BP8A 4EWDA 5LRRA 2GC2A 4Q0UA 5HDKA 2WC2A 2EA4A 4LUKA 1ZZ7A 1OFNA 3VFZA 2FA5A 4HQMA 3WTYC 4XEZA 4D7TA 3P7NA 4IEVA 1G6NA 4N9HA 4HAMA 3MEXA 1SQ4A 5LHHA 2OQGA 1LQ1A 4K2EA 4FAHA 2EJRA 3SCFA 3CJNA 3I7DA 4ENNA 3WTWC 1YTYA 2XKPA 5TJJA 2D5FA 3U0ZA 1XDSA 5E17F 2Y0MA 4I01A 1ZG5A 2HYGD 2XAHA 4IVNA 2ZMEB 4WX9A 1EPZA 3GEZA 2Q8KA 3W6JB 1SFEA 3SHRA 3F72A 1ZHFA 2HQRA 5LRSA 4YRDA 1KA8A 1USTA 4EWEA 2ETHA 1QPMA 1FZPB 3CLPA 3QPTA 1MDMB 2HTJA 4IEXA 2LF7A 2K02A 3CUQC 2GH2A 2IXIA 3FZ3A 4ESFA 5K5RA 1UIJA 1OD5A 1P4WA 1X8MA 4MGZE 4EMSA 1P2FA 4RAYA 1RUOA 3R4KA 4LLNA 4LA2A 2WV0A 1CAUB 2PHDA 2W57A 2ISZA 3U10A 1ULYA 3QOPA 2XLGA 4MZUA 2EFNA 4FHTA 1XGSA 5D4RA 4NQWA 2D5HA 4B29A 3NJZA 3CO6C 3FJSA 4RB3C 3R6SA 1TBXA 5FQ0B 1YW7A 4HN1A 2NYXA 1IPJA 1FYKA 4WXCA 1IRFA 4RGXA 3LZZA 4R52A 5EZWA 4J1WA 1NE4A 4KU7A 3FFQA 3E5UA 2C6YA 5BY5A 4EJOA 4EJTA 2DAOA 1ZRFA 1DZTA 1QZYA 1OYYA 3WTTC 1BM9A 3WTVC 2X4HA 4XFAA 1MD0A 3I54A 4IRGA 4UV8A 3PQJA 3SQNA 4O9GA 4PDKA 3H9AA 2F5FA 1RI7A 2GA2A 5K1YA 4KT5C 1S29A 1DZRA 4ENJA 4IXAA 5HLHA 5JR7B 2ZCWA 4G6DA 2ADUA 5IT9Z 4RB1A 4Q0QA 1KU7A 1CAVA 1ZN2A 2IVMA 4F7ZA 1FY7A 4EM0B 3R61A 5E8IA 4J1XA 3NEUA 3F22A 4MGIE 2K4JA 4OOIA 5KVRA 5CVJA 5FLJA 4HQEA 1K78A 4LLOA 3GFJA 5F1RA 1TQMA 4B09A 3GZ5A 3PLQA 2MBFA 1KYZA 1J3PA 2RC4A 3F8FA 5HS8A 2MC3A 3IKVA 1WLTA 4BIFA 1RNLA 4QXKA 4AQ6A 4XBFA 4QLCU 3OD0A 3H3ZA 4AIHA 3ST7A 5DCFA 2QYOA 3LWCA 5FFXA 3KP4A 4KN4X 4ZZDA 3SXWA 1TTYA 3FF5A 2L4AA 2QQ9A 2ZXJA 4HV5A 1J2XA 5FLIA 1IXRC 1ZYRF 3I4PA 5D1IA 1O7LA 1XSVA 2ZKLA 4ZH4F 1R00A 2DFIA 5H6RA 3LOIA 2Z9OA 1UW8A 1MGTA 4UVCA 4L11A 4IEZA 1LNWA 1ZVFA 2XAFA 4M6XA 3CF6E 2FBIA 1UB9A 2P5KA 4META 2L4MA 3PNAA 1JXSA 5IT9K 3CL1A 3G3ZA 3WTXC 2VONA 2M5WA 1R7JA 3I59A 3OTFA 2E9QA 4XFHA 3E6DA 3HHGA 3WW3A 4P5OA 3GFMA 3BY6A 2LNBA 1TW3A 2O8XA 3H1YA 2GXBA 2ZBKA 1WSUA 4FX0A 1H9TA 1FYLA 5KBFA 2IJLA 5FFZA 2FEZA 2XAGA 4EJVA 3GUDA 1OKRA 1CGPA 3OF1A 1X82A 2KIMA 4G94A 4AIJA 1YLLA 1J1LA 1KQ0A 3ZQ7A 4IRIA 4XF0A 2F4PA 5AIPA 3WTZA 3E5QA 2BE5F 4M74A 1R1TA 1XCBA 1R22A 4QX5A 3NVCA 2PEXA 3HSEA 3JSOA 3H3UA 5BUVA 4LB5A 3E3VA 4EVIA 2BNNA 4LD5A 4KIGA 2WTEA 4HSLA 1WRJA 2HTSA 4M9ZA 3JTGA 5BPDA 4XF9A 1G4DA 2COMA 1U2WA 5A2QZ 3J80Z 4A2UA 5L3CA 1EH8A 1T38A 5D5VB 1Q43A 2YSRA 2LKPA 2O0YA 3B73A 4EM1A 4K8FA 4L0YB 2PA7A 1CAXA 1U5TA 1IUYA 1GQHA 1NHAA 4M6YA 1H9GA 2YPRA 2DK8A 1B1BA 4JBAA 3HTUA 1D8KA 4OLLA 2IXCA 4MTEA 4KUMA 2KXLA 2XASA 3RKWA 1ZRCA 5I0RA 1IW7F 3T1BA 2RQPA 1JUHA 5FLXK 1FWZA 4L9NA 4ESJA 1NXMA 1ZX5A 3TO7A 4RD7A 4HYEA 4B8XA 1HKTA 3SFZA 3BCWA 4CDGA 1YHFA 5ERIA 4MV2A 1RUNA 1XRUA 2O1QA 5HS7A 1ZZCA 2DK5A 2W85A 3E97A 3H50A 1Q5OA 4EQQA 5FPXA 4HDUA 1HW5A 4O3MA 2HJIA 1O7FA 4EGYA 3SCGA 1FBSA 1IN5A 4LFUA 2XLFA 5D6FA 1PMIA 1X3UA 4CGZA 2PTMA 1EYBA 3BROA 1L3JA 2LSOA 2FOKA 4OIQF 4CXFA 4LEJA 2STTA 4RS8A 1UPIA 3ZDSA 1WI9A 2OD5A 3HQXA 3J80K 4QGMA 3ZN0A 5K5QA 2MPFA 3KP6A 4XLNF 1WQ2A 3WU0A 1ZG1A 3K1NA 3KETA 2VECA 3KLNA 4KU8A 1OYIA 3FE5A 3FXQA 3FMSA 1I5ZA 3ZMZA 5K8SA 1LVAA 3CO7C 2QLZA 1TLHB 4ETSA 2CG4A 3N97A 2UYAA 5I0UA 4G6QA 3IRQA 3V7CA 2EA7A 1TQ5A 5JR3A 3FXRA 2RVCA 3R0AA 3WGIA 4IETA 4MUVA 4LLGF 1XB4A 3MCZA 3I64A 4I98B 3F21A 3HRUA 4IRHA 3OGJA 4IF4A 5FPZA 3LWFA 1BJAA 1XGNA 3GF2A 2D45A 4XFIA 3M1EA 2RGVA 1QQIA 3BU7A 2IXKA 4G7HF 5KK1A 1TNTA 4A5NA 1PUEE 6PAXA 4OIOF 2D2WA 1W4MA 1MKMA 4R79A 2Z5UA 2QBYB 3D5LA 4A0ZA 3FM5A 4QGLA 4HZFA 5E1ZB 2R3SA 1SD7A 1KQ9A 4X6RB 2HQNA 2QJVA 2DQRA 2Q30A 4KWKA 5H6QA 2E1CA 1ZH5A 1A04A 4Y17A 2DCTA 2Z33A 3SXYA 4XFBA 3CUQB 4KMUX 3RYRA 3K0LA 1KU2A 5DDGA 2M1BA 1YLFA 1QZZA 5CVUA 3ECOA 2GC0A 4HLYA 2IT0A 5D8KB 4H7LA 3HOTA 5E1XA 1FOKA 2IA1A 3DFGA 4LGWA 4OIPF 1H1IA 4L2NA 2IA2A 2CQKA 5I0TA 3FMQA 1D5VA 1JHHA 2B9UA 3H7JA 3BPZA 3TQNA 5L3FA 1X7NA 3WW1A 4Q0PA 5L3GA 3IDCB 1T6SA 2JT1A 2RV8A 2ISYA 3F6OA 3T8RA 1YFHA 4AVAA 1HSTA 1USSA 3U9GA 3IRRA 2OA2A 2PMUA 4KICA 2H0VA 2P6SA 1YS7A 2QENA 2ZKZA 2HEOA 4LULA 4EM2A 2AS5F 2DBBA 3GXOA 3EYYA 2XAQA 3ZP5A 5CYVA 1FX7A 1YIOA 2CW0F 4BHPA 2CO5A 2VN2A 4M9SA 2UXNA 1MDMA 3HSFA 1FI2A 4NVPA 4LK1F 2RNJA 2ZFWA 1T0FA 4KNYA 3WU1B 3Q9VA 4RB2C 1O3SA 3LAGA 1J0RA 1ZGAA 2D93A 3IWFA 2PMHA 3HT2A 4N0BA 1XCVA 2VBZA 3KEQA 4PIXA 3FZVA 1FPQA 2E7XA 4MQ9F 4QM8A 4E70A 3I5UA 4MH0E 2IXJA 3R60A 3T8TA 4IEOA 2A6HF 1V70A 2ESHA 3FXUA 2J5OA 4EWAA 4ONUA 2DTRA 4Q0VA 1O3QA 2ZJ2A 3K2ZA 2H09A 2Q4SA 2JRTA 3HYIA 2XL7A 2VXZA 3DKWA 2JPCA 3LAJA 3K69A 2XGXA 4YYOA 4YFKF 3SHFA 3HIFA 2HFHA 4U0VA 4Z2YA 4ENKA 4ZYDA 3EETA 3FM3A 1DGWA 3RTRA 2BNMA 1SD5A 2RDPA 5HS9A 1JGSA 2Q2EA 5DCMA 2XIGA 3E6MA 5T3NA 3BOQA 2Y75A 3F8BA 2ELHA 3KP3A 2ET1A 4HLTA 5LHIA 4KL1A 1E17A 5JAXA 2CSOA 4HDVA 4KYWA 1ZG3A 1VTNC 1RTVA 1O57A
chains in the Genus database with same CATH superfamily
3RPQA 3OYBA 4UFHA 2V1DA 2BBVA 2IGOA 4AVBA 1S6LA 2OYZA 3BJ6A 4UFKA 4GALA 1ODNA 2V4AA 3TMOA 1SDWA 1UCXA 3SFIA 3ZQHA 1AL0G 5LHGA 1ZBA2 3CESA 4YIIA 2ZTNA 1IRZA 1FSHA 1JZ3A 1R64A 4QM9A 2YC4A 2DDUA 1BMV2 1NQJA 4XAAA 2R6QA 3FL7A 3UV9A 4HK9A 1WBLA 1TWAJ 1LR5A 3PDQA 4AG4A 1MZ5A 5F5QA 3PU8A 2ID3A 2XF7A 5CNAA 3ZMSA 3WQBA 5F6FA 4BY1J 2VCCA 5M0TA 5FMOL 2RS12 2EQRA 1SFNA 1W8FA 3VBHC 4J00A 1R1A3 1ZKGA 1NQDA 3RI4A 3ZFEB 1HDDC 5LA9A 5HI0A 4IE6A 4FOWA 1NCRA 3ZIWA 1OF4A 1QNWA 5KXBA 2QQJA 2XB6C 5HOOA 1SANA 2K9LA 3J81Z 1K4SA 3RZHA 2FNPA 5DAXA 4DPNA 5CVVA 4AWXB 4D94A 3KZZA 2KM2A 1UY0A 1HRI2 3CDLA 3BPXA 1VAMA 1W28A 2H94A 5JI6A 5F3CA 2LLKA 1UYPA 2RDSA 4CP2A 4DUVA 5DUUA 3IMMA 1TW2A 3Q8FA 2OQRA 1M1EB 2W0XA 5HXVA 3KD4A 2W4SA 3I3BA 3ZN6A 3BALA 2M45A 2XROA 4TV7A 5LZ6A 1US3A 2E1OA 5DD8A 3BTLA 2WJSA 1Q56A 2LW8A 2QQAA 1MZFA 4FBFA 1OLMA 4XK4A 1MBJA 5E89A 4E7HA 5IP6A 1CF7A 2LG4A 4I09A 4ZS3A 1BYHA 1OLQA 2HDCA 3WUCA 1DQUA 1UHSA 4PGHA 1U8RA 1OSGA 2Q8CA 1R9TJ 1I6HJ 4LHLA 3N4MA 1DHKB 1DUXC 2ADEA 1ZZ6A 1H1AA 3WTSC 3TN92 1D0YA 3TO6A 4EV0A 2PHLA 3ZXFA 2EV5A 1DCSA 4BMEA 2JZYA 4M9XA 1IDZA 3TDZC 2G19A 5F08A 4D0PA 3O5SA 4N43A 3ZMVA 2E32A 1WJEA 5D4SA 1X1DA 4FE7A 1WMXA 2GNMA 4OAYA 3GFLA 2ILMA 1EF4A 2BBYA 4CUGA 3CP8A 3H0OA 1PIV3 2XB5A 5EQUA 4A7YA 1Q3EA 4D7NA 5K7PA 3MIEA 3J26N 4ZYEA 3PIPF 3GYHX 3OYEA 5B1AH 3CCRI 3GXUA 1BJQA 4D9JA 5LBQA 5C8CA 3WOGA 2DDBA 3DPLC 2P3KA 4FPFA 5DEQA 4OHZA 2F4IA 5K0UA 5F04A 3URFA 3BUCA 4DZPA 2HWE2 3T0DA 1IPKA 4LIUA 2LFBA 3LA2A 1LVKA 1ULDA 3I4IA 3H1MA 3LMMA 2JVGA 1UYZA 3V4GA 5D6EA 2UXXA 3K7AJ 2MW8A 3GVAA 4XRSG 5CA6A 2NNNA 5B4NA 2NS8A 3E6CC 3Q0VA 1L0OC 4JOMA 1XSDA 3ABUA 4CDQB 3UETA 5E8AA 2A5YB 2JENA 3WNLA 4EN6B 4HF0A 2B0LA 2Y60A 3M3IA 5FDBA 4CEWB 4CYDA 1G59A 4AXOA 2L5QA 4CTEA 2FMDA 5EPAA 2FU4A 4RM3A 3VZKA 2ZX3A 3AZXA 2VNOA 4LOCA 5A2QK 3LD8A 3OYNA 5FMCA 5BNPA 1PVC2 4YW1A 4G7ZF 4TSVA 3VHPA 1IXSB 1LPQA 2ZNZA 1LHWA 5K0UC 4XRSA 1WA4A 4OIRF 2JG8C 3KV5A 2DTYA 1MNEA 2QQUA 4ZZLA 3U78A 4OUMA 3SZPA 2OAZA 4FPCA 2GALA 5FK7A 4FX4A 2AUYA 5L7OA 3VBSA 1GNHA 4EROA 2OUMA 5E1RA 4BH9A 5FTTC 5F5AA 4H55A 2GM4A 4BQWA 5GALA 4OMZA 4GCVA 4CUBA 5I0SA 1GV5A 2XBO2 1QXRA 4ZS2A 1HRV3 5FXVA 3BLYA 2AXLA 4JGZB 1X2NA 1R1VA 1YJ9I 3A4UA 3D0SA 4IZZA 4XTPA 3BCBA 5ICFA 1TME2 1S2BA 4HF1A 3BR6A 1VBA3 2GC1A 3HM5A 4NR1A 2VVFA 2ZJRF 1WGXA 1LU1A 2A07F 2XQRA 1FBUA 3ML6A 1JE8A 1TT0A 5AFBA 3NNFA 2MG4A 3RVHA 2VT2A 2FBKA 1NLSA 1YIJI 1I1GA 4WZCA 4DYQA 2KR2A 2R041 2DFEA 4ANJA 2EV0A 4KFCA 5E8GA 4BAYA 4PJNA 1R4NB 4LO7A 3CBNA 2MNGA 3IV5A 5DMYA 4QWNA 2EWNA 4ES9A 4XFGA 5HODA 1O5LA 3VKLA 4Q2FA 4NDLA 1YCIA 1K61A 4FXGB 3WG9A 4X0GA 2D7FA 4FPHA 3GCXA 3MBWA 3WV6A 2SLIA 4IQPA 3SISA 3AP6A 2G1MA 3QU3A 3MV01 1LOEA 4X6QB 4MYEA 1IAWA 3J81K 2ORZA 2FZ1A 1UCRA 5T5OA 5FY0A 1N1VA 3ZR6A 2ID6A 4WCGA 1JOBA 2RDNA 2JWTA 1QDCA 3RIRA 4IEWA 2WNVB 1WW5A 5C4JJ 2QZ2A 3UGGA 2LH9A 2WWJA 4UFIA 2W00A 5FP4A 4K1YA 5FWJA 1WVRA 5HV4A 2VQUA 4RA0A 3U4XA 2MEV2 5BNGA 3RDIA 1OLTA 3VGIA 1IN8A 2O6GE 4C8DA 4Y5SA 4KDPA 1YW9A 5F0CA 4QD2A 2E1NA 3MKLA 3EQLF 1RPWA 2ADDA 2XC7A 3RZZA 2VBXA 3S1RJ 1IO2A 1FP1D 3H35A 2JUGA 1OUSA 1S0FA 1S7EA 2CDPA 5IVBA 3ABMH 4QX8A 2ACJA 4O5VA 4OUEA 3CMYA 3CMGA 1YUDA 3AG2H 1UN1A 3K4BA 4AVPA 2QA4I 2DPUA 4A3LJ 2LP0A 4IL7A 3SKVA 5ABJA 3G1LA 2VG9A 3OB8A 1K7AA 1UZZA 3ACGA 5LEJA 1BKZA 3L2CA 2KT0A 1D8JA 4CEYA 1RUF1 5A1LA 4DJAA 5BNQA 4UFMA 2ESNA 2EXHA 2LROA 1JYTA 2HYKA 4C2MJ 1OQ1A 4WK8F 4YZ5A 3ZM8A 3BVCA 5LFAA 1I6XA 2FCVA 2TRTA 3CD6I 4P02B 1PGL1 5L3BA 3B7MA 3OY8B 1X4OA 4IESA 5DUXA 3CCQI 4XILA 1S7OA 3HEIA 2ORXA 4XICA 2VPVA 4DNYA 4DRVA 4LA3A 5CISA 2DYRH 4KWJA 4Q26A 2JECA 5LY2A 1EY2A 3A02A 2V9VA 5D8AA 3MW3A 3NW4A 1CAWB 3ON7A 3QD6A 3BZCA 5DM7F 4ZHNA 1OH3A 3F3XA 4Q48A 4V2WA 1IJWC 3NV4A 1SVMA 2O03A 4PK4A 3BI3A 3E7LA 3PVEA 1RUH3 3IL2A 4H2AA 4OI4A 4YGBA 1W6MB 3BU0A 1JI6A 1QJY1 4HSTA 1WKMA 2PFBA 5I8YA 1W9FA 4A3MJ 5L7OB 1XGMA 2XQXA 2AEYA 4RYDA 2XGEA 3GJBA 4A41A 3GLXA 4GDFA 4P55A 3Q0WA 3FBNB 3E6BA 2BGCA 5DYMA 1BOAA 3MV11 1LDKB 1HXS3 1R5GA 1DPUA 2DOAA 3TDUC 4CH7A 3V7SA 4QPIB 4B47A 2QZ8A 1EJ9A 3VBRA 3BZ6A 3N9LA 1VQKI 3JAMK 4YFXF 4BKXA 1IV8A 3S32A 2HKXA 3R4SA 1WI3A 4BNCA 4KISA 2RS33 1VBA2 4L9VA 2WAOA 1JBCA 3BR2A 1AR61 4HSJA 1OKOA 2WAQA 2NAZA 2ZGPA 5CKMA 3HC7A 2KKOA 4RGUA 2AC1A 1SLIA 3RZLA 4R8HA 4XFCA 3TOJA 2LY2A 4RGSA 3MQ0A 2A7AA 2BZDA 3J9SA 1D0XA 4L0ZB 1SFXA 1YO5C 2E33A 3VBOB 1JYVA 3OIQA 4Y4RA 4UOJA 2KQRA 1PP8F 3OSGA 5CBLA 1NY72 4IGQA 3VOEA 2DU1A 2VAUA 1XBFA 2PAEA 1OLRA 2X1DA 5F37A 4AI3A 2D40A 5D8LB 4BQ1A 3P3PA 4CDXC 2KHMA 5CVRA 2VVEA 4CDUB 3ALQA 3RKXA 3U1DA 2LYCA 4FTSA 1H4HA 4M3DA 2KDZA 4NWVA 2XAUA 3CLQA 1SBFA 2F5CA 1SVLA 1JODA 4S2FA 1Y39A 3TNPB 3H9JA 2XRNA 5J09A 1YQ2A 2OT7A 2K9ZA 3UR3C 1Y9QA 2C0ZA 4JGZA 4YZ1A 1GNZA 4MGSA 5APAA 4M72A 1DQ2A 3J8F2 2A6VA 3G71I 5KHHA 2QCSB 4TLFA 2GXGA 3H8RA 4UBGA 5IATA 3O1SA 5LW9A 2J1VA 4XLPF 3K4KA 1F9NA 3IKTA 5DQ0A 4A0YA 4IW3A 4I7HA 3USUA 3EQEA 2PI0A 2ME6A 2TEPA 4DXRA 2IAIA 4XETA 1W6QB 2ZGSA 4W4ZA 4EE2A 3KQ4B 4HMZA 4YVWC 4M4RA 1KJLA 5B4XA 3GYDA 3FHIB 3HJEA 3VZJA 1AA7A 2WY7Q 4M73A 2A6XA 2V4JC 1WJAA 5HCBA 2HWE3 4C3HJ 1RUJ3 3BDDA 2H1LA 4HEA2 4CP9B 4E9KA 1SLLA 1CAVB 1TME1 1F4AA 2Y0OA 3D0JA 1LUJB 1NLRA 3AFKA 3POWA 4HA8A 2WBMA 3WDWA 5J8FA 3GBGA 5FZDA 2A3WA 5J1UA 3BKZA 3GO5A 4XN0A 2HQ5A 3V8LA 1QGPA 2GOMA 2FRHA 3O1RA 4JP0A 3IN9A 2E7WA 3KZ4C 2QDRA 4XSXF 1E57A 1K3IA 2BFUS 1YRZA 2XG3A 3OEBA 3V65A 3NJXA 3JU9A 4IGOA 3ZFEA 1NYWA 5FWEA 3D5SC 1CJDA 4AIKA 3LSTA 2R7XA 2KRHA 4KA4A 4HVOA 3U14A 5CU1A 4A0XA 1XD7A 1LE8A 2DVFA 4KITB 1C5IA 3H1CA 1AX2A 2OZJA 2UUZA 3ABTA 5F7UA 3F9KA 3AB0A 5KHGA 3ZRGA 2CHHA 3V0AA 1N1TA 5E1WA 4Q8KA 2P6HA 3HNBM 5M3MJ 4JGYA 4L9JA 1OBNA 3V8KA 1RHI3 4UB6C 4HVQA 1RUI3 3ELNA 2ZX2A 3CJQB 3TRSB 4XJUA 4JKMA 3EMRA 1EUTA 2IGMA 1N1SA 3GZNB 2E7AA 2W5FA 2W92A 3ZQFA 1AR93 1RUD2 2XH6A 1AUYA 4JKKA 4UW3A 1SLBA 3R4DB 3PNTA 3AMMA 2B9VA 4B44A 1PM4A 5IHRA 3BR3A 5ABJC 3JUUA 5EFUA 4RAFA 5IT3A 1LOFC 3ZO0B 3OR2C 5B2GB 4NRMA 4XBNA 4I3PA 5KC5A 3MI8A 1LHVA 3DF8A 3EO6A 2RS52 3NJYA 1GWMA 1YE9A 1VQPI 2LR8A 4AAPA 2Q8OA 3JRDA 4ZDLA 4Q4V2 1H2KA 2LTPA 2HWB1 1VNDA 3QYFA 1U12A 1YWKA 5L9RA 4MGQA 2VOTA 4HPQA 2V09A 3OGGA 2CV2A 3C7HA 1NZCA 5FUPA 3ZYBA 4WF2A 3WVJA 3WE3A 3CCJI 4U7BA 4N4NB 2MEV1 2IPQX 4LR4A 2B42B 4UHTA 4GAZA 4OHWA 4B8EA 1AU7A 3RQIA 3QQAA 5FXWA 4LG0B 5DAPA 4XFFA 2JTVA 3KT4A 4XC9A 3BWGA 4N43B 3T0BA 1NE6A 3FX3A 2PHUA 3P9IA 3LSIA 3MW2A 3GCWA 3TOAA 1ZNPA 1HOMA 1LHNA 1PMHX 4RDUA 1VQLI 1LJ9A 1H88C 1JU4A 2GNTA 2DQLA 5F0FA 3ZDVA 2A69F 2FDGA 2R5ZA 3MYXA 1W6NB 2P4WA 3I71A 1HSJA 5BPIA 2VUMJ 4GWMA 1MSEC 5HDNA 2AXTC 2HVRA 5A33B 3IAPA 2QE3A 1EV11 2CV6A 5FREA 2AR6A 2VQHA 2BDRA 4E2SA 4XXAA 4F83A 4FAGA 4BBSJ 3DPRB 2P5VA 1LEMA 3OYCA 2JJ7A 3WY6A 3NWKA 5JLXA 1YI7A 4HVRA 3ZQLA 5A7WA 4J25A 1QBJA 4RAZA 3VBOC 3QAHA 2JK3A 2G7UA 2J5PA 4P9UA 5TRDA 2EZKA 2L7MP 1MJBA 2LKSA 3M7AA 3MEPA 3Q8BA 5CFDB 2IXHA 2WZR3 5AC91 2QEXI 2FD5A 3LNQA 4LKSA 1Y8RB 4P9GA 1F5TA 2Y48A 1MS3A 4ATEA 3BR0A 3S93A 1XDUA 2WZPP 3AKZA 5FCCA 2GH8A 3QWLA 3GDBA 2ZX0A 3JBG3 4B3XA 4AL9A 5J37A 1CZSA 2RS11 1JMUB 2UU8A 3BP8A 4EWDA 5LRRA 1ZR2A 2WT2A 5KHDA 3C7EA 4BMBA 2RS13 1CJPA 4XJAA 3Q3SA 4M3EA 2LY1A 4HQMA 4DUWA 1OCOH 1G6NA 1SQ4A 3FLPA 3OBZA 1D0HA 5LHHA 3AVRA 2ZJQF 2LTNA 5FJHA 4HSRA 1D1CA 4IE0A 2WB1A 2EJRA 4Q4W1 3I7DA 3ZKUA 1AF9A 5TJJA 5DAVA 3U0ZA 1XDSA 5E17F 5A7OA 1DU6A 1G7YA 2E6VA 2EZHA 1ZG5A 5FZFA 2ZMEB 4MXWA 3RSNA 4WX9A 3GEZA 2Q8KA 3W6JB 1SFEA 3T3YA 1YIFA 3KHBA 2HQRA 5FIXA 4EWEA 1QPMA 4BJ0A 3UYJA 2W52A 1MDMB 4IEXA 3CUQC 2GH2A 3FZ3A 5IVYA 5C3RA 4NAMA 4LBLA 4NIIA 3BR5A 3A0HC 1RUOA 5DZFA 1MMGA 4LA2A 1BW5A 3S30A 4XOTA 2ISZA 1ULYA 2XLGA 1HQNA 4YZ3A 4FHTA 1XGSA 5D4RA 4GZ9A 3DPUA 1BA5A 4UFJA 3MZ8A 2RS32 1UL9A 3LSKA 3R6SA 1LGCA 5JLWA 4QPYA 5JPNB 1ENSA 2WFF1 1UZ0A 5EZWA 3G6EI 4XLFA 5GPAA 3WD5A 5BY5A 1HRV1 2KISA 2NVXJ 3IDEA 1WW4A 1DBNA 3WTVC 2PHXA 5AFEA 5GLTA 1JOPA 4Y7NJ 4O9GA 1BR4A 4PDKA 1E5HA 1RI7A 2PLV2 2Y6GA 1ZTRA 2R072 2EILH 5J4VA 1MQTC 4WVWA 5JR7B 3ZX7A 4YW4A 2TNFA 3OSDA 2ADUA 5IT9Z 4CP9A 1HIXA 2CQ7A 4YW3A 4GFBA 2BWCA 4CP0A 1Z3YA 4HPKA 4R9CA 2OF7A 4OOIA 5KVRA 1IC8A 5A32A 1H2NA 5FLJA 4HQEA 1K78A 2JDPA 4DFSA 5BNNC 1Z77A 4LBJA 4B09A 1MH4A 3PLQA 5T52A 2HWD3 5FZ6A 2RC4A 2I2SA 3IKVA 4ARXA 1ZBA1 5FZKA 2VTXA 1UF2C 4N53A 3WNOA 2HXIA 4MO7A 1GZWA 4BE2A 4AIHA 5JR2A 2VUAA 2VH9A 5DCFA 3KP4A 1F2NA 4GIQA 1TTYA 1TC3C 3A0BC 2W9XA 2H1KA 5IWFA 4FASD 2QQ9A 3NRUA 2K85A 2DCJA 1TMF1 2ZKLA 3IPVA 2YG0A 4ZH4F 2DFIA 3LOIA 1UW8A 5CEHA 3JRBA 2P3YA 4GJYA 3O1MA 5T54A 2WNOA 3WG4A 4AZZA 4S2GA 3WDTA 2FBIA 4LE3A 1GICA 5IT6A 4META 5FLVA 5JZGC 1SAUA 2ZEWA 2VW1A 5IT9K 5T55A 3G3ZA 3WTXC 2WADA 1DGWX 4XAEA 5CG8A 2VONA 2M5WA 4PSWA 1SPPA 4BQ4A 5DM6F 1R1ZA 2XPJA 4XFHA 3GTGJ 1X1PA 3HGGA 3GFMA 3GTPJ 3BY6A 1PO22 2VM9A 3H1YA 4FX0A 1UOFA 1H9TA 4M00A 2L9VA 1XG1A 2C9AA 2IJLA 1QMJA 4DIQA 2DT6A 5GLZA 3LEKA 2LOOA 2ZXQA 4IRIA 3VD3A 4XF0A 2Y0SA 2X6OA 1B09A 2HWF3 1R1TA 3VB9A 1MQTA 3NVCA 2CQQA 2RR11 1KDKA 4CDQC 5F2SA 4K40A 3LEMA 2BNNA 5F5CA 1LENA 3QODA 4YEJA 2GXAA 1OUXA 4HSLA 4M9ZA 2VNGA 4XOPA 3L1PA 1QHDA 2GDFA 2R7SA 2XUEA 3EPZA 3H5NA 5EYXA 2YSRA 2O0YA 3B73A 2WT0A 1JXNA 2A71A 1W0PA 2VZTA 1W8WA 5FO8B 1CAXA 1AR62 1IUYA 1H9GA 4BACA 5LA0A 2DK8A 3JREA 2DFCA 4COWA 5HBAA 1RHI1 2IXCA 4Y22A 2X09A 2J1SA 2KXLA 3N35A 2XASA 2AYHA 3RKWA 1ZRCA 2MD0A 4QX1A 4A3FJ 3T1BA 1X58A 1JUHA 3WF1A 4COYA 1JZ2A 1ZX5A 5LBEA 2R49A 4PQ9A 4HG2A 1MQTB 4RD7A 3D5OA 1OVPA 3SFZA 3BCWA 3RGBA 1H9PA 2MABA 4QXBA 4OMCA 1MH3A 2DK5A 5FFOC 1VBB1 1ETKA 1GMMA 1XTAA 1Q5OA 3KPHA 2AZ5A 3FN9A 5FPXA 4O3MA 4LMFA 2XLFA 4YGDA 3VL9A 1PMIA 2PTMA 4CEYB 4RN5A 3BROA 5KCMA 1U5YA 2BV4A 2RJ2A 2VUJA 3MW4A 1X1BA 4RGKA 4N90A 4RS8A 1WI9A 2LS6A 3ZN0A 2DURA 3K1NA 2VQLA 1O4ZA 3KETA 2VECA 3KLNA 1JN2P 3LOBA 4XQFA 2FDHA 3ZMZA 4IX7A 2QLZA 1JW6A 2JE7A 4BE3A 1C8NA 1AVBA 3VDDB 4Q4X1 3NJVA 4LORA 3NNMA 1JYWA 5IUQA 5I0UA 2VZQA 3IRQA 2P81A 2K3PA 3JXSA 3V7CA 2R30A 3GMEA 1TQ5A 3I2JA 3UJQA 2O7OA 3TL4X 2WNUB 4DXZA 3FXRA 3CZJA 3CP2A 1BHGA 1LU2A 4BXSV 1OJLA 1RVF3 3F21A 3HRUA 4IF4A 1BJAA 3K4DA 1MW7A 2HBUA 3VBHA 4CA0A 5KK1A 1TNTA 1AX0A 3IH2A 1DQ5A 1MKMA 3A0KA 3G6JB 3UESA 3FM5A 4LO5B 4QGLA 1ZR4A 3WQ0A 3VBUA 3NAPA 1WA6X 1QEXA 2HQNA 1MVEA 1AXKA 1VQ9I 1BQPA 4KWKA 1ZH5A 1R5ID 3K4ZA 2DV9A 2X48A 3W2AA 2M1BA 4AYBA 3ECOA 1CD3G 3VD9A 3U21A 4HLYA 3J7MA 4H7LA 4B7EA 4IHWA 3VBRB 5E1XA 1FOKA 3GZTB 3X29B 2WINB 2BY1A 5LD2C 2E5NA 2R1BA 3PUHA 3NNJA 1GDTA 2DTWA 4YIRX 3FMQA 1JHHA 2AREA 2NVYJ 4L99A 3PIOF 2ZJCA 4NIAA 3DTKA 4XDQA 2JSPA 1AHSA 3N7MA 4PSXA 2DT7B 5L3GA 4BQNA 1T6SA 1GLNA 1WZ2A 2R7QA 2G9ZA 2XRLA 3G4SI 4GH4A 3F6OA 4QX7A 1YFHA 4AVAA 2K9SA 1HSTA 5FYTA 2ZEXA 2PMUA 4YM3A 1BXHA 2QENA 2HEOA 2WKKA 4LULA 1OQEA 4EM2A 4C9YA 2AS5F 2WAAA 3PVNA 3ZXJA 4OHXA 5CYVA 4PDWC 3JBG1 2P5BA 2LBFB 2IVIB 3B9IA 1MDMA 5IYBJ 1F15A 5FZMA 1QJX1 3E1F1 1A5JA 4TZDA 1DQ6A 1YITI 1T0FA 4KNYA 1VPHA 4RB2C 3LAGA 3NAPC 1MACA 3TP3A 4XOGA 3TEWA 1UO9A 1N78A 2RM22 3KEQA 2VBZA 4XNFA 2JEMA 1EA3A 4AEDC 4MQ9F 3VV1A 4QM8A 4E70A 3DWLE 2IXJA 3S3OA 4E7JA 2A6HF 4EZ4A 2Y64A 4HRIA 5EDNA 2WDBA 3PL8A 4CEWA 3K2ZA 2GMMA 5FAXA 2A5WA 1VQ7I 1N3PA 1U9NA 2JPCA 2GSYA 4CDWC 2ZAHA 5HCFA 4DGWB 3HIFA 4ENKA 3C2BA 1JGSA 5DCMA 3OBAA 2L2OA 1AYN3 4HLTA 4KL1A 5FO7B 3VHNA 3CDZB 1KEXA 5FZOA 1RTVA 4NRPA 3KCYA 2GQQA 1R58A 2HKOA 4FPLA 4DW6A 1COV2 5FYZA 2VI6A 2RV9A 2EK5A 5F32A 5HCAA 2YX4A 1DGRN 4PHZA 1CZVA 2YROA 4Q27A 1FMWA 2WL1A 5L9BA 4RR3A 2I74A 1E5IA 3ZXGA 1NCQC 4A3KJ 1HJFA 3M2MA 1WLDA 4WVZA 4A3IJ 2WQZC 3NO8A 1DP3A 4HBLA 2H6BA 1P7JA 5CKQA 1GU3A 3WCRA 3LFKA 1DU3D 2Z79A 5A6QA 4GWJA 4JCKA 4Q29A 3RSJA 1JZ4A 1WKYA 1RKWA 1UWWA 2HOAA 4H14A 1YQAA 1LFPA 5LGUA 3GTJJ 3LFUA 4HONA 5FY5A 2ZSHB 2RS51 3O12A 4QQ2A 3IAS2 3P9KA 3EXUA 4EN7B 2B7YA 3LA3A 2BYVE 4FTBA 4XUNA 3MO4A 4MADA 3S2WA 1G3WA 4AIDA 1DGRM 4IHYA 4QHZA 3GTQJ 4XUTA 2KLOA 3K75B 2A6EF 4G8XA 4CU8A 1FTTA 3USSA 3AG4H 2QBXA 4K9SA 3AM2A 5FD5A 1V0AA 2HWF2 3LIGA 5L7OC 1C1FA 2P7VB 2JA7J 1ASJ1 4NIGA 5EGOB 2H6CA 3FLTA 3S5AA 1PVXA 2XSJC 1WD3A 3BTXA 1PZ9A 1GHCA 3W6KB 2XR4A 1AR92 1W36C 3CUQA 2LREA 4MGYE 2QQ8A 1HLCA 4C90A 4QPGB 2Y9YA 3GWZA 3ZMUA 2E7TA 1A6QA 1RUG2 4LKFA 3H1WA 1YOVB 1W9YA 1KQ8A 3ZOIA 3C2GA 3SZTA 4I30A 3WLUA 2ETEA 5KXEA 2NRAC 4AHWA 1GZ9A 2XWBB 3THCA 1J1TA 2RE9A 3O1TA 1OT5A 4J19A 4N53C 3W2WA 3I3LA 1ETXA 3ASNH 2OTJI 4MXWB 1V55H 1Q8QA 2WZEA 2Y9ZA 1YIPA 4LTAA 4QPWA 1TME3 1V9U1 2IFWA 1VP6A 1XSXA 4SLIA 4FTHA 5JXGA 4PLOA 2ZGQA 1YS6A 2CRGA 2NVTJ 4CE8A 3TOBA 2WBKA 1XMXA 1B9MA 2XBO3 4LBMA 3VBRC 1QXJA 1LRHA 5C9AA 1G9AA 4Y52J 1UY3A 2IVJA 4PT6A 4B4RA 3VODA 1QNYA 4UBHA 3A0NA 4IOCF 3CF5F 1AZDA 4INDA 1GFF2 1AXYA 3BG9A 3V64A 5CQGA 4YG6A 5T5PA 2JIGA 4N9IA 1MJAA 4YVSC 4XKBA 3WDVA 3F6VA 4M3CA 2PJPA 3ZPOA 5FROA 1J83A 5A7QA 5A33A 1XNAA 2QKLB 1G86A 5E3LA 2C5DA 5LLQA 1SFUA 4JQRA 3ES4A 2HOSA 4BJTA 5EJ3A 2PQQA 2BXYA 3F8CA 3A01A 4HNTA 1CESA 2BGOA 5FY1A 2KIQA 4FOQA 5I8SA 5JLVA 1DDLA 2W94A 5LA1A 4RM2A 1N77A 2VBPA 1DP0A 1RUC2 1JYNA 3WGGA 1HLVA 4JX5A 1WUVA 2HOEA 3JRGA 1REPC 3CIHA 2DYSH 3IIIA 4A4AA 1B9NA 3BT9A 2J22A 4U0WA 1DLCA 1LOGA 1FNNA 1N1YA 1PZ7A 2PAKA 1UPSA 2DVGA 1KYWA 4AM3A 1OH4A 4XJ9A 1LFUP 2VBWA 2NMOA 4LMYA 2RDQA 5EZHA 1XE7A 3M8LA 1DYPA 3KV9A 4YW6A 2YBKA 2MFZA 4OFGA 5F3GA 2E35A 3VHOA 3PJYA 2HWC3 2VL4A 1OPOA 4ZJZA 2XUBA 2EXJA 2OU2A 1VIWB 1AR72 4QKNA 4E4HA 1B6AA 4OINF 1IS6A 2O8OA 4XACA 1T98A 4O61A 4D6SA 3B6CA 4CEYC 1FSEA 5IVJA 1B72A 1TQPA 1ZZ8A 3RQ0A 3FWEA 1FLIA 2BJSA 1D4M3 3K2OA 2X6XA 3LQRA 4IOAF 1SMYF 1H9WA 2X8KA 1V5FA 1Q1HA 1UHMA 2CAUA 2A61A 2QGUA 1WCSA 1PVC1 2VJXA 4BXFA 5IPAA 2NS7A 1J58A 1PNFA 3L09A 5BS6A 1O91A 3HN3A 1J59A 1R1A1 4A3BJ 3O2PE 1VQMI 3LPFA 4XN3A 2A6ZA 1D4M2 1VLNA 4HANA 1PYVA 1GLHA 1R4MB 5FZ9A 5H9QA 1V6KA 3TWIA 3K9TA 4DY5A 2PG4A 2VE9A 3T1MA 2XVLA 3QPHA 4RL7A 3OPWA 2E26A 2AENA 4QU2A 3WE2A 1QU3A 2VULA 1MJ9A 3AKQA 5F8PA 1JZ7A 2OPTA 5CZKA 4L97A 3THDA 1FX5A 3I0TA 4XRFA 2PMWB 5AVAA 1MBFA 1XXNA 3SYTA 2IS6A 5FZCA 5L3DA 2ZXWH 4YM1A 4Q5OA 1FT9A 2H27A 1H8VA 5IOYA 3HRMA 2ENRA 2L3DA 2M9HA 3LFIA 2JDKA 3M70A 2X05A 4CCCA 4II2A 3HNYM 2K5CA 4OMYA 2QNKA 1W7PD 2A3SA 2M4KA 1HF0A 4ZXEA 3DYPA 2V1UA 4NQWB 4W6XA 3OEAA 4HLXA 3RCOA 2D1VA 2CYFA 2CUFA 1Y0NA 5IVCA 4XQDA 2VTFA 1NK3P 2UURA 3T5XA 1DDNA 1VBB2 4D7YA 1KU9A 2HWF1 1RHI2 3ATGA 1J5YA 1JTXA 1STZA 5A1FA 3LSEA 4LJHA 3WR0A 2ZHKA 4E6KG 3M1CA 3Q8AA 5BQTA 2DA7A 5BPXA 1W6MA 3P5BA 2LDUA 1GZCA 2AHQA 2HGCA 3X2QH 1YW8A 3T4HB 3HOSA 1J3QA 2NP0A 1ULFA 1W99A 4LJZF 1SEFA 1ZA7A 2ZMLA 1S0CA 3DKYA 3RWNA 4P5YA 3JCIA 4XXPA 2X29A 5EYYA 2YU3A 3J7AY 4PJLA 3VWBA 3NV2A 5A1AA 5LBFA 4O9EA 1DYKA 1UOJA 1NK2P 3G1OA 1JS9A 2ZBJA 2QTWB 2Z1DA 4BQ3A 1X8EA 2WNUC 5C4WC 4XLHA 3ACHA 3HPGA 3POIA 1TVGA 3R4UA 4L5IA 1KS5A 1RMU2 1XPXA 3EB7A 2RJLA 1KZHA 1COV3 2NNYA 4YGEA 1X1AA 3WNPA 1ULCA 2RVAA 5LA2A 2PQ8A 4HX4A 2VMFA 3ASIA 3DTIA 3PSIA 4AEDB 3ROUA 1LB2A 2FHRA 2Q0OA 3L2HA 3N3HA 5ANNA 4YNIA 5FOJB 1WHUA 5FB2A 4ZDOA 1E0EA 4N4OB 2A6WA 2VXJA 4OHVA 4YG3A 4AEKA 1GYKA 3V7RA 2Y8KA 2DU9A 2ZGNA 1RUE2 1QRYA 2D6MA 4D6RA 3DCFA 3S14J 4ENMA 1EH7A 1R71A 3IIAA 1XYPA 4XZPA 1UJ8A 4D3WA 2YBPA 3C8XA 1HRI1 4MXVA 5GP9A 3GZ6A 1RMU1 2P5LC 3CCYA 1XPWA 1HKSA 2ERFA 5C33A 2K9MA 5BXXA 1EKEA 2WFF2 3ZYPA 1WCQA 4A3XA 4Y20A 1OFCX 2DA1A 2ZA9A 3IAQA 3VBUB 1TQIA 3SNMA 4EJWA 4J01A 2RG4A 2GBYA 2MLGA 2P3JA 4HX8A 4BCUA 5A70A 4A5MA 1JTYA 3REOA 4A44A 3OYLA 1RUC3 2ELKA 2RN7A 1CVNA 2LM3A 3M3CA 5GZCA 2HQAA 4BXXJ 1REEA 3C7FA 2P8TA 5ICGA 1SDDB 5F6KA 4OQ8A 4P5HA 1VBC2 3EJKA 1BR2A 3NARA 1AKHA 5GZFA 2AACA 2QCOA 4AFMA 1F43A 5FYSA 3ZYRA 5C5TA 4S04A 2QQMA 3RKYA 2HDDA 2FF4A 2K9NA 2HR3A 5FV3A 1FYUA 5IFTA 4IV3C 2HPIA 5DPNA 3RG0A 1XYNA 3OOUA 2DN0A 3L7WA 1BBT1 3E5XA 4ZYHA 1A3KA 1UXZA 3CUOA 4JVAA 2XF5A 4KN7X 3LDBA 3WNNA 2B8MA 1W90A 1Z1DA 5ICCA 3ZXKA 1OURA 3TN93 5FKNA 3ES1A 1FOXA 5FY9A 4I2OA 3GTKJ 2HOTA 2ID4A 3R05A 1S55A 2L9SA 4MHGA 5M3FJ 5L19A 1D2QA 3BCAA 1VJ2A 1FMD2 4FPGA 3G73A 4O7XA 1XMAA 1QO0D 1Y3TA 1OOPC 4B4QA 3HZJA 2WNEA 3S57A 2M8EA 2XJPA 4CDWA 3G1MA 5C5UA 3PO2J 2KD7A 3U11A 1T08B 3VBSB 3LDKA 5FZGA 3PM1A 3TEDA 3OGSA 1UMZA 3SEPA 1I5PA 1OA4A 2VOPA 2COBA 4KMFA 5AC93 5KHIA 3JW4A 3RPUA 3H9GA 3RZDJ 1MEC1 3KCCA 2VASA 3KZYA 5TGTA 4E7ZA 3EHKA 5G04L 2YU2A 5CQEA 4ATFA 3C3VA 3DYOA 5FZ0A 3RZOJ 3H3LA 4RFT0 2D6NA 1XNDA 3C1DA 4F8AA 1V6IA 5J1YA 1MMDA 4IPAA 4AFBA 2EFPA 1JI8A 5IVFA 2R7WA 3F23A 2LKXA 4NHLA 3KV4A 3L2UA 3ZR8X 2Y26A 2P37A 3HOYJ 1HW2A 2HH9A 3VBOA 1WCDJ 1G3TA 1QXPA 2R7UA 3J7HA 4E7KA 2UYBA 4L18B 3MFKA 2X1EA 5EIYB 2ECCA 3DU5A 4BE1A 3M8EA 5FQ0A 4CUCA 1CAUA 1FAYA 5CG9A 3NAPB 4BLIA 1I39A 2FXAA 3NRVA 3Q0UA 4FCAA 2ZGTA 2YYOA 2ME0A 4IKFA 1R082 3D3AA 1YG2A 3IHUA 2DCZA 2RDRA 2L54A 4Z07A 1GV9A 4XQWA 3K6GA 3AP5A 1QWRA 2PMZA 1W9TA 2YUEA 2HWVA 3VB2A 3EUKL 3OG2A 3PUAA 3N9NA 1EP0A 5ANQA 2CW8A 4UB8C 4EJUA 4IHSA 3GALA 5D5XB 3WDYA 3DL3A 4RS5B 3WF0A 4LOTA 4RLQA 2W2IA 4PBPA 5IYDJ 4URTA 3FC0A 4L92A 5HNFA 2OPKA 1GXPA 3QRFF 1IF1A 5EF6A 4XIKA 1UOBA 2SBAA 1BIAA 3IH4A 1WWXA 2QUFA 1K79A 1CF7B 2W1SA 1GOHA 2W47A 5B3SH 3VZLA 1X2MA 1W2OA 2QQOA 1V6LA 4YFWA 5JMCA 4Y22B 1O4TA 2ATFA 2K9QA 2J1RA 4KGGA 5A3UA 2VR4A 3LL7A 4P08A 3RNSA 1S0EA 3DBLB 4NROA 4LK7A 4MIMA 3NQOA 4JC1A 3VEPA 3W59A 5CYYA 2BWAA 1YFXA 3SC7X 3TNQA 4BL0B 4M3CE 5GJ6A 5J40A 4P14A 1GVJA 1OISA 3QBQA 3MAJA 1REFA 4YFNF 2K46A 4CZCA 3SZGA 3KLSA 4SBVA 3I56I 1TNSA 2PFWA 4JDNA 5C71A 2EIJH 3TN91 1I27A 3MKZA 1KFUL 3J4UH 3FISA 5SV8A 1XJAA 4PFPA 2I5UA 4UXNA 1VBD3 3UJOA 2FNAA 1J7KA 2R042 3HSRA 3M7GA 3RZJA 2DFBA 1T6GC 2N8GA 2CWMA 2XVGA 5FPUA 4WM8A 2EINH 5E3MA 1PO13 1FV3A 5D2AA 2ZMEA 2BY0A 5DUKA 2CWEA 3ZQIA 3PNYA 1RB8G 1BI3A 2JXAA 2LUWA 5F3IA 3ELKA 4IO9F 1TEIA 3OOXA 5FJKA 3OBTA 2O3FA 1LEAA 4QQOA 2QVSB 4UW5A 1JKQC 2DFFA 5D5WB 5H9SA 3JRHA 3I2HA 3H7YA 3VKMA 4FPJA 1G2HA 4PF5A 4LO6B 2FQ3A 2FBEA 2GIVA 2ZC2A 1RVF1 2FSWA 3EUAA 3ZFFC 4IDZA 3BYWA 2KP6A 1OA2A 1U5TB 5M5XJ 4XPVA 1XU1A 2NOJB 1A78A 3FK7A 2PJRB 3DEEA 4ITVA 1PDNC 1VQOI 3KQRA 1ZZ9A 1LHUA 3VKNA 2ET7A 4DNCA 1JHFA 1POV3 3OJBA 2V4VA 2JPBA 4ZZ5A 2W3JA 4A6SA 2I45A 3LSDA 1RC6A 1FV2A 1W8TA 4KWLA 1LOAA 3ZFEC 2JA6J 4A3ZA 3O1VA 1CPNA 4LUKA 1OFNA 4TYSA 3VFZA 2Y69H 4XR6A 5BNOA 2V5YA 2NVUB 2YPJA 4GD4A 4D7MA 1OCRH 2FA5A 4XKWA 3CQZJ 4V19K 4N9HA 3MEXA 2HVQA 2OQGA 4QQLA 2VNRA 2IS2A 2CV1A 1XSRA 3CJNA 3JD71 3UNGC 3FXOA 3BOPA 2XKPA 2H8WA 1JZ6A 1MS8A 2OS2A 2Y0MA 4I01A 1A6IA 1HDKA 3WF2A 1JZ8A 5FUIA 1EPZA 4B43A 1NLQA 5EXOA 3I2FA 3JCUC 1ZHFA 5FZ8A 1KA8A 1USTA 3ORJA 4K21A 1BK1A 2YGMA 4GWNA 1ODMA 1K5MC 5A6ZA 1KJRA 2B39A 3OUHA 2HTJA 1WD4A 2JKBA 5A32B 2LF7A 2K02A 3ACFA 2LY9A 4ESFA 1X8MA 4MGZE 4N8MA 3WDUA 2VVDA 4RAYA 2VL8A 3POFA 2WV0A 2VB6A 1RUH2 1Y1WJ 4HK8A 5LWBA 2EFNA 4R4XA 1V5EA 2CU7A 4BDVB 5KWRA 4RB3C 5J47A 1YW7A 4KG0A 1IPJA 1FYKA 1QU0A 3PUBA 4WXCA 5A7SA 1NE4A 2WYFA 2C4XA 1PZ8A 3E5UA 2C6YA 4HNVA 4EJOA 3GTLJ 4I3GA 2DXIA 1HXS2 1OYYA 3WTTC 2X4HA 3I54A 4IRGA 1I3HA 5B1BH 4HL0A 1GSLA 4C2UA 2W1WA 2A3YA 4JRLA 2RM21 3LFMA 4CVUA 4UW4A 4ENJA 2ZPXA 1QOOA 4LOSA 4AVTA 3B6AA 4G6DA 5BNOB 3I2GA 3SKJE 2WLPA 4X8NA 5HPOA 5EEAA 2K4JA 4M6VA 5CVJA 4LLOA 5I0DA 3WNXA 5J1XA 2W08A 3GFJA 5F1RA 1TQMA 3VZMA 3GZ5A 1LGBA 1TWHJ 2I8DA 2OC6A 1J3PA 3S1QJ 3F8FA 3WP6A 3KM5A 1WLTA 2XWJB 1MBHA 3A01B 4JX0A 5C44J 4COZA 3R0RA 1RNLA 4QXKA 4AQ6A 5FZEA 3K70C 4P9YA 5KR7A 3LWCA 4WM8B 5FFXA 3T2OA 5C8CC 2YHJA 3MF9A 1ENQA 1TWFJ 2ICWG 2E60A 4GB31 1GP6A 4HKWA 3K4JA 2WAFA 4HV5A 1LKXA 2HEVF 1J2XA 3CCMI 4D6QA 1ZYRF 5C3SA 3H0DA 1XYOA 1YQ8A 5H6RA 5JOWA 5A3MA 5FR3A 1Y4WA 3S5QA 1MGTA 4UVCA 2WN2A 1PX4A 5GZGA 3PIGA 5GLWA 2YMZA 4IEZA 2Y6KA 3H5RA 4ISQA 1UB9A 2L4MA 3K3NA 4PCRA 3PNAA 2DCKA 5FZHA 2M0CA 1L7QA 3CL1A 3TEXA 4BWOA 5DTDA 3NV1A 2AGSA 2JDYA 5EJ1B 3CJRB 2WWUA 3VBFC 4P5OA 2LNBA 4JAAA 1C57A 2GXBA 2PHTA 1AXZA 1UX7A 2ZBKA 1ENRA 1OCCH 1W8UA 1QA6A 4CA9A 4AWDA 3KVAA 1CN1A 3VYUB 1R081 2W95A 2KIMA 5JOXA 4G94A 3UK9A 4AIJA 3FHAA 1YLLA 1J1LA 4BEHA 3MIDA 2F4PA 4IV1C 3ZXLA 3M3QA 4RR3B 4S0HB 1YRNA 3H42B 1XCBA 1R22A 4G6TB 1QQP2 3H3UA 5CPRB 3A03A 2D43A 1ND3B 2RMU3 2DDAA 3ZFGA 3CC4I 2WTEA 2BHYA 1B35A 3DBRB 1WRJA 4NHKA 2HTSA 4Y5TA 3J7NA 3MMYB 4CEWC 3GBWA 2JJ6A 3JTGA 3BGAA 4XF9A 2XF6A 1NAEA 4OZOA 1BBT3 2COMA 4M4PA 2HDWA 4YVWB 1W2AX 5A2QZ 2BVLA 1RUF2 3LSHA 1U5XA 4L0YB 2VE1A 1NHAA 4M6YA 2P4EA 2ZGKA 1QHGA 1JU3A 4KUMA 1OCZH 5I0RA 5LBCA 1FWZA 4L9NA 1LOBA 3LGRA 3TO7A 1FOD3 4Z1VA 1WW7A 1W1WE 3VZNA 2K40A 3PUFA 1YHFA 1RUNA 3WSOA 5LATA 3E97A 3H50A 3ZFFA 1JH5A 5EG0B 3MFAA 4EQQA 2QSGX 4AVSA 1W2TA 1HW5A 1O7FA 4EGYA 3I3MA 1FBSA 3MIGA 1PGL2 1X3UA 1K5JA 4UF0A 1WLCA 1L3JA 2BERA 4AOCA 5FMDA 2RNGA 2STTA 2WO7A 3ILRA 3JRIA 1RR7A 1RMU3 1OD3A 1OF3A 1K5MB 2HEWF 1CWPA 3NNGA 3KP6A 4B4CA 4R9BA 4ISRA 4JQTA 1QF3A 1VBE3 1X3ZB 4B7KA 4GRIA 2CUJA 1OYIA 3FE5A 3FMSA 1I5ZA 2R5YA 4ES8A 1LVAA 3CO7C 1TLHB 2CW7A 2CG4A 3HB9A 2OPWA 2E2HJ 1EUUA 3SH5A 5CAZA 1F31A 4Y4YA 4CCMA 1SCRA 5C9AB 4CCDA 3WGIA 1W6QA 4IETA 4MUVA 1KGYA 5F6LB 2D3RA 3CZUA 3MCZA 5GPCA 1PO12 3OGJA 4IRHA 3USUB 1VBC1 4U36A 2VZOA 2M34A 5FPZA 1SFYA 3GF2A 3J8F1 2RGVA 1QQIA 5C7GA 2ZKNA 1WCUA 4G7HF 1XX5A 3CC7I 2R043 6PAXA 1C5HA 4A7KA 1QH7A 1AJKA 1WBFA 2TCTA 1W4MA 2VMEA 5IFPA 1QOSA 4R79A 1GOFA 3DEMA 3D5LA 5JI9A 3AZZA 2YGLA 2OUHA 1JOJA 4HZFA 1D0ZA 4RBOA 2R3SA 5A6YA 2KDOA 2R7VA 1FMD3 1IG3A 4E27A 1W3XA 5H6QA 2E1CA 3ZR5A 1GANA 1E5RA 2DCTA 3OR1C 4XFBA 1S9HA 2FDJA 2VW2A 3CUQB 4KMUX 5DDGA 4J6GA 4DQAA 4Y5Z0 1QZZA 5CVUA 2HEYF 1UX6A 4TLGA 3T4VA 2IT0A 4RS5A 3KT1A 2IA1A 2NYYA 4ZY9A 1RR8C 1MS0A 4Z6YA 3O8HA 2IA2A 2CQKA 3MKWB 1D5VA 1DYOA 2ARAA 1TWCJ 3H7JA 4XIOA 3HBZA 3WW1A 1QJX2 2ZX1A 5FLMJ 5IVVA 1S0IA 4BGDA 4AQSA 4GKYA 3IDCB 3MICA 2R16A 2RV8A 1J84A 3JRAA 3ZMNA 3T8RA 3ZYIB 1FPN1 1GUUA 2WZ8A 3U9GA 3IRRA 5LBBA 4KICA 4FOVA 2H8RA 3K77A 3OYGA 3CCEI 1YS7A 2ZKZA 1PGSA 4M3GA 4C0HA 5FPLA 1FX7A 4BJ5C 2WRAA 2CW0F 3WG2A 4BHPA 2UXNA 2J1UA 1FI2A 1HRV2 2FD8A 4RQPB 3W2VA 4U2AA 2A70A 4ASKA 2DMTA 2WNVA 2ZFWA 4KG8A 1YJWI 4W6YA 1O3SA 1J0RA 2CS3A 4ZXKA 3NWTA 1VBD2 3MPPG 1OFSA 2D93A 4CXYA 5SV5A 2PMHA 1RUI1 1ZBE1 3PUQA 4PIXA 2DJIA 3FZVA 1FPQA 2GMPA 1B35B 3I5UA 3VD5A 1UKGA 2WSVA 4XONA 1JT0A 4IEOA 3AKPA 3FK6A 1I9RA 2VQTA 2ESHA 4CCKA 4EWAA 5FK8A 3DKQA 5DDJ3 4UUSA 2H09A 3HYIA 3IMNA 1POQA 2NPIA 3K69A 2XGXA 1ULOA 4HOOA 1QJX3 2VU9A 4U0VA 4Z2YA 2ZGRA 3EETA 1DGWA 3RTRA 1AYM2 2Q2EA 5LK5A 3ZSKA 3AMPA 3KP3A 4YPJA 1D4M1 4N43C 1HCRA 2LMDA 4HDVA 3P5JA 4KYWA 4U87A 2JB8A 5M5WJ 3O0XA 1LODA 1VTNC 4KQ7A 1A31A 3AG3H 2VMGA 4FP2A 4XZUG 3M3OA 4RS5C 4IXLA 2QM3A 4YM0A 2OVUA 4UNOA 1XOYA 4AFDA 4BM8A 4XLCA 2WS93 1R5HA 2BNOA 3ERMA 3ZMTA 2DFHA 4ASMB 2JG9A 1FXZA 2WLQA 3RI9A 2Y30A 1MMSA 4OAZA 4CDXB 3KSCA 1DGWY 1F8VA 2CYYA 1W0TA 3MFCA 4MTDA 4Q47A 4NOTA 2EF6A 2DU0A 2JMWA 1H1MA 1O5UA 1WCMJ 4QPQA 1XMKA 2WQ4A 5F3EA 4LLLA 1HA8A 2Q2EB 1QH6A 1VB4A 3DEUA 2QF7A 5IY5H 5D8AB 5F64A 2NQYA 2PAMA 2K7LA 2HWD2 1H8TA 3MUY1 3P9CA 1UMQA 1LFBA 2MH9A 3O1UA 4LHKA 2LVSA 4ZONA 4KJZA 2R7OA 2C6SA 2IRFG 4E2QA 4W8JA 2JKXA 1TZLA 1YJLA 3FDYA 4CICA 1V5GA 2BV6A 3L2RA 1LCLA 4W1UA 1RKTA 4L0PA 2Y31A 4P00B 4CO8A 3H8UA 1SAXA 1VQ5I 1UY2A 1UNBA 4QX3A 2OV7A 5EG0A 2X10A 1XGOA 1RYYA 2CGOA 2F6BA 4JX4A 4IEJA 1ORKA 1PX3A 1HKDA 1V00A 2XKOA 1PM7A 1Z91A 5BMZA 2ZS6B 3ACLA 1NCQB 4BXUA 5KHJA 1TNFA 3IM0A 4QKDA 2O9LA 1X9PA 1TWGJ 1U3EM 3AKTA 1YQ5A 4QAWA 1IXCA 3HOWJ 5I8TA 2CFXA 1IUFA 2ZZQA 4ZDPA 3EBRA 4P96A 1EV12 2UY9A 3ITQA 3B01A 3TB0A 2Z69A 3LQCA 3WXPA 2CNAA 2BRTA 5FYUA 1J3RA 3OWTA 2V6CA 3ZYGA 4A42A 5JZGB 1Q8SA 3Q9SA 4BQAA 3UKTA 2L01A 3GZAA 1RL3A 1S7AA 1ON2A 1WGPA 4YGCA 4A6EA 3MHZA 2V9KA 3MZHA 2YU9J 4LBOA 4CYCB 4M3FA 4P9FA 2NZ9A 2WNUA 1GWLA 1V9U2 1IDYA 2HYXA 1BK0A 2VMCA 1MS5A 4LG0A 3F8MA 5IOZA 5ICEA 2LRPA 5FKOA 2JDAA 1RITA 5CB7A 1EAH3 4L9BA 4GH4C 3BG7A 4ESBA 4FOYA 4KWUA 1P92A 3JB8A 5LASA 4LBQD 4HX7A 3L9FA 3OYDA 3CJXA 2GU9A 5IYCJ 2HI3A 2XHNA 3AFGA 3LKJA 2Q1ZB 1T95A 2DPDA 4HKOA 4NB5A 3S15J 2BOLA 3ZN4A 1M4WA 4HBNA 2YZ4A 2KL4A 3HKZN 4DUXA 4QXCA 2BVMA 3R0JA 3HMYA 3KLOA 4IQJA 4G3YC 1B8IB 2A6YA 4Z2WA 1ND2C 2XVCA 2DODA 2VZ3A 2E71A 2W1UA 2A68F 4PDWB 3KEOA 4AC0A 2XBO1 1Z7S1 3VBFA 5GLVA 1W7PB 2NS0A 2R7DA 1E3PA 5FGMA 2G9GA 1Q8VA 1QHHD 4Y1UA 2IP2A 3CJIA 3MIHA 4G4FA 3WQ7A 1XU2A 1V3FA 1KRIA 2JDMA 2RHPA 3GBFA 2FOWA 3OYMA 2IW5A 1J75A 1A36A 2OZ6A 5HVQC 5GLUA 5FJ8J 3AZYA 1IGOA 3KF5A 1ZBE2 1D1AA 3H92A 2F17A 2YR2A 1UXXX 1IQDC 4UVAA 3QOEA 1SHWB 4D7SA 3AX4A 3AYEA 2R7EB 5E18F 5DDJ1 3ZCOA 4P9LA 1WJDA 4UUSB 3B3QE 3ZXAC 4V2GA 4YLZA 4Y13A 1YFWA 1O59A 1UD1A 4ARYA 1HDPA 3BTYA 3DUIA 1FMD1 5FLHA 2F5EA 5FRMA 3KV6A 4XHXA 5B5EC 3CTAA 3I4NJ 5JHUA 5DABA 2X6YA 2EAAA 2IS1A 1UQXA 2VQ0A 1PO21 1S0GA 2CJJA 3MLKA 2LRDA 1BI2A 4V2FA 4OI1A 5E20A 3HRSA 3S7EA 1AOYA 5GAHJ 2Y38A 1UIKA 1WMDA 2KZGA 2JA5J 1GQGA 3VDDC 1QKQA 2XJRA 3ZFGC 2HBTA 1HXDA 1KS4A 4QPGA 4RQPC 5FKMA 2BW3A 4F3JA 5KXCA 4CDQA 1ZRRA 3MIBA 1X1CA 2RR12 3JBG2 3RJPA 2BZTA 2FQ4A 4JKLA 4A69C 4KGQA 2OJED 1FPN3 3SEZA 1G8WA 3D5RC 1W8OA 1OA3A 2YS9A 3BB6A 5EEGA 3MDPA 3PQKA 1H6YA 3N9MA 1UOGA 4KT6A 5FKLA 5D8AC 4A6DA 1RUD3 2ZACA 3W9AA 2D1HA 3B5LB 1UY4A 2HNHA 4Q4Y1 1X9TA 4CU9A 4S2DA 5K7HA 2Q8EA 3B9CA 1FBQA 1G9BA 1X19A 1ODDA 2R5ZB 5FMOS 2L9LA 3WQ1A 1MNMC 4YW5A 4D5CA 3OS1A 2BOIA 4EGZA 1RXFA 2K2SA 3RYKA 2NMNA 3BTJA 1AJOA 5FYBA 4WWCA 1RZ4A 3K4MA 1ZREA 5FYYA 3CQOA 5L36A 3LA7A 2K27A 2HZTA 5J98B 3V8JA 5ILVA 1Z7S3 4D8MA 4MHUA 1Z7UA 3ZXSA 5A7WB 2YB7A 2KJBA 1BR1A 2OTLI 5ACA2 4F92B 2O5RA 2DBIA 1Z0XA 2XPWA 4RGRA 2YC0A 2LC2A 1B59A 5F5IA 3MLJA 1I1SA 4AK3A 1CQTA 4C2TA 5FZ3A 5TSWA 1IN4A 4IV3B 2ECBA 3AP4A 1H0BA 4JTNA 5D5UB 1RETA 4FPEA 5IJRA 2E1MC 2ARCA 1FTZA 3NV3A 3JRFA 1IG7A 3QLQA 2JDNA 3ZSEA 3OYIA 2X5IB 1IOAA 3I49A 1VBC3 5C9AC 3AZWA 5JFRA 4HETA 2DA6A 4LK0F 2OKXA 4Z82A 1ENHA 5ED4A 3C7JA 3LOCA 1IRXA 5FP7A 4Q4V3 3P1IA 3ZN1A 3NKTA 5DG1A 4LNVA 2JE9A 4Z2AA 4BYYA 3WZ1A 4YVSA 4HOBA 4FI9A 1I50J 1DQ1A 2WB1N 5EWSA 2EA2A 4CDUC 2KMUA 2XV4S 1XSQA 3IH3A 3CLOA 4CXXA 1P6RA 2W48A 3HQRA 2V1NA 2YXSA 4FVVA 5FP8A 1IN7A 2VOKA 3I9V2 5CFDC 3DBHB 4DYCA 2FCTA 1S0DA 2R1DA 1E3OC 2EXKA 3BJOA 2JX9A 1UG2A 3KP5A 5GAEJ 4ZPIA 1LE8B 2VIXA 4XF4A 3DPRC 4AEJA 4NHXA 2BW3B 3KEYA 3ETPA 2WABA 4W6WA 2GP5A 2WN3A 2E19A 2DO7A 3RJRA 4L8QA 1HQLA 1Y9MA 4JQFA 3DN7A 2F5VA 4CSWA 1ACCA 2K0GA 2Z4FA 1PUFB 2FZ2A 4LITA 2UWMA 5EV7A 3S0MA 4UT5A 2D98A 3PFIA 2DVBA 5EZGA 2D6OX 2W25A 4RHV3 1SG3A 2QQPA 4WBBA 4CDXA 3M3EA 4GA9A 1BCXA 3BPVA 2MHFA 1VBB3 3IBMA 1MS4A 2ZABA 1ETWA 4GYGA 3HUGA 1PIV1 4GB33 4XF3A 3HOXJ 3A21A 2A75A 1HKQA 2JG9C 2PLV3 2PLYA 2EVXA 4BQOA 3OV8A 1K45A 2L9RA 3OL4A 1H0MA 5DD4A 4Q4W2 4XM3A 4A7ZA 1YQ6A 1FIAA 3D8CA 4FXKB 4IERA 4ZZ8A 2F4OB 2GWRA 1AR73 4ORFA 3ZVXA 4XJWA 4DYRA 4F55A 3OMYA 1IRGA 1HQWA 2D44A 1JHNA 3RS6A 4M3CF 4YZ2A 4XJZA 3V0BA 1OPCA 3VKFC 2MLKA 4R9DA 3WODF 1WJCA 5A7PA 3H8OA 4QB2A 5C4XJ 5JZGA 3WW2A 2JSCA 4Q4X3 4RGGA 2D3PA 1Y1VJ 2OQ7A 3HWJA 4AVVA 3OIOA 5HLTA 4U88A 1CPMA 1JTZX 3D1NI 5IW0A 1U5TC 1POGA 2EB7A 1S0BA 4NC8A 2VKHA 2BTVC 1ULEA 4UVBA 3U37A 3M8FA 1C1LA 1R36A 1L3LA 1F4KA 2XPVA 3WUDA 1KONA 3O14A 3VPRA 4IEPA 3IDBB 1FATA 2RQQA 1ST8A 2P17A 2K4BA 3SEQA 5FP9A 1ETOA 5KHKA 4AE2A 2WO1A 1MZBA 1O6UA 2QQIA 5C3PA 1ZAOA 1PP7U 1XN7A 4H3WA 2WY8Q 3H3VK 3HR9A 4OMDA 3GNEA 4Q4Y2 5LGNA 1UFMA 5LCWL 3UKNA 4GMP3 3RRDA 1Y7BA 2QQVA 4QQHA 3ZKYA 1LEDA 4ZC3A 4E7SA 3EUHC 4B1MA 2M7AA 2P6TA 2FQPA 4FP3A 3VDBA 1MR5A 4CCOA 4FFGA 4UAPA 3KS7A 2Z99A 3PTRB 3MLLA 2Z42A 3T09A 2XGDA 4EQVA 1Q1VA 1G3SA 2OCEA 3WTUC 1SBEA 5FP3A 5K5OA 3LDRA 3DECA 2PXJA 3I58A 1CONA 2DTZA 1VAKA 5FLXZ 2BUKA 2B5HA 2VQAA 2Z2SB 2R0FA 3NMBA 3PMEA 1PK6A 4NRQA 5IP9J 1BIBA 3A4CA 2OZUA 2EIDA 2CGPA 1UELB 2MD5A 5FXZA 4YRVA 3JZVA 3FKJA 3BR1A 2IS4A 1W7PA 4HNUA 1JT6A 2RKHA 5ACA3 4D69A 1W8ZA 1WJ5A 1SMTA 4FFFA 3G7DA 2XVKA 4FFIA 4Y1XA 4QIWN 3ZPLA 1WH7A 2ZB9A 4ZU5A 4AI0A 1AWCA 4BPZA 1MPXA 4S05A 3ZYHA 5JUVA 4FTEA 4EYUA 3POSA 4QT6A 1G8XA 1UMHA 1VFCA 2CWSA 3IDAA 2W7NA 2Y33A 5JSOA 2ZJPF 3VLBB 1AR83 3M8JA 4PCQA 1S0JA 1BLZA 1RUG1 1LKNA 4PI0A 1CAWA 3LSGA 1BEV3 1D4VB 3QP6A 4EN0A 1WFXA 2EFQA 1UYXA 5L3EA 4L9TA 4XUOA 3PSFA 3QH7A 4MQVA 2WFF3 5G05L 3K4CA 3ISPA 3AVSA 3O6BB 2B7EA 1NA1B 1WMFA 2IBDA 5F2WA 1U6GA 1FPN2 5IK8A 3L2QA 1TMF3 1ZZBA 1YQCA 3K4LA 3HG9A 4JDMA 3IUOA 2EV6A 3B94A 3B00A 2ARBA 3OS2A 3JD73 2N7GA 2E2IJ 3WINE 4NPLA 3J7ZI 5EEHA 3BTAA 3PTYA 4JTOA 1FNYA 1ZLJA 5J48A 2R7FA 2VJJA 1ZBA3 2QQNA 3W5MA 2V72A 2VKVA 4IE7A 4ZYGA 3A1YA 3VN4A 1SD4A 4GYIA 1T39A 1ERDA 2BPA2 4XMYA 1APNA 4IEUA 2E34A