4N9HA

Crystal structure of transcription regulation protein crp
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
201
structure length
201
Chain Sequence
b'PTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Structures of inactive CRP species reveal the atomic details of the allosteric transition that discriminates cyclic nucleotide second messengers.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
total genus 55
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4n9hA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4n9hA01
1IN5A 4FAGA 4RD7A 4HV5A 4FHTA 4WVZA 3F21A 5FB2A 5FQ0A 4I7HA 3ISPA 4UV8A 4HVOA 2RNJA 3I54A 3MWMA 3WW3A 1Z05A 3CUQA 3B73A 1SFUA 4X6RB 1XMKA 5JFRA 4MGZE 3FX3A 4HW0A 5I0TA 1S29A 4ZYDA 4P9FA 3WE3A 4LLLA 5BS6A 2PMUA 4KDPA 2XV4S 3HTUA 5ILSA 4XFIA 5E20A 1ZZBA 2MLKA 2BE5F 1QPMA 4PDKA 3CTAA 3ZMUA 1PDNC 2HTSA 2QBYB 2EK5A 3SZPA 2PQQA 4BYYA 1YYVA 4NQWA 5LHHA 2UYBA 1IN8A 3MEXA 2PJPA 4YNIA 1D3YA 5HLGA 4AIKA 5KHKA 2DQLA 1IN4A 2G7UA 1LJ9A 3V4GA 1U12A 3S7EA 3FZ3A 3UKNA 5LRRA 2XAQA 1WLTA 3KP2A 1UCXA 2BNMA 2O8QA 2DT5A 3ZN1A 4WCGA 4PIYA 3P9CA 2VN2A 4KNYA 1EV7A 1BIAA 4AVAA 4YFXF 1XRUA 1R1UA 5AVPA 4HZFA 3RPQA 2CAUA 2W25A 2UY9A 2Z69A 4EJUA 5LGTA 4S04A 2EFWA 2PEXA 2VBXA 2AS5F 3C3WA 2FNAA 1HSTA 4ESJA 4IRGA 4QMAA 4M9SA 3OF1A 1FX7A 3L2CA 4BQAA 3LA2A 1XB4A 3KP6A 4O3MA 1ZLKA 2KRFA 4D0PA 4PIXA 3KE2A 4LFUA 4KYWA 4I3PA 3FZVA 4KWKA 4IHSA 1WA4A 1VJ2A 3WTUC 1XGOA 5BMZA 5ILUA 1GVJA 1LEAA 4ENNA 3WW2A 2GA2A 4WWCA 4B8XA 5AONA 5HI0A 3J81Z 1FC3A 1HKQA 2H6BA 3I5UA 1FXZA 2MHFA 4G7ZF 3WW4A 5D1IA 4NVPA 2DCTA 3WTXC 3LAJA 4LGWA 4IJAA 3K1PA 2Z33A 3WU0A 4HSJA 3H7YA 2DK8A 1DUXC 4LB5A 1ZRCA 5BPDA 4Q0QA 1OYIA 2KJCA 2EAAA 4J1WA 2PI0A 1GXPA 1NXMA 1IAWA 5FLJA 1XMAA 4HN1A 1RIOH 3J81K 1X7NA 3I71A 1A04A 1E2XA 1LB2A 1IXCA 4N9IA 3M70A 4YFKF 4IEUA 4YARA 4ZYHA 2G7HA 3HIFA 1QGPA 3W6KB 1W7PB 3T5XA 1O3QA 3RKWA 1G3WA 1REPC 4BXUA 2VODA 2D93A 5CADA 2PHLA 3JZVA 2ACJA 4XFBA 3GFMA 3K9TA 2PQ8A 1EY2A 2EJRA 3ETQA 1U8RA 3GVAA 2F5FA 3GYHX 3GZ6A 3M8FA 4RAZA 5ICCA 5D5WB 2L4AA 1PMIA 1V3FA 2CYYA 1HQCA 3O2PE 2IRFG 3HUGA 5E1WA 5J8CA 3KFWX 2X4HA 2HDCA 1FBSA 3TQNA 4UVCA 1KU7A 2EV0A 1QXRA 4J1XA 2HTJA 1ZG5A 1ZG3A 3ZPLA 3RI4A 1BI3A 5H6RA 1ZRRA 3KLNA 2RV8A 3ABUA 2L02A 2XROA 5E1ZB 1MJ9A 2IXHA 1STZA 1AOYA 5LEJA 5BY5A 5FPZA 5TJJA 1HW1A 4UNOA 2P7CB 2QQAA 4QM8A 3SCHA 4RB0A 4L5JA 2AXLA 5LBQA 3HSEA 4BHPA 2M45A 3MYXA 3V7SA 4ENKA 1XSVA 4Y17A 2EV5A 3OTFA 3EQEA 2K86A 1LRHA 1BOAA 1XCVA 3DQVC 5JSOA 4UV9A 2A5YB 2QENA 2Q2EA 4OIOF 4Q0SA 5JCTA 1H1MA 3I58A 3KGLA 4MGRA 1BIBA 3M8EA 3FFQA 3B02A 3GF2A 3LOIA 1IN6A 4IEVA 5AIQA 4MGKE 3NJZA 2PMHA 4N0BA 2ISYA 1QZZA 1I27A 3BPXA 4WXCA 1XGSA 3MZYA 4LK1F 4HVRA 4I0AA 1K78B 1D8JA 1S7AA 3MCZA 1BI0A 3O6BB 3SCGA 2LF8A 2WTEA 1UIKA 3E6DA 2WFPA 5DDGA 5DEQA 3HRTA 4O9EA 4QGNA 3V7RA 2TDXA 2FQ3A 1G4DA 2D5HA 1T39A 1F9NA 2QZ8A 3LA7A 1XN7A 2JPCA 4AD9A 2H6CA 4R79A 3HRSA 3WTWC 3NRVA 3D5LA 2DQRA 4ESFA 2K9ZA 4XFCA 5T3NA 4DINB 2CQKA 2MNGA 3OV8A 4XSZF 4RGSA 5DUIA 2OZJA 5DD4A 4HDVA 4IEYA 4XF1A 3BWGA 3KGZA 2PTMA 4YYOA 4HA8A 4IVNA 2ZKZA 2PLYA 3BJAA 2VT2A 3KP7A 5KHGA 4D7TA 3T0YA 3KP5A 1CAUB 4M72A 3GWZA 4ENJA 1NE6A 3KP3A 4GXOA 3TDZC 5BPXA 2EFPA 2JSCA 1J0RA 5LGNA 5LHIA 2RQPA 4L18B 3WTVC 3W6JB 4OMYA 1IW7F 4JTOA 3LSTA 4HQMA 4AXOA 1IN7A 2KIUA 4G7HF 1QXJA 1J59A 1RI7A 5H20A 3WGIA 4G6DA 3C1DA 2RC4A 1W5TA 2B8MA 4LA3A 5HDGA 1G3TA 3U10A 1WRJA 2XLFA 1HBXG 1T6SA 3RIRA 3Q5FA 1GHCA 2M1BA 3U0ZA 4OINF 4XEZA 3L9FA 3CUOA 3JAMZ 3FHZA 4IEXA 2IVMA 2ESNA 1RUOA 2W57A 3MQ0A 1RUNA 3DPTA 3OOPA 5EFUA 3SHFA 2PN6A 4IXAA 2QYOA 1CAUA 2VPVA 4IPAA 4IEZA 5FLXZ 4X6QB 3JAMK 2PAKA 2KIFA 2GH2A 1YS6A 4MNUA 4HX4A 2C0ZA 3I64A 3J80Z 2HYFA 4MGYE 3CO6C 4EVIA 4KL1A 3TOAA 4MUVA 1P4WA 5L3FA 2CO5A 3BDDA 1Y0UA 1MKMA 2GC2A 2XKPA 1P92A 1E17A 2RVCA 3G3ZA 1NZCA 3KETA 2NS0A 4G8XA 1R58A 3DP7A 1KQ9A 2OZ6A 1YHFA 2M8EA 3KLOA 3QPTA 4A5MA 1B9NA 4ZZDA 3RTRA 2FOKA 2P8TA 3LWCA 2VBWA 5CU1A 4HAMA 2Y75A 3BALA 5I0SA 2R7DA 3C3VA 2CV6A 3HYIA 5JHUA 3GLXA 2HOEA 1RGSA 3H7JA 4KMUX 3H1MA 2EFQA 2Z3YA 5I91A 3J7AO 3F8CA 4AQ6A 5CVRA 5ERIA 3E5XA 4EWDA 4Z07A 1SMTA 4BH9A 4CO8A 4UUVA 1B4AA 2OAZA 3F3XA 1SFXA 2M87A 5JSRA 4EM1A 2R3SA 1RL3A 2A3SA 4KMFA 3FM5A 3TOBA 3EETA 5KK1A 3VEPA 1IRFA 2YSRA 1J5YA 3H3ZA 2XGXA 1IXSB 5FD6A 3F22A 3NW4A 2GC0A 3QRFF 3E6CC 2HKXA 2QCSB 1ON1A 4HVQA 4KWJA 5I0RA 1UCRA 2OYZA 1RTVA 1F5TA 2XAHA 2QUFA 3I59A 3DL3A 1LDJA 3CJXA 2IXLA 4L0YB 3H1YA 1DZTA 3H3UA 1XGMA 1NE4A 3PQJA 5CLSA 5E8IA 3F8FA 3HT1A 2HFHA 3E5QA 4JTNA 2DTRA 3ZMVA 5E1RA 2FXAA 4MGIE 3FMRA 2MA3A 3CDHA 4JBAA 1UHMA 3F8MA 3QOPA 5ICEA 2ETEA 1TW3A 2OA2A 4XF4A 4AIJA 5LGUA 1LNWA 3JSPA 1LKNA 2F5CA 4Q0UA 1XE8A 2Q0AA 1EP0A 2UWMA 3E97A 1QQIA 1J9IA 5A2QK 2VC1A 1FZPB 1SD4A 3BPZA 1KU3A 1S8NA 3F72A 1YLFA 1T38A 1ZZ8A 1DP7P 2UYAA 1WSUA 5LLQA 5K1YA 1QO0D 1LVAA 2DLLA 4HV6A 3PFIA 2VQAA 3SHRA 1YUDA 4IEPA 3AAFA 1PP8F 5EZWA 4TLFA 1KU9A 4RB1A 2A69F 3K1NA 3H50A 1YFUA 5LEKA 1CAXB 1Q1HA 3EYYA 4UXNA 4WK8F 4G7OF 1HSJA 4S05A 2BNNA 1FP2A 2ZFWA 5CVIA 3KSCA 2CFXA 2VOPA 4P5OA 4FBFA 5I8TA 5BV6A 4GULA 2V1DA 5FPXA 2ZCWA 3IKTA 2GC1A 2EA7A 5FGMA 2W85A 4H7LA 3G73A 3K69A 5HOOA 1XCBA 3REOA 2H94A 4WF2A 5C8WA 4Q47A 3BP8A 4META 4IEWA 1SFEA 4IESA 3PNAA 1XD7A 1W7PD 4L0ZB 4XFAA 2VE9A 3ES4A 3S2WA 3F6OA 3SFZA 3GX4X 2L3DA 5FFXA 3BOQA 3QAHA 2XL9A 3LAGA 2OU2A 3TDUC 4WXHA 4ZZLA 3FF5A 5JVTA 4U7BA 4IETA 4CGZA 5HVQC 4KN7X 4PJYA 3FHIB 2OZUA 1I1SA 1ZZ9A 4K2EA 4XFGA 5EEGA 4OOIA 2EFOA 4LUMA 1Z6TA 4P9GA 4YRDA 3MAJA 3QACA 5D5XB 3BCWA 2GZWA 1CAXA 4HDUA 4WBBA 4XLNF 1CF7B 1U3EM 2ZKLA 5FLIA 1MJBA 1OI6A 2Z9OA 1CAWA 1V70A 4NB5A 4FX0A 4F8AA 2A6EF 3F8BA 3D82A 4Q29A 2Q4SA 2D40A 2Y0OA 3C7JA 4RAYA 4ZU5A 1AWCA 1F4KA 3ECOA 1TBXA 3DFGA 1MZBA 1W5SA 1O3RA 2XRNA 2FQPA 2OQGA 3SCFA 4GYGA 2FNPA 1UIJA 2MBFA 2A6HF 4PZJA 2LDUA 4PGHA 2HQRA 3KZZA 1I1GA 2NNNA 4RGXA 4HF1A 4EMSA 5IT3A 3WTYC 5KHHA 3RJPA 4CYDA 1TQIA 3BU7A 1HXDA 4M6YA 2IA1A 4TV7A 4KT5C 3I7DA 1JHFA 2FU4A 2ET1A 3IKVA 4EQQA 2O03A 1YQAA 2IXCA 2V79A 4XFHA 2MH9A 1CGPA 2OPKA 1TLHB 4EV0A 4QXKA 5L3BA 5ICFA 4U0YA 1CF7A 3FE5A 3H1WA 3RKYA 5E1XA 3QP5A 1ZZ6A 3E3VA 2X0LA 5D5UB 1B6AA 1VP6A 2A61A 3O14A 2FA5A 1HW2A 5I93A 3R0JA 3FMSA 3LWFA 4Z2YA 4PGGA 2XAGA 2D5FA 2IXKA 2ISZA 3CLPA 2GAUA 2UXNA 3FWEA 1U5TC 2OBPA 3V8KA 5K5RA 2NYXA 4L9VA 2DAOA 3JSOA 2WC2A 1ZG1A 1UB9A 3GUDA 4MQVA 4HBLA 2F5EA 1X82A 1EPZA 4UBGA 3GYDA 3ST7A 3EYIA 1O4TA 1TQMA 2E9QA 5ICGA 2IPQX 2YR2A 3TO9A 4XBFA 4CICA 1O5LA 2QQBA 3I53A 2PAMA 4KUMA 4O6JA 2ADUA 1ZN2A 5J3UA 4HX8A 3IDCB 2WWYA 5I0UA 4LG0A 1ZRFA 5I8SA 3SXWA 1G3SA 1PP7U 1SD6A 2CSOA 5F6FA 4ENMA 4KFCA 2JRTA 4UHTA 1KYWA 2H0VA 4JV4A 4F7ZA 4QX5A 3VHRA 2OD5A 4ESBA 4YFNF 4JQFA 3KEOA 5J7MA 4A12A 1DGWA 1T98A 2NAZA 1IRGA 2V1UA 2FMLA 3OD0A 2VE8A 3EUHA 4EGYA 2O6GE 4RGUA 3WTTC 5EEHA 1TNTA 3R6SA 5CVJA 1IXRC 1OYWA 4HN0A 4AQ2A 4Q4ZF 1KQ8A 5FO5A 5JAXA 1B9MA 3ZQ7A 3OCPA 1ULYA 1BC7C 3NSTA 1EYBA 1OD5A 4KU7A 4M71A 1ZZ7A 1FI2A 3IWZA 3WODF 4L9JA 4P55A 1CAVB 1NYWA 1YIOA 3FXRA 1U2WA 2P5LC 1DZRA 4CXFA 1T2KA 3EJKA 2HEOA 5DYMA 1IF1A 3R4KA 4FX4A 3RYPA 2ATFA 2CGPA 2RN7A 5DCMB 1L0OC 4BNCA 3FM3A 1IPKA 1MGTA 2QM3A 2F2EA 4ZU4A 1RNLA 4A5NA 2HR3A 4AIHA 1XSDA 4MV2A 3TO7A 2K4BA 5DV5A 2DO7A 2Z99A 1O3SA 3BROA 5AIPA 4HOBA 2PA7A 3FXUA 1ZVFA 4BAYA 3ZMDA 2FRHA 4HQEA 4NHJA 1VTNC 2FBIA 3N97A 5E17F 1ZGAA 2CW0F 2GU9A 1V4RA 1ZHFA 4ASNA 4IHTA 5IT9K 3U1DA 3IC7A 5D8LB 5CYVA 1NHAA 4MH0E 2E7XA 1CAVA 5D4SA 5K5OA 4EWEA 3EHKA 1YW7A 2GQQA 1Z6RA 3D0SA 1JUHA 4WZCA 1YFYA 1ZARA 4L2NA 4I2OA 3VB2A 2VECA 3KMHA 3ULQB 2IA0A 1P4XA 2OQRA 4KN4X 1DPUA 3BB6A 4P9UA 2ET7A 3ERED 3IIAA 3L2HA 1R7JA 2H09A 5DCMA 3WGHA 4ONUA 2HZTA 4R8HA 1FNNA 2HKOA 1J1LA 5L3GA 2RKHA 2VBZA 3D0JA 2ZO4A 4MEYF 4AVCA 4EJOA 2XASA 3K1MA 4BIFA 3GFJA 1F1ZA 3M3IA 1VR3A 2GXGA 2ZJ2A 4M74A 4UVAA 4A6DA 1LDDA 2DW4A 4R52A 2IP2A 2EWNA 3CUQC 2VONA 3GFIA 2A68F 2MLGA 2W84A 4MTEA 2QJVA 3NVCA 3FMQA 4I0BA 2JT1A 4LULA 3I59B 2DFIA 4M73A 4KA4A 1JE8A 4ZYEA 4XF3A 2DI3A 3CO2A 1Z7UA 1S3JA 4MTDA 2L01A 2JPBA 1S7OA 1YS7A 1R22A 2M5WA 4LMYA 5HS7A 1K79A 1OFNA 5HLIA 1YFWA 1FT9A 5E16A 2E7WA 3LAPA 6PAXA 3LFKA 1ZRDA 2GWRA 2COMA 3CLOA 4FAHA 3O3KA 5FCCA 2XLAA 1BJAA 5FLHA 2XUBA 2STWA 1KA8A 3V8JA 4BHCA 4HMZA 2V6CA 3H8UA 3DKWA 1GQGA 3QU6A 3FJSA 2VT3A 2YX4A 2F4PA 4HF0A 4AWXB 4GYIA 1WGPA 2CAVA 1DDNA 5LHGA 5HDNA 2J5PA 1Y9QA 3WG9A 3F6VA 4YIFA 4IERA 5D6FA 3LQQA 3ZP5A 1R36A 2CWEA 1UD1A 1I6XA 3DV8A 3SXYA 1D5VA 3VODA 3WTSC 4HBNA 2FBHA 3HOSA 1CX4A 1UW8A 2J5OA 1P2FA 3KEQA 1K6OA 2L54A 3COAC 5FD5A 3DXJF 3VFZA 3M1EA 4N9HA 2V9VA 2ZBKA 5JR3A 2LF7A 5I8YA 3HQXA 2N7GA 3ZDSA 3GXOA 3WE2A 4EGZA 3M9AA 4I02A 4LLGF 1TQ5A 3IL2A 4XETA 4LA2A 2HWVA 2GA1A 1O7LA 2EA4A 1KGSA 5BOXA 2P6SA 2H27A 2IA2A 5A2QZ 4OLLA 1QZYA 4EWAA 2IC1A 2ZNYA 5BXXA 3QPHA 3TNPB 4PIZA 2QQ9A 2BEOA 2Q0OA 1TNSA 3EQLF 4KWLA 4B29A 1PUEE 5TRDA 1WWXA 1RC6A 1SEFA 2DPUA 3E5UA 3HHHA 5K5QA 3I0TA 2PG4A 1Q43A 2O0YA 1R23A 3ES1A 5FDBA 2D1VA 1X8MA 4LB6B 1ZX5A 2KIMA 2VC0A 1YW8A 2K0GA 4RS8A 4E2GA 4A0XA 3V8LA 3RKXA 3RDIA 4HX7A 3E6MA 4AVPA 3ROUA 2EA2A 1ZLJA 4Y13A 1U6GA 4A6EA 2HYGD 2P7VB 5CVUA 4L9TA 4EJVA 1K7AA 3C18A 4LTAA 3ZN0A 1CAWB 4MQ9F 2IXIA 4IF4A 4QM9A 2FE3A 3S7IA 3TKYA 2K02A 1R5GA 3K0LA 2M30A 4HSLA 3T1BA 4WXDA 5D6EA 3GW2A 3L00A 5CJ9A 4P96A 1YFHA 2P4WA 1LQ1A 3LQRA 2B0LA 1LR5A 1ZYRF 3ZMTA 2P6TA 4LEJA 4Q48A 2YU3A 5J6XA 1FYMA 4HLTA 2Q1ZB 3R0AA 1ZZCA 3GBFA 3ML6A 3MZHA 2V09A 2Z2SB 3USSA 2E1NA 3U11A 4LJZF 2QVOA 2BNOA 3HOTA 1EH6A 3MDPA 4ORFA 1IZ1A 1IUYA 5L3DA 4E2SA 1D8KA 3BPVA 2FEZA 1QY4A 2PFBA 2IW5A 2XKOA 4XF0A 2FBKA 5KHIA 2BBYA 4O9GA 1OKRA 2QBYA 2ESHA 1SAXA 5DD8A 2ZXJA 3HSRA 2LNBA 4U88A 5E18F 3KZYA 4E70A 1J3PA 4ON0A 5F64A 2Y48A 3IRRA 3ZMZA 3DF8A 3OGJA 3LZZA 1FWZA 1Z1DA 4UXAA 5JSPA 4YIIA 1YWKA 1FSEA 3NKTA 2VXZA 3JTHA 1OPCA 1FBQA 1GXQA 2G9WA 4OIRF 4Y15A 2MD5A 4L5IA 3F23A 4JVAA 2STTA 3RZZA 1S6LA 2GIVA 1R1VA 3LA3A 3BJ6A 5D5VB 1P6RA 4MZUA 3RNSA 4XF9A 4XFFA 2K4JA 2QDRA 4LLNA 3Q9SA 3SQNA 5HS8A 1T0FA 2P5KA 1UPIA 5L3EA 1TTYA 4QLCU 4G94A 3UKTA 3U9GA 1C0WA 4G9YA 1OR7A 4YSFA 4ZYGA 3KCCA 2EV6A 2B5HA 1R5HA 5BPIA 2XAFA 1XGNA 3ZMSA 1ZNPA 2QWWA 2NNYA 2P17A 3RYKA 1KYZA 2XAJA 4MEXF 1J3RA 1FYLA 2K27A 1BM9A 3QP6A 2I45A 2PHDA 2KXLA 1Z9CA 3HRUA 1H1IA 3DPLC 3BY6A 3IBMA 1IPJA 2KJBA 1W4MA 4GCVA 4EJWA 4LG0B 1ODDA 2R7FA 1QBJA 3R60A 2IXJA 4IEQA 2MC3A 3GEZA 2ELHA 4CZZA 1BI2A 1L3LA 3I4PA 1FY7A 4WX9A 4K8FA 2MPFA 5HDKA 2FF4A 2HGCA 4OU0A 1USTA 2VBYA 3ECHA 3HT2A 1HKSA 4YG2F 3CF6E 2ZMEB 2ETHA 4LLOA 2JTVA 3IDBB 4H0EA 1H9TA 2Z5UA 2LKPA 3S0MA 5KHJA 4HLXA 1EH7A 1ONVA 4M6XA 3Q9VA 3WGGA 3IRQA 2VOOA 2MH2A 2QVSB 3WW1A 1LDKB 3IHUA 4XRFA 1W7PA 1ZGJA 4KU8A 3V7CA 4XLPF 3K2ZA 1HW5A 4OFGA 5J8FA 4QWQA 1UFMA 2DK5A 1X3UA 3T8TA 3HTSB 4IRHA 5HS9A 1U5TB 3L7WA 5ED4A 4CDGA 2RGVA 1FOKA 4EM0B 4OMZA 3MPBA 4ZH4F 2Q8KA 1WQ2A 4HLYA 5H6QA 1JGSA 4OIQF 4KIFA 1J2XA 4MHGA 5JI6A 4A0YA 1MD0A 1QNTA 4HF2A 5JR7B 3UKVA 4UVBA 4KIGA 4Q0VA 4CHUA 3P9IA 4IEOA 4BHBA 4LUKA 1O7FA 1BN5A 3NEUA 2B9UA 4ZU7A 1UHWA 2ZMEA 1TQPA 2W24A 1B59A 3KP4A 4RGRA 2O8XA 4B09A 3EDPA 1Y3TA 1ON2A 2BYVE 1MJAA 3ACLA 2DBBA 2EB7A 1J58A 3FXQA 1DGRA 3TGNA 2O61A 1YTYA 3GFLA 1G3YA 4DNCA 2O3FA 4G6QA 2F5DA 3U2RA 3GO5A 1DPRA 1SFNA 1TW2A 3DEUA 1Q3EA 1H9GA 1SMYF 2UZKA 5K8SA 3HRMA 4KIBA 1U5TA 1JHHA 4L9NA 4D7SA 4A2UA 1WI9A 2O1QA 3VOEA 1XE7A 4FT8A 2DPDA 2BGCA 2V1XA 1ZAOA 1EH8A 3N4MA 3P7NA 5IT9Z 2FSWA 3BJOA 3EBRA 1B1BA 3JW4A 4GGGA 4JK1X 4Q0PA 1K78A 4EROA 4HYEA 3NQOA 4KICA 2LSOA 2EVXA 1SD7A 1SQ4A 2WV0A 4IRIA 3PLQA 2Y0MA 5ILVA 5LRSA 1ZH5A 1KQ0A 3CJNA 5L3CA 4LD5A 3QU3A 4RB2C 3SMHA 1XSXA 1J3QA 3EO6A 3JTGA 1R00A 1BI1A 1ZREA 1PM7A 1H0MA 1J7KA 4M9XA 4AVBA 1FPQA 4MX3A 3L09A 1I5ZA 4I09A 2XL7A 1FP1D 2YX7A 1FLIA 4QGMA 4UBHA 3HSFA 3WTZA 3H9AA 5E8GA 3RPUA 2C6YA 2GXBA 4EM2A 1LEBA 4DQ2A 2FMYA 2CG4A 3R61A 3TO6A 1Q5OA 3ELKA 3PQKA 1OYYA 3HHGA 4A0ZA 1YLLA 4GO1A 1KU2A 2K7LA 2A07F 2XLGA 2RDPA 1O3TA 2XIGA 1JXSA 5J48A 4OIPF 1RZ4A 1WKMA 3WU1B 1G6NA 3F8NA 1O57A 1O5UA 4ETSA 4EJTA 1P4AA 2ZNZA 1OMIA 1YW9A 1USSA 4PCQA 3CO7C 1MDMB 2L4MA 4I98B 4XSXF 2IJLA 4U0VA 3E6BA 3G7DA 3DN7A 3PVBB 3T8RA 3TNQA 2JZYA 1YFXA 1SD5A 3ABTA 4I01A 2E1CA 5BUVA 3SZTA 2D2WA 1YO5C 3M7GA 3ELNA 5FLXK 3GZ5A 1Z91A 1XDSA 4E2QA 1FBUA 1QWRA 2IT0A 2PFWA 5D4RA 4L11A 4Q5SF 2PAEA 1X8EA 2BV6A 2UXXA 2D1HA 5F1RA 5FQ0B 5C6CA 2XHKA 2HS5A 1YG2A 3P9KA 5CVVA 3NL1A 3J80K 2P5VA 5KBFA 2D45A 3CUQB 5D8KB 5BQTA 4M9ZA 2XVCA 3H92A 3RYRA 4LK0F 1FYKA 2KKOA 2HJIA 5KVRA 1R1TA 4R1HA 4U0WA 3CL1A 1BC8C 2GC3A 2HQNA 2OA4A 2PBIA 1U78A 5HLHA 2EFNA 1XDUA 4U7DA 4O5VA 2DU9A 4RB3C 2NRAC 1MDMA 1BBYA 5FFZA 2UY8A 1FSHA 5DUKA 1J75A 2QLZA 2Q30A 2YPRA 4QGLA 2QNKA 1GQHA 3CEWA 5DCFA 2PYTA 1L3JA 3IWFA 1HKTA 3MFKA 3BZ6A 4Z82A
chains in the Genus database with same CATH superfamily
5LB6A 4FISA 3PUAA 4FAGA 1VB4A 4FHTA 4MHUA 5JPMB 1NUKA 3FLRA 5F1JA 2K2SA 5CB7A 4XUNA 1ZQ3P 3HNMA 2ZHLA 2VZOA 3I54A 4P5HA 3MWMA 3WW3A 4QB6A 2ZJRF 1AYN3 3ZYJB 1Z05A 4UY8I 2XAUA 3OOXA 3LMMA 1NCQB 3TEWA 2Y0IA 3LSKA 2DDUA 4MGZE 2Y26A 4P00B 5I0TA 3OY8A 3BU0A 2J1SA 4ZYDA 2JJ6A 5J4YA 1AXYA 3VD9A 3VKOA 2WB1A 4DOUA 1NY72 1RUJ1 5ILSA 1T2XA 2ZGKA 3IH4A 1ZZBA 4IE0A 2NN8A 2C6SA 3ZMUA 4DGWB 5FXXA 1PDNC 2HTSA 3MLJA 1WJCA 3SZPA 1S0DA 3BYWA 1RUG2 1IPSA 5LD2C 2EIGA 2ZXHA 1X9PA 1K5MC 1IN8A 4UW6A 3WQ0A 1IG3A 1VBD2 2DWRA 2Q1MA 1UMZA 5KHKA 3B5LB 5M5YJ 5K7FA 3S7EA 4AWDA 4IZZA 2ZHMA 3UKNA 1W99A 1ASJ3 4AK3A 5F0FA 4AHXA 2E31A 3KP2A 4S2FA 3KM5A 1HDPA 2XJTA 4M3FA 2KHMA 3FHAA 2DT5A 1X1CA 4YFXF 1XRUA 1VBA2 5A33B 1AR93 5AVPA 3RPQA 1R1A3 2RS32 1SBFA 2W25A 3OYAA 2PEXA 1UU6A 2XJUA 2DXIA 2WLQA 5JZGA 2FNAA 1HSTA 2RS12 2OTLI 4ES8A 5GZEA 1UNBA 3OF1A 3L2CA 4BQAA 1RVF2 3RS6A 3KP6A 4O3MA 3O12A 3BT9A 1DYKA 2VMFA 5FZMA 1T33A 4QIWN 3FZVA 4KWKA 4IHSA 2ARCA 3GNEA 5FZ4A 4V19K 3LSGA 4DMIA 1OVSA 2R5ZA 4HPQA 3AFGA 3WW2A 3AP7A 5GZFA 5AONA 3NMBA 4KMQA 3J81Z 3JRCA 2G19A 3B69A 3Q0WA 1W9SA 1QHGA 4N53A 3NQHA 4YM2A 5FWEA 2CQXA 4LB5A 1JOPA 1OYIA 2KJCA 3MD2A 1KZHA 4JCKA 1MBEA 4XLHA 1RIOH 2PHRA 2M0MA 4NDLA 1RUE3 1X7NA 1OLME 3CCSI 1S0FA 1LB2A 2AC1A 3OBTA 4YFKF 2ZJCA 3DKQA 2DBIA 1YJWI 4IEUA 2X85A 2G7HA 1GZTA 4S2GA 5A1AA 1E3HA 3RKWA 4BXUA 2D93A 5CADA 2VXJA 1ZK8A 2ACJA 4XFBA 3HXLA 1OQ1A 4BBRJ 1EY2A 2HH9A 1SVOA 1SPPA 3UGHA 3M4FA 3GZ6A 3MLLA 3M8FA 3G6JB 1NG7A 4F52A 1PMIA 4UFHA 5HXMA 5F37A 1V3FA 1DIWA 4QX0A 1HC8A 3KFWX 3OL3A 1FBSA 3TQNA 1KITA 4CZSA 3PVNA 2HTJA 3N3HA 1TT5B 3ZLIA 3ZQIA 4A42A 3VZNA 4YG0A 1YIPA 3MF6A 2L02A 3C2HA 3R0RA 1MJ9A 2IXHA 3T4HB 2DYCA 5BY5A 1CQ9A 1LOBA 1F35A 2NP0A 2JD4A 5M3FJ 2P7CB 2QQAA 3SCHA 1O91A 1PK6A 4N7IA 2W95A 3FN9A 3EPZA 4I99C 2J7MA 3MYXA 1XSVA 1SC7A 5GP9A 2ZGPA 4DUXA 4DUVA 1E3PA 3IAS2 5JSOA 2FD8A 4XKWA 3MKLA 4Q0SA 2ZGRA 2COBA 3I58A 1UOFA 1VLNA 2LY9A 1LKXA 4IEVA 3GTOJ 2PMHA 3A01A 3PNTA 1QZZA 4CEYA 1I27A 3BPXA 1XGSA 4LK1F 2VZVA 4I0AA 2Y34A 3CDIA 5DEQA 3HRTA 4QGNA 5TISC 2KDOA 2TDXA 3LOCA 2D5HA 1T39A 1Z7LA 3JD73 1F9NA 2CL2A 2JPCA 3ZFEB 3J7MA 2G0EA 5LY2A 1HJGA 2HZDA 1WCMJ 1OF3A 1UPSA 1AYN2 2W3JA 1TWHJ 2AZ5A 1DZQA 4UT5A 4XSZF 1AHDP 3WDTA 1UZ0A 2OZJA 2EBIA 2ZKZA 2PLYA 1U0AA 4XR6A 3BJAA 2BW3B 2ILMA 2YY1A 2VT2A 5IFPA 4CDXB 2X8KA 3PUSA 2D6OX 3BKZA 2AGSA 5CQEA 1NE6A 5EWSA 3TB0A 4OUSA 3T2QA 2JSCA 1R081 5LGNA 4L18B 1IW7F 4JTOA 3J9SA 4R9AA 3HG9A 2ZEZA 4PBPA 3W3CA 3I2KA 1RI7A 3WGIA 3WCSA 3QYEA 3BVCA 2WWUA 3W5NA 4MFEA 2B8MA 5JIAA 4LA3A 1HN0A 4L8QA 4A3ZA 1ETYA 2VKEA 3RIRA 1ASJ2 1GHCA 1ZR2A 3IIIA 3K4DA 3U0ZA 4OINF 4QPGB 1YRZA 1YNAA 3FHZA 4IEXA 2AQEA 4GMP3 4GH4B 1RUNA 3DPTA 1ZRIA 3SH3A 3OOPA 4L99A 4GWMA 3SEPA 9ANTA 1AR92 4IXAA 4JDOA 1R1A2 4J25A 5LZ6A 4GXLA 4DUWA 5CAZA 1NY71 2NS7A 1CAUA 5KAIC 1V5EA 2VQGA 4JGYA 4DJAA 2TEPA 2BP6A 3VD3A 4IEZA 3TN93 4EN7B 2CMPA 2X6XA 5CFCC 3CMYA 1AU7A 1YS6A 1WCSA 4FPHA 2JJ7A 2WV1A 4MNUA 4NMIA 3UK9A 4D8MA 1RUG1 4V2WA 4HX4A 4BE3A 1VBD1 1TE1B 2EQRA 2BXZA 1ALYA 1UZWA 3I64A 2F6CA 3SH4A 2XJQA 2XJPA 3RZJA 3CMMA 5FKMA 1DU0A 3CO6C 4XIDA 2HOAA 4MUVA 1RKWA 5L3FA 5T55A 1Y0UA 1OKQA 1OLRA 3ZGKA 4P9JA 3FC0A 4QKBA 4YIRX 3G3ZA 4A6OA 4P9WA 4D6SA 5GM0A 1R58A 1KQ9A 2M8EA 3KLOA 3QPTA 2JKXA 1VBA1 1B9NA 4FOWA 4IE7A 1JJ8C 2RS31 3LWCA 1V00A 5IYDJ 1WWYA 3FXJA 1RUE2 2B42B 3GLXA 2HOEA 3CF2A 1VBB3 1K83J 4A3FJ 3A2KA 2EFQA 2Z3YA 4JX4A 3W6VA 3E5XA 1W8FA 4JOMA 3QQAA 3NNMA 2R7QA 3DLAA 1E5HA 3U07A 4EM1A 3AJYA 2M4GA 4C3HJ 4CP0A 1JHNA 3DPRB 5F5QA 1IRFA 2CW7A 2XGXA 4A44A 2E5NA 5AFEA 3H1CA 4LBKA 4XDQA 1YIJI 1C5HA 1NCQC 3VBRB 3KV9A 1RTVA 3I59A 3CJXA 2IXLA 3N7KA 4FQ4A 4UFJA 5T5PA 2QGUA 2Y30A 1SHWB 4UUSA 5FZ1A 2BOJA 5BNOA 3G71I 4W50A 3G6EI 2DV9A 1EKEA 3KF3A 2FDKA 4JTNA 1PM4A 2FXAA 3OUHA 4CDQA 4LBQD 4JBAA 1GP5A 1U9OA 2ETEA 1MBHA 1SFKA 5FZ8A 1JOJA 3ZX7A 2ZHKA 2ZTNA 4Q4V3 3JCUC 1ODMA 1EP0A 2VJ5A 2DVBA 4B3XA 5BNQA 3AM2A 2F4LA 2XBO1 1SD4A 3K4LA 1KU3A 2BBAA 5LA9A 1YLFA 1T38A 5EJ3A 5IVJA 1WSUA 5LLQA 3TWIA 1X1BA 1ULPA 1QO0D 4HV6A 2DLLA 1Y43B 1WH7A 2ID4A 3SHRA 1PP8F 1H89C 5IVVA 3MO4A 4B3NA 1KU9A 2WAEA 3K1NA 3I2DA 1UKRA 1Q1HA 3EYYA 4UXNA 3KCYA 4HSTA 2BNNA 1FP2A 3OEAA 2WADA 2E63A 1CR7A 3KSCA 5IYBJ 3GZNB 4P5OA 2QQWA 4L97A 5I8TA 5LBBA 5BV6A 3JD72 1JKPC 1MBGA 2ZCWA 2WYFA 1BZWA 3JQWA 2RG4A 3P3NA 2W85A 3T4VA 3Q8AA 2LUWA 5GLWA 5DN2A 3UESA 1XCBA 3GGLA 3PUBA 4WF2A 3VDCA 2YG0A 3BP8A 4META 1SFEA 4UI9L 1XD7A 1UYPA 1W7PD 3AG4H 1WZXA 2VE9A 1N25A 3F6OA 3PMEA 3SFZA 1OVPA 3BZKA 2JWPA 1X1AA 2XWBB 5FFXA 1AL21 3BOQA 3QAHA 2XL9A 3LAGA 4MXVA 4FSJA 1EUUA 4BB3A 1APLC 2NM1A 1W8NA 5JOYA 4IETA 1IV8A 1TNFA 2ME0A 2HWC1 4KN7X 1U5ZA 4XLEA 1TME1 2O8KA 3WP3A 1U5YA 3HVDA 4XQWA 4NROA 4P9GA 3LEMA 1JUPA 4RM3A 2RAEA 4CA0A 1WJAA 5D5XB 1YRNA 1CAXA 4WBBA 1CF7B 1OFCX 1U3EM 3O1RA 4YVWB 1S0EA 4NB5A 4E7ZA 4FX0A 4C2UA 4F8AA 1D4M3 2WNUC 1MBJA 1ND2C 3F8BA 3D82A 2W1UA 2JD9A 5F9TA 4R4ZA 2D40A 2Y0OA 3C7JA 4RAYA 2W39A 4FPEA 2EIMH 4ZJZA 5EIYB 1AYN1 1W5SA 2VKVA 2CSGA 3CC4I 1VZ0A 4UFKA 1GUIA 1UIJA 3NWTA 2NOGA 2HQRA 3KZZA 2NNNA 3GM8A 5FZHA 5DZGA 4EMSA 1TQIA 3ITQA 4G3YC 5IVEA 1RUD3 2OJED 3SEQA 4TV7A 3I7DA 2FU4A 3MW3A 3TN92 1ZBA1 2IXCA 3JRAA 5FZ3A 2CV2A 2BZDA 2MH9A 2OPKA 1TLHB 2CJJA 3ASOH 1Y8RB 3AVSA 4AUXA 5L3BA 2ZMEC 3FE5A 1PO23 2W7NA 1IZ3A 5BNGA 4D94A 2EIEA 2F48A 3E3VA 1H6XA 1NX9A 2VBBA 5D5UB 2Y0SA 4II2A 1ASJ1 4AGVA 1W04A 3JB4C 3LWFA 4C1XA 2D7FA 2OPTA 2ISZA 2TRTA 4TN7A 5DM7F 4PFOA 3GBWA 2DVAA 3T2OA 5FMCA 2OBPA 3WX5A 3K4AA 3ZPOA 5J1UA 1UB9A 3GUDA 4MQVA 1C1LA 4O7XA 1QOOA 4NR1A 4NIDA 4HBLA 3UL2A 3A21A 4UBGA 4D5CA 2OUHA 3GYDA 2ZEXA 1VBB2 4XQ4A 1ONAA 2Y2ZA 3POSA 2ZABA 1NLRA 2IS4A 1Z0HA 3KPHA 1A8MA 2I2SA 3PUFA 3GBGA 2WNVC 4ZONA 3O0VA 4LR4A 5A7QA 2YR2A 4CICA 1XYPA 4TLGA 1G9BA 5T5JA 1UMHA 1JJ6C 4O6JA 1ZN2A 4QAWA 4LG0A 4IHVA 2NYYA 3SXWA 1G3SA 4A7ZA 1PP7U 2JG9B 1PZ7A 4FETA 5F6FA 4ENMA 3KLSA 2E1OA 4UHTA 1KYWA 1KD7A 1PMHX 3PO3J 1Q8PA 1UO9A 4C3IJ 3VHRA 5D21A 1LE8A 4ESBA 1Z3YA 1FMVA 2JK3A 3I8TA 4ZS2A 1IUFA 3V64A 4LBOA 4IQ4A 4P14A 1DGWA 1V6IA 2P3KA 2NAZA 4CYCB 2ZGSA 2WABA 3ASNH 4XRSG 1GP6A 5A32B 3LDBA 2CY6A 5AC93 5EEHA 1BR2A 3R6SA 3PSFA 3ZXJA 3DU5A 1OYWA 1RUE1 3RQ4A 1QHDA 3BTLA 1B35B 2R7VA 2E35A 1ULDA 4KU7A 5T52A 2PXJA 1FI2A 3WODF 3JRDA 1CAVB 1AKHB 2ID6A 3MW4A 3FUOA 3FXRA 1UU4A 2IBDA 1X2NA 1T2KA 3EJKA 3CC7I 3AK0A 5FYHA 5EYYA 2LYCA 1OCCH 2HEOA 4Q4V2 3LSJA 1WVRA 1OCTC 2W2IA 2RN7A 2HLEA 4NC6A 4XTMA 3FM3A 4BUPA 4XJZA 4DYQA 1MNMC 2LALA 4RR3C 4QPGC 2JDYA 1MQTB 1X4PA 4BISA 1RUF1 4UW3A 2K4BA 1FPN3 2WNEA 2Z99A 1O3SA 3LD8A 2QQKA 3IMNA 1VQ5I 2VCMA 4Q8KA 3FXUA 1F31A 1DP0A 3ZMDA 1A35A 5J1XA 3M8LA 4GJZA 4B44A 5FRNA 2DJIA 3APBA 1VTNC 3VSKA 5A7NA 5FOBB 3N97A 5CKQA 1FV3A 1XNKA 2CW0F 1V4RA 4IHTA 3U1DA 3M8JA 2E7XA 4UYBA 3B93A 3EHKA 4ZKTB 3OYWA 1PGW2 4L2NA 4I2OA 3ULQB 4ASMB 4RM2A 3BB6A 1VQ6I 4P9UA 4HOOA 3CCQI 2DUPA 3ABKH 3DU6A 3WGHA 1WJ5A 2WY7Q 3FL7A 3BTXA 1FNNA 2HKOA 2RJ2A 3OPZA 4EN6B 5L3GA 1H2KA 3D0JA 1SVLA 2KPMA 3GFJA 3M3IA 3CKHA 1KFXL 4Q4Y3 1VR3A 2ZJ2A 3CIHA 4R52A 2IP2A 3CUQC 4LE3A 5FZOA 1PVXA 1DF0A 2W84A 2LW8A 3B6CA 2WAQA 3VBSB 3CCMI 2OS2A 4CP1A 4KA4A 1OLTA 4ZYEA 4XF3A 5KR7A 2DI3A 1D4M2 2BVVA 3CO2A 1S3JA 3JD71 2P6HA 4OYUA 5FYUA 2TNFA 4DQAA 2E5ZA 2PN5A 2WA4A 2M5WA 3F9KA 3RVHA 3VYSB 3I2IA 1PO11 2E7WA 6PAXA 3WP4A 5FXZA 2IS1A 3BQYA 2ARBA 1ZRDA 4RMNA 2AREA 3VD7A 2X1EA 3H8UA 3CNAA 3G1OA 2L7FP 4M4PA 2YX4A 4HF0A 4AWXB 1WGPA 2CAVA 2RREA 5T54A 1RUD2 2J5PA 3S93A 3NAPA 3VBRC 4FQGA 2DODA 2JVGA 1E5SA 2X05A 4NO4A 5D6FA 3LQQA 3ZP5A 1JTXA 1R36A 1UD1A 2ZGMA 3HOSA 1UW8A 4AVVA 2WKKA 1K6OA 2L54A 1PO22 4KQ7A 2C9KA 5FD5A 3WF3A 3VFZA 3UNGC 4EGZA 2WSUA 4LLGF 1TQ5A 2EPFA 2B45X 2HWVA 4YG6A 5T50A 4IUGA 4L0PA 3LNQA 3ZMNA 4C90A 2BGOA 2P6SA 2H27A 1PZ8A 5A2QZ 2IC1A 4GMP1 5C4WA 2IS6A 3RCOA 2R93J 5FYCA 4C0HA 4Y20B 1UOGA 2JECA 1QNWA 2Q0OA 4LKSA 2E71A 5BNPA 4RHV3 3RMYA 2X6OA 1WWXA 5TRDA 1SEFA 3FISA 2R30A 3LSIA 1Q43A 4D6QA 2EILH 4A3DJ 1DG6A 1ND3B 1KRIA 2XB6C 3ZXDA 2KIMA 1VMJA 2RS51 1YW8A 4BMBA 4E2GA 1Y8QB 5IOZA 3E6MA 5K7ZA 3WNXA 3ROUA 3S3OA 2BOLA 3D4KA 1U6GA 5J98B 3BOWA 1A34A 2HYGD 1PNFA 2IVJA 2P7VB 5CVUA 4EJVA 1VQ4I 3ZDVA 4FPYA 3ZN0A 2R0FA 4K1YA 2R7ZJ 4QM9A 1W39A 4E7IA 5FZAA 1R4NB 2K02A 5FJ8J 4HSLA 3T1BA 3S3NA 2LK2A 1CONA 1LR5A 3ZMTA 1XU2A 1F9KA 1O4ZA 2EICA 2A6ZA 1FYMA 2D97A 2Q1ZB 5AC92 5FZ9A 3ML6A 2V09A 4EZ4A 3USSA 3U11A 2DMPA 4XOTA 4H7MA 3WZ1A 2OIIA 5KC5A 3MDPA 5CA6A 2VKHA 5L3DA 4E2SA 3NV2A 2JIJA 1RC9A 5GALA 3ACGA 4UWDA 2G4IA 5F7UA 4YVWC 2K3PA 3KZYA 4ON0A 3HB9A 1GU3A 2LFBA 3UNPA 2QZ3A 5TSWA 5SV8A 4CDUB 3V56A 3HQUA 1OPCA 4JGZB 1FBQA 2ZACA 4OIRF 2D5VA 2MD5A 2HVSA 1I3HA 3F23A 3RZZA 5BNNA 1MZFA 4ZXKA 3BJ6A 5D5VB 2VPRA 4QX7A 4XFFA 5HXVA 2QDRA 3ZRGA 2DMNA 4IGQA 1LJ7A 2R5YA 1FPN2 1CJPA 4CCNA 5HS8A 2BVBA 4XLCA 2ZXIA 4Y5TA 3HQRA 2P5KA 3ZSKA 1UPIA 5L3EA 3I2GA 4XJ9A 2V4JC 1TTYA 3RKQA 2R7RA 3ETPA 3UKTA 4RLFA 2I8DA 4CZCA 3AJZA 3BLYA 3P5BA 4NHLA 4E8CA 3T1LA 1OR7A 1Y39A 3KCCA 2EV6A 3IPVB 4YZ5A 3HGYA 1C28A 4D1QA 3EXUA 1ENSA 1QJU3 1Y7BA 4PLMA 2NNYA 1GKBA 2W46A 2XAJA 3S16J 4CUGA 1FYLA 4FOQA 1WMFA 1B72B 2WY8Q 2I45A 4Q4V1 1UG2A 4QDRA 1H1IA 5C3RA 3BY6A 3IBMA 5C70A 3ILFA 4L5EA 2W47A 1P9QC 5ABJA 4IV1C 2D6PA 1XC5A 1Z7S1 1H8TC 1QU0A 3HAGA 4MGSA 4Q4Y2 1FY7A 2E7AA 3LPFA 4XKBA 2MPFA 4LO5B 2HGCA 4OU0A 2PX9A 1FTTA 1JXNA 2Q5TA 3O1TA 2ETHA 4AQTA 4H0EA 3VYUB 1QJY3 1ONVA 2FZ2A 4M6XA 4BEHB 1UZYA 3WGGA 4JHTA 2XF7A 2B9SA 2VOOA 3WW1A 2A6YA 3L2VA 1WHUA 2ADDA 5JXGA 2R49A 1PGW1 4GZ9A 4OHZA 5EJCA 2XUMA 1VPHA 5FMDA 1EA3A 4QWQA 1HRV1 1R71A 1UFMA 5K0UB 2YU9J 1JT6A 1LGBA 4YW4A 5ED4A 3O7OA 1FOKA 4ISQA 4OMZA 5FZFA 5F39A 4AFMA 3B9CA 4DW6A 3OYHA 3C2BA 1CESA 2GMEA 3CQZJ 2OUMA 5IOYA 2HWB3 1W6QB 4PF1A 4HF2A 3BG9A 2JUGA 2EZKA 2CRGA 3OMYA 3QYBA 3NAUA 2P34A 4Q0VA 4CHUA 4IEOA 2HOTA 2ORXA 1B35C 1O7FA 2C9AA 4ZU7A 1UHWA 4RA0A 1Z78A 1TQPA 1D7PM 5AFBA 1D4M1 5K9YA 1PX3A 4RGRA 3EDPA 1K45A 1J58A 2XWJB 1HDDC 3TGNA 2O61A 5J09A 3GFLA 1G3YA 5IYCJ 2YC2A 2CQ7A 1DLCA 3GO5A 3DEUA 3N7MA 2UZKA 2Y38A 1UMIA 2DDBA 5B4NA 3W59A 2IWGB 1G9FA 4XIOA 4L9NA 3H5RA 2BHYA 1RUD1 1SLAA 2QQLA 2VQLA 2GP3A 3OYBA 3GCWA 2JQ7A 2J1TA 1A78A 1ZAOA 3CDZB 4RAFA 4BJ6C 2B39A 1EH8A 5IT9Z 3KQRA 2YPDA 3ZKYA 1JZ7A 2FSWA 1PO21 1SAUA 3NQOA 4KICA 4Y5SA 1NA1C 2EVXA 1SQ4A 3ZOIA 3PLQA 3CCRI 3O0XA 1M06G 2EF6A 1ENQA 5ILVA 4YFZA 4QHZA 1ZH5A 3CJNA 1AJOA 2G9ZA 3QU3A 2HYKA 1VBE1 3POYA 5IWFA 1J3QA 4U87A 3I2FA 4M9XA 4AVBA 2R061 4MX3A 4CCJA 1D2QA 1U9NA 3Q8CA 1FP1D 3K70C 4QGMA 1QJX1 3H0OA 1S2BA 3H9AA 2VOWA 3B00A 5J3LA 4XRSA 2W5FA 2LS6A 4KG8A 4M4RA 4DQ2A 1ENRA 2DMUA 2PHFA 4U36A 3R61A 3ELKA 3PQKA 1OYYA 4QD2A 4A0ZA 2VASA 2A75A 2VR4A 4HKLA 2M2EA 5KXEA 3PO2J 3W2WA 1WKMA 5F08A 3WU1B 1G6NA 3F8NA 1O57A 1O5UA 4ETSA 3BR5A 1EF4A 5GPCA 5DG2A 2DJNA 4PK4A 1YW9A 2WL1A 1MR5A 2W82A 3CO7C 3VBSC 1KJLA 1D5YA 4I98B 1G8XA 4L92A 4LLFA 3HGGA 2E2IJ 3ABTA 3SZTA 4V2GA 1YO5C 1G9CA 3GZ5A 4LOTA 2WB1N 1S55A 4E2QA 2E51A 1FBUA 2JDKA 1QWRA 2IT0A 4NPRA 1CJDA 1OOPC 4Q5SF 2ZX4A 4OVEA 3BG7A 3JUUA 2BV6A 2UXXA 2R0QC 1C4RA 4HPKA 5FQ0B 4QPOA 3NL1A 2DOFA 2P5VA 3KHBA 4B47A 2D45A 5H9QA 3C7HA 4QT6A 2XVCA 3H92A 3RYRA 1WCDJ 2WSVA 4LK0F 5FPBA 2VOVA 3K4KA 4P02B 5LWBA 1R1TA 5FP8A 5CFDA 3CL1A 4ZTFA 3HOBA 1BC8C 5HCFA 2HQNA 2OA4A 2PBIA 5IUQA 4RL7A 4Y3OA 2FDJA 2EFNA 2E7TA 5DZFA 5B1BH 3OOUA 1QJU2 1JYNA 4EN0A 2E7QA 4O5VA 4YGDA 1GDTA 3HC7A 2QLZA 2Q30A 3UETA 2BHZA 4IV3B 2IXSA 5DCFA 4BXSV 2OXBA 4CUCA 4NQWB 4M3CA 1L3JA 5EQUA 3BZ6A 1W6OB 2XSDC 1H1AA 4RD7A 3ZR8X 4WVZA 3F21A 1FPN1 3ZFGB 1O4YA 3NJVA 5FB2A 2J1AA 4PI2A 1K6YA 2ZPXA 4I7HA 4GKXA 5FBJA 4LK6A 4E7JA 5FBZA 4YVSC 2A3YA 4XHBA 2M4KA 3BN6A 4ZZ5A 3KF5A 2LH9A 2J1EA 1SFUA 4KGGA 4HNUA 1DYOA 4X6RB 1S29A 2KISA 4AYBN 4H2AA 4Y1ZA 4ZHNA 3NNFA 4TSVA 1D0GA 4LLLA 1QJY2 1BHGA 4C1WA 1VQPI 2CNAA 3S1QJ 4OI0A 2X5IA 5DUUA 4AGGA 4KT6A 5J96B 2MLKA 2H1KA 1W0TA 1XYOA 1LGNA 3FFZA 3W20A 4F92B 2NVYJ 2EK5A 2QFEA 3N05A 1OQEA 3VBHB 4NUBA 1YYVA 1V6OA 4CSWA 3MEXA 1GMMA 1AXZA 2TUNA 4OHWA 1MMGA 3AG1H 4AIKA 1H9WA 1Q56A 2YBSA 3HMYA 1OCZH 4QB2A 2B63J 2J42A 1JU3A 1U12A 2HWB2 3FZ3A 1UG0A 2JWTA 4AFDA 4R9DA 2IGNA 2ZZJA 2BNMA 4OULA 1FIPA 2O8QA 4QQHA 5H9SA 3KD4A 3ZN1A 1NCRB 3P9CA 1N1VA 2VL4A 2VN2A 4KNYA 1NG0A 1BIAA 1Z77A 5FYIA 3BTZA 2CAUA 2Y69H 3FHQA 4EJUA 4S04A 2EFWA 3ERMA 2EIJH 3C3WA 2VJIA 3M1CA 2ZSHB 4LBQB 5FYMA 4ESJA 2JICA 3VKNA 4C30A 3SDBA 1I9RA 4IRGA 2D6KA 1POV0 1ZLKA 2KRFA 2Y6LA 3O1VA 4D0PA 4PIXA 1QXPA 3KE2A 3C2UA 5F3EA 4CDUC 1F2NA 4AFAA 3GTLJ 4I3PA 4MXWB 2CDPA 4KGQA 2FJ1A 4JGZC 1IO2A 1RR7A 4G4FA 5H9RA 5ILUA 3UGFA 1GVDA 3A0HC 2IFWA 4ENNA 4AC0A 4WWCA 1HKQA 2H6BA 1FXZA 2A73B 1MEC1 5H9PA 2P37A 4Q27A 3WTXC 5FYYA 5FKLA 5CZKA 5C7GA 3VPRA 1ZBE3 3O8HA 4IJAA 3K1PA 1DUXC 2M9HA 1ZRCA 3WU2C 4A7YA 4HFSA 4J1WA 5A7WB 5A33A 1GXPA 2OQ6A 1IAWA 1WCQA 1AVBA 3URFA 3KT4A 3DGTA 3WF2A 4AE2A 3VHOA 3ZXLA 3I71A 5GPAA 3TOJA 1IXCA 4AEDB 1JZ8A 1A8DA 3JQXA 4QHBA 4R4XA 5FMOL 5L73A 4ZYHA 1LOGA 1FOD2 1HX6A 1W7PB 4A3MJ 1OKOA 5J36A 4X0GA 1JZ2A 1O3QA 2XR4A 3MIBA 2R7OA 1REPC 2VODA 3H8OA 1QVTA 4U2AA 1UY2A 3K9TA 4B4QA 4OI4A 4BA6A 3MLKA 3KZIC 2Q2EB 1ULGA 1YX5A 1SDWA 3O1OA 5C44J 3BPSA 3EUKL 1DGRN 5ICCA 2O0OA 5EJ1B 2UU8A 3T30A 3VBUB 5J4VA 1W0OA 1HQCA 1UQXA 4LOSA 2XF6A 3LDRA 3HUGA 5J8CA 4INDA 5HCBA 2HDCA 3F0CA 1XQNA 2O8OA 2EV0A 4J1XA 4OZOA 5C9AA 1ZG3A 1EPWA 3ZPLA 4NIHA 3OIPA 4YW2A 2DCJA 1ZRRA 1MS1A 4JC1A 5JMOA 4B8EA 3ABUA 5IYYA 2XROA 5ANNA 3JRGA 1STZA 1AOYA 4KITB 2HWD3 4PDWB 1HW1A 4C3JJ 5F27A 1HF0A 1H4GA 1HB4A 3AXEA 3V7SA 2VE1A 4ENKA 4AEJA 4Y17A 4Q4X1 1MACA 1JW6A 3RPUD 2BV4A 3EQEA 2ZMLA 5JLVA 2K86A 1XCVA 2DVFA 2NVQJ 3MIFA 2A5YB 1LFUP 1GSLA 2VW0A 2EXIA 5JCTA 4AVTA 1H1MA 4YW7A 2YC0A 1JUSA 2WBMA 2HWF1 2HDWA 3VHPA 3KGLA 5JMCA 2XPUA 4EZHA 3P5JA 2GIZA 4E4ZA 5AVAA 1D8JA 1BCXA 2QSHX 3MCZA 2LF8A 1ORKA 2WFPA 1VAKA 3AKSA 5L7OB 3LIGA 2ICWG 3V7RA 2EIKH 1EV13 3CZ6A 3LA7A 3JRBA 5F5IA 3D5RC 1CIWA 1WW6A 3UKGA 2JA5J 3D5LA 3HDDA 1DU6A 4XFCA 5T3NA 3D6EA 2A6TA 4DINB 2CQKA 2MNGA 3OV8A 3BG3A 4ISRA 4YYOA 5EGOA 2GALA 5CKMA 2V1NA 3ABMH 3GZAA 5KHGA 4D7TA 1HXS3 4RS5B 4DRVA 1QJU1 2GNBA 3ORJA 5FP4A 1W9FA 3KP3A 3PJRA 5BPXA 2D98A 4QPQA 1OT5A 5LHIA 3WTVC 4OMYA 4HQMA 3S1NJ 4AXOA 4G7HF 2BFUL 2GMPA 1QXJA 1JTZX 3B94A 4SLIA 5H20A 4AR2A 1OQDA 2RC4A 3VBOC 1W5TA 4CU7A 1G3TA 3ZFEA 1JKOC 2XLFA 1HBXG 2VTFA 1T6SA 2WA3A 2OVUA 2VUMJ 3HBKA 4NPMA 4XEZA 4K7JA 1FEXA 3L9FA 2WIIB 2IVMA 2DTYA 4QX2A 2QQNA 2ESNA 3OL4A 2ZGOA 4J19A 4EN8B 2DYRH 2BW3A 1QJY1 2ECBA 5EFUA 2PN6A 4CDXA 3KIOA 5K7HA 4LHSA 2EALA 4KISA 4I3GA 4P08A 3KYCB 4WM7C 4IPAA 1AX2A 2QA4I 1YJNI 3VDDC 5L19A 2KIFA 4Y1XA 5IVBA 1AHSA 3OUIA 5FPVA 4COWA 5FYTA 5GZGA 3UYJA 5A3UA 2HPIA 3WDUA 1TT0A 3J80Z 2HPMA 5GTHC 2Y64A 2ZX3A 3N35A 1H88C 4XYXA 1WW4A 4Z8BA 3O5SA 3TOAA 1D4VB 1ZTRA 1E5IA 5EJZB 2OF7A 4QWNA 1P92A 2PLV3 5FXVA 3OG2A 1ZBE2 3RRDA 2JVHA 2NS0A 1JHJA 3G1LA 1YHFA 4GH4A 4LO7A 1YQCA 4PLOA 4A5MA 5FY7A 3M3QA 4ZZDA 2P8TA 3RTRA 5CU1A 2CUZA 1Y4WA 4B1LA 4FPOB 3C3VA 2CV6A 4BLIA 1CPMA 3OY8B 1RGSA 4KMUX 5EG0B 4RGGA 3J7AO 1HLVA 4LPLA 5ERIA 4EWDA 3CCEI 4CO8A 4IV3C 3I55I 3RI9A 3K4ZA 3KZ4C 1B4AA 2OAZA 1X2MA 1SFXA 4BJ5C 4XQDA 4GFBA 3OYKA 5JSRA 2VI6A 2XOMA 4L9BA 1VNDA 2A3SA 5FFOC 5KK1A 3IV5A 3ZFGC 4A3LJ 2V73A 5D8AB 3QH6A 3UGGA 1IXSB 2GP5A 2J22A 2YUSA 3ABLH 1WCKA 5E3MA 1QJZA 1F5JA 1S0JA 3BGAA 2XAHA 3DL3A 2JG8B 3H1YA 1LTEA 4UW5A 2QQJA 1NE4A 1GZWB 2KQRA 3PQJA 3OYEA 4XHXA 2W9XA 3VHNA 4AI0A 4DBQA 3F8FA 3OD4A 2VLAA 2YU1A 4W65A 4WM8B 2HWD2 1HCRA 2LD5A 4XORA 4LIVA 3CDHA 4JYKA 1FOXA 5JZGB 1DQ6A 1FOD1 2HBTA 5IW0A 4NRPA 1PGSA 1KJRA 5EZGA 1TW3A 2WBKA 5LGUA 4J00A 3V65A 2YGMA 3Q9OA 1JYIA 2F5CA 3H42B 1XE8A 5FUPA 3E97A 3JB8A 3DPRA 4FI9A 4IE6A 4CCOA 3LSEA 1KS4A 5A2QK 2VC1A 3EUAA 4CP9B 3F72A 5DUVA 1MNDA 1ZZ8A 2UYAA 3MIDA 3C8XA 2K9MA 1HOMA 4LNVA 5K1YA 1LVAA 1F4AA 1NCRC 3VBRA 1T0FC 3ACFA 1XXNA 5FUNA 1FOWA 4AHYA 4N53B 4RB1A 2A69F 2KDZA 3H50A 1N1YA 5LEKA 4DO0A 3WF4A 1HSJA 5KWRA 2YUEA 3LCPA 1TMF3 3HJEA 4CCMA 4Q1RA 5CVIA 3WP6A 2MW8A 1AR63 2JA8J 4FBFA 1EV12 1K5MB 4GULA 2V1DA 1IKPA 1W8ZA 5FZCA 2EA7A 2G1MA 1QVUA 1F4HA 1SLIA 4BJ0A 4IEWA 4IESA 3BODA 2QDNA 1MW7A 3GX4X 2DMTA 2LREA 1LOFA 3ZQGA 5J47A 5E8AA 1AR73 4UFMA 3FF5A 1WJFA 1HXS2 4CGZA 2E26A 4XZUG 3FHIB 1ZZ9A 1I1SA 4R9CA 4K2EA 4XFGA 4LUMA 1Z6TA 3VDAA 2ZGUA 3D5SC 1GNYA 5C3PA 3MAJA 2L9NA 4XTPA 2DTZA 4HDUA 4PHZA 2X10A 1CAWA 3E7LA 5SV5A 5DUWA 4AEDC 3DBRB 3RWKX 1F36A 3S8PA 2IGMA 3ZO0B 2Q4SA 3OYGA 2MSYA 1F4KA 3ECOA 1JODA 1TBXA 2ZGLA 4LHNA 1MZBA 5C8CA 1TZLA 2XRNA 2FQPA 5IT6A 2CS3A 2VVDA 3IH3A 4OZXA 3VKMA 3WUCA 3EMRA 1QHHD 3KEYA 1O4XA 2A6HF 4PZJA 2LDUA 4PGHA 1I1GA 1IDZA 1GWKA 1LOEA 1MS9A 2QKLB 2LRDA 5KHHA 3RJPA 5JXHA 4DBRA 1YOVB 4NHMA 1HXDA 3VBUC 5GZDA 2IA1A 3PNVA 2ET1A 4MGTA 1YQAA 2NVXJ 4XFHA 2XPJA 4D7NA 1CGPA 2FDGA 1H2LA 3A01B 2LKXA 1CF7A 3RKYA 3MF9A 3AKTA 5EXOA 1S72I 4H14A 5E89A 1B6AA 5JDBA 4E4HA 1HW2A 2BBVA 1OLQA 3DBLB 3R0JA 4IGPA 4OWRB 1WFXA 3OBAA 2V5DA 3TP0A 4Z2YA 4PGGA 1HA8A 1HB1A 2D5FA 2PLV2 4OMDA 5FZLA 1DLLA 3KV4A 2UXNA 1CD3G 1U5TC 5K5RA 4PCRA 4YW6A 1W28A 5DMYA 4QKDA 1ETWA 3W2AA 1IQDC 4S0HB 1X82A 4BACA 1EPZA 4QTRA 5LY1A 2NVUB 1EAH3 5ICGA 1RR8C 3TO9A 3I53A 3PU3A 3N7LA 1G8WA 2K40A 3AMQA 5L7OC 1W2NA 2BU9A 4IOCF 3I3EA 4LO8A 1STMA 1ZELA 2K9SA 3DYOA 4M00A 1Y1VJ 2VJXA 2PHTA 4KFCA 3J4UH 2JRTA 3WY6A 1W9TA 2XJRA 2DA2A 2VNGA 2EIDA 3ECQA 4JV4A 4F7ZA 3ACIA 2OD5A 1ULFA 1YX3A 1DYPA 1PIV3 3OY9A 1BYHA 5CG8A 2RE9A 4XKVA 1T98A 1AA7A 1IRGA 2V1UA 2ZS6B 2VE8A 3EUHA 4RGUA 3WTTC 3HJRA 1TNTA 1IXRC 1DGWY 1G59A 3WR0A 4CEWA 4AQ2A 4Q4ZF 5JAXA 3ZQ7A 3H8RA 2JA2A 3AX4A 2RDNA 4ZPIA 3LSMA 1JZ6A 2HVRA 1WJBA 4M71A 1ZZ7A 3DF0A 2A5ZA 3H9JA 4A41A 1NYWA 2P5LC 1DZRA 2YB7A 1Z0XA 1YJ9I 1JYCA 4CXFA 1XNCA 5CNAA 3K46A 2VZQA 3GTKJ 1X50A 4IKFA 1OSGA 5FR3A 3RYPA 2X6WA 2JG9A 3CJQB 5DCMB 5LCWL 5C3OA 4BNCA 1NLSA 3OS0A 1F15A 2F2EA 4ZU4A 1RNLA 1ENHA 2IGKA 1PUFB 1W6NB 3E1F1 5GLTA 1OPOA 2DO7A 1TG7A 5AIPA 4CYCA 3C7OA 1Y9MA 4BAYA 2MG4A 2GOMA 2E1MB 2L7ZA 2GSYA 5T5OA 5A7SA 5GADJ 1TMF2 4OQ9A 2OV7A 1AR62 4V1PA 1K12A 5E17F 1XB9A 2GU9A 4GA9A 3N9NA 5DUXA 5IT9K 2HWD1 3EYPA 1TC3C 3IC7A 2DCEA 3IAQA 5HNFA 2HXOA 2JE8A 2ZFUA 1CAVA 4JZRA 1AKHA 4BE1A 2ORZA 2D3RA 3OGVA 5A1LA 1QQP3 1Z6RA 3D0SA 1JUHA 1ZARA 1YQ5A 3AC0A 2VECA 2OQRA 4NRMA 2AHQA 3B3QE 1FNYA 4A3IJ 4AM3A 2H09A 1L7RA 3CJIA 1AR72 3JR9A 1AUYA 3JCIA 3VDXA 3FDYA 2PELA 2RKHA 1WJEA 1C8M3 4AVCA 4CPBD 1MQTA 3R05A 3A4UA 4GB31 3J8F3 1YI9A 3DEMA 4PT6A 4DXRA 1E5RA 2A68F 4XN3A 2LG4A 3KV6A 2QJVA 3NVCA 3FMQA 4I0BA 3I59B 5B5EC 1EV11 1JE8A 1Q8VA 1KQRA 2L01A 1S7OA 1YS7A 1R22A 3VKLA 5D2AA 1JZ4A 5HS7A 1K79A 3SNMA 1OFNA 1WUVA 5HLIA 1YFWA 1FT9A 5E16A 4EYUA 4IQJA 2PHWA 2VY0A 2DCYA 4XONA 2GWRA 2ZX0A 3WNPA 5FCCA 1AX1A 1RMU3 1BJAA 2STWA 1IJWC 4BHCA 1N3PA 2V6CA 2W94A 3AKQA 3PIOF 3DKWA 4V2FA 3FJSA 4UFLA 4ZTJA 5FKOA 5A3OA 1APNA 5J40A 2EH3A 3ME2A 3ZN6B 2BW8A 1Y1WJ 3BTCA 5JXIA 1Y9QA 5M0TA 4FTBA 5FPAA 4K1ZA 4JRAA 4YIFA 2JG8C 2CWEA 4IQPA 1QOSA 1CX4A 2SLIA 4N7UA 2J5OA 2B4KA 1SACA 4NAMA 3DXJF 3ENRA 2DA3A 1TWGJ 2LF7A 3HQXA 2N7GA 5IATA 3IT8A 3M9AA 1W03A 5JZGC 2XH6A 3OYCA 4XETA 2K9LA 1S0GA 3OYIA 4BBSJ 3BCBA 4OAYA 1CQTA 3HWJA 4XBNA 3R4DB 2EA4A 5JVGF 1KGSA 5BOXA 2I5UA 2NMNA 2IA2A 4K8RB 4XCBA 4OLLA 1BBT3 4AYUA 1SCRA 1OCPA 3QPHA 2WWJA 2BEOA 1OA4A 4QXHA 1VBC1 5FJKA 3UV9A 3FBYA 2JMWA 2Y6FA 4BQ3A 3ZYPA 1H8AC 4ZDLA 1PUEE 4DS0A 2AH2A 2WS93 2DPUA 2GDFA 2PG4A 2O0YA 3K4BA 4J01A 3WHCA 1WI3A 1BVVA 5FMOS 1ZX5A 3ZFFA 3C7EA 4CH7A 3AG2H 4N53C 1MS8A 3PJQA 1UF2C 1XBFA 5HV4A 2VNRA 5IHRA 4JX5A 3RKXA 2WQZC 3NNGA 3PL8A 1B8IB 2Y6JA 2GNDA 4HX7A 2EA2A 1ZLJA 4Y13A 4BM8A 2BJSA 2R043 3D8CA 4PJLA 2W87A 3FBMA 1AYM3 4LBJA 1T56A 4A6EA 1JS9A 4KJZA 1K7AA 4BQNA 4LTAA 3QCWA 5DS9A 3X29B 2O5RA 2PLV1 4WXDA 3GW2A 1PIV2 2KFDA 5CJ9A 1YFHA 3J7YJ 2B0LA 5DPNA 1LU1A 2P6TA 4Y20A 3VZKA 3I3LA 4Q48A 2YU3A 5J6XA 2ZA9A 3AZXA 4HLTA 4QX3A 1POV3 3R0AA 1ZZCA 3GBFA 5B66C 3MZHA 4YG3A 2PHUA 3RZKA 2E1NA 1A5JA 1LNSA 2BNOA 4XICA 3HOTA 1XU1A 3MW2A 2W91A 5B4XA 1EH6A 1ND3A 1RUC3 4ORFA 1IZ1A 1S4CA 1IUYA 4OCTA 1K61A 2A6WA 1JYWA 1D8KA 4IHWA 2PFBA 2OKXA 4UW4A 4DZJA 1JU4A 4XF0A 2FBKA 2KZGA 5FMBA 2VBDA 2V4AA 3ZYIB 4O9GA 1OKRA 3MGUA 2QBYA 2IS2A 1SAXA 3THTA 4XNFA 5E18F 1J3PA 5F64A 4PJNA 4LBLA 3BOPA 3ACHA 1MVEA 3LZZA 4AYBA 4UXAA 2FUG2 1FSEA 3NKTA 3POJA 2VXZA 1D0ZA 3MKZA 2MEV3 4L5IA 3WHTA 3I4MJ 3LA3A 1KEXA 1PK6C 2YYOA 1P6RA 4XMIA 3RNSA 3K7AJ 1REEA 3Q9SA 1HB3A 4NRQA 4ZXEA 2VM9A 3T08A 2ZAAA 1FMD3 2DBNA 2JDUA 1N3QA 3K2OA 1C0WA 3TRSB 3AL0C 4IL7A 4ZC3A 1YC61 2CQNA 2WNUB 1ND2B 3OUJA 2MYSA 3CP2A 3RSNA 1ZNPA 2JXAA 3S15J 4CEYC 3RYKA 1KYZA 2VGDA 1BM9A 1QNYA 3HOVJ 1YI7A 2NZ9A 1V5FA 4LG0B 3C7FA 2R7FA 3R60A 4GD4A 5EV7A 3DCFA 2ELHA 1C8M2 4BE2A 1JN2P 4CZZA 3K75B 4CXXA 4OHYA 1VRH1 4UUTA 3J8F2 3CHXA 2BFUS 2LBFB 4XRMA 1PX4A 4FPFA 1F5FA 2QSFX 1A6QA 3CF6E 2ZMEB 5A3LA 3Q0VA 3LKJA 1IGOA 1BMV2 2VMIA 1H9TA 2R073 4FASD 3IPVA 1XJAA 5KHJA 4HLXA 1EH7A 5GLVA 2HU9A 2P0WA 5IJRA 3IHUA 1R49A 4QU1A 4XLPF 1B72A 1HW5A 2FD5A 4NAOA 1VAVA 3VDBA 1GOGA 1RMU2 2DK5A 4GAZA 1BJZA 3T8TA 3HTSB 3L7WA 1AR71 2P81A 2RGVA 2M7AA 2WO7A 4YELA 1PMJX 4AFBA 3PIGA 5H6QA 5I0DA 1JGSA 4OIQF 1DU3D 5EPAA 4KIFA 4NBQA 2FDIA 3U14A 3LL7A 4A0YA 1ETKA 1QNTA 3KYDB 3QLQA 1YE9A 4FPKA 2WNVB 1S0CA 2QKMB 2WFF3 1ODNA 3P9IA 5L36A 2CW8A 2O9LA 2B9UA 4I76A 3L9JT 1T6BX 1L7LA 3KP4A 5HODA 4QPIB 2BYVE 3PIPF 4JGYC 3ACLA 4QXCA 2EB7A 3CESA 1DGRA 4BEHA 2CU7A 3M2MA 2W1OA 2ELKA 4G6QA 4LHKA 5FY9A 4JQTA 2ZB9A 2Z42A 1XX5A 1BBT2 1DPRA 4BY1J 3JRHA 1Q3EA 5K0UA 5K8SA 3HRMA 4KIBA 5GTIC 2TBVA 1JHHA 5FWJA 2WS92 4D7SA 1TP4A 2O1QA 1XE7A 5A3NA 2DPDA 2BGCA 5J1YA 2V1XA 2R7TA 4CCEA 4RBOA 2YDEA 3NJXA 1W6QA 4ASKA 3N4MA 2E1MC 1C1FA 4JK1X 1K78A 2A70A 1QJEA 2R042 3WDWA 2LSOA 1JT0A 2WV0A 3MV11 5F32A 1AYM2 2XHNA 1BKZA 1UYXA 1JKQC 5LRSA 1HV1A 2RDSA 1KQ0A 4RB2C 2WO2A 1H0MA 4Y33A 4YPJA 4RR3B 2L0KA 4FVVA 1I5ZA 4I09A 2W00A 1XMXA 1FLIA 3HSFA 1R5ID 5E8GA 1F43A 1RUJ3 2BERA 4E27A 3OYMA 1LEBA 2FMYA 3O1PA 4BPZA 3RSJA 1LHNA 3K10A 1RUC2 1J83A 3O1MA 4OIPF 3N9OA 1RZ4A 5A3TA 1C3HA 2VQ0A 3BTJA 3D5OA 2Z1DA 1F8VA 1A6IA 4ARXA 4QKFA 1VE0A 1R093 3TAYA 3SH5A 2IJLA 2R7SA 2DUOA 4FXGB 3G7DA 3T8RA 5BNOC 2JZYA 1SD5A 4I01A 2D2WA 2YV8A 3WQBA 3M7GA 3MIHA 3AZZA 2MEV2 2R7EB 4CDWB 4CDQC 1XDSA 2X29A 5D4RA 2VZRA 3QPLA 3UJQA 2RNGA 2PAEA 3FLTA 4FOVA 1V0AA 4DXZA 2L2OA 2IUWA 3J80K 1ITYA 1FMD2 3CUQB 4Q8LA 4NNJA 4NE9A 3ZR5A 5BQTA 3W9AA 4DYRA 3ZMOA 5KCMA 2BGPA 2RS11 3BR2A 5BNPB 4R1HA 5GZCA 1W0PA 2VZSA 1RVF1 1TNRA 3GHMA 2XVGA 2GC3A 3A4CA 3JBG3 1QIQA 1AZDA 4HANA 2F6BA 4YLZA 4N43A 3LB9A 2DU9A 4RB3C 1KDKA 2WQ4A 2UY8A 2WNOA 1FSHA 1DQ2A 2ZXWH 3CJRB 2DFBA 3CU7A 2YPRA 4QGLA 2ECCA 2QNKA 1GQHA 3CEWA 5A3MA 2XVLA 3IWFA 2VO5A 1HKTA 3T1MA 4W8JA 3OS2A 1IN5A 4HV5A 3DBHB 1JOBA 1IS6A 4C0BA 2L9VA 5FQ0A 2ES3A 4UV8A 2D3SA 3MFAA 5L9RA 4XLAA 5HNHA 4DXTA 3B73A 4TXWA 3BG6A 3NKGA 2LVSA 2MC4A 4XMYA 5JIUA 1OH4A 3A0BC 3CCUI 4FTEA 4P9FA 2R072 2IAIA 2XB5A 1O8SA 5IP6A 1W8HA 2PMUA 4PSXA 1LHOA 2ZEWA 4LT5A 1YQ2A 4KDPA 2XV4S 3H9QA 4XFIA 4IO9F 3ZN4A 1DQ0A 2BE5F 4E4DX 3S32A 3RQ0A 4PDKA 3CTAA 2YBPA 2WA0A 3AP5A 2PQQA 2E33A 4NQWA 1UOBA 2PJPA 1C8M1 1T6GC 4OHXA 4Z1VA 2WZR3 5HLGA 2DQLA 3J8F1 4JRLA 2WO1A 1CZTA 1LJ9A 3V4GA 4D9JA 4TWTA 5LRRA 4Y1UA 1WLTA 2WFF2 5B1AH 2YFZA 2RQQA 5F3IA 2ARXA 4Y7NJ 4WCGA 3OGGA 1BMV1 4J6GA 3TEZA 4Y4YA 2Z79A 1R1UA 4HZFA 3CMAI 5KNLA 1JH5A 2UY9A 5LGTA 2AS5F 4X6AJ 1LPQA 5E3OA 2XRLA 4M3CF 4QMAA 1FX7A 5ISLA 4Q4W3 3LA2A 3M3YJ 3BTIA 1RMU1 2XUEA 1MNEA 4FE4A 1AXKA 2VVFA 1GZ9A 4NOTA 5TGTA 1JYVA 3TEXA 3VBHA 1VJ2A 2VOKA 3WTUC 1BEV3 1XGOA 1QRYA 3PNYA 5C4JJ 1JZ5A 2NOJB 1GVJA 1LEAA 5EYRA 2VUAA 2R16A 2VMEA 1QMJA 1FC3A 4K3UA 3AG3H 2MHFA 5ANQA 1OISA 4G7ZF 2JIGA 5D1IA 4NVPA 4QHOA 3SEZA 2DCTA 3KQ4B 5FP3A 1GLHA 4LGWA 1RJ8A 1MVQA 5C3SA 4HKOA 2DFEA 3WU0A 3H7YA 5BPDA 3CZJA 4Q0QA 1G9DA 4A3CJ 1Z21A 2PI0A 1N1TA 1XMAA 4HN1A 2VMCA 3J7AY 1SVMA 3TEYA 3UJOA 4LBQA 2VKDA 4FPLA 2YBKA 1A04A 3M70A 1BBT1 2FCVA 5LASA 2VJJA 2Y6GA 5FREA 3HIFA 3T0DA 4HK9A 3W6KB 4MXWA 4OAZA 1I6HJ 1G3WA 3WXPA 2A1XA 2PHLA 4QPWA 3WF1A 3BQZA 1H8VA 1R083 1WPKA 4NHXA 2EJRA 3ETQA 1U8RA 3NJYA 4TTGA 3AVRA 4GQ7A 2ELJA 3GYHX 4PLNA 4RAZA 1UELB 1GYKA 2L4AA 4PF5A 4Y4RA 2R041 4QX1A 1R092 4CU8A 2BPA2 3O2PE 2IRFG 1AYM1 1X1DA 4W4ZA 1OJLA 4UVCA 1GWLA 3HBLA 1UAAA 4COVA 4ARYA 2HEVF 5A7WA 1ZG5A 1GUUA 3RI4A 1H9PA 5H6RA 2ZX1A 4GRIA 1C8NA 2RMU3 1I3QJ 2DURA 2FX0A 4IV1B 4AEDA 5FPZA 2WINB 3POBA 1H8TB 3IN9A 4QM8A 3T3YA 5HCAA 5LBQA 2C1FA 1UXXX 1LHVA 1AR91 1R1A1 4B4RA 2EV5A 5IAXA 3OTFA 1RUC1 1LRHA 3DQVC 4BXFA 3A22A 2QENA 2Q2EA 4OIOF 2F4IA 2VQUA 3SC7X 4DEVA 3S1RJ 3JBG2 5KC6A 4MGRA 3M3CA 1BIBA 3B02A 3GF2A 4XM3A 1IN6A 3LOIA 5AIQA 3BR1A 4KNCA 4MGKE 3VBUA 3NJZA 4XURA 1ACIA 4N0BA 5KHDA 3S17J 2ISYA 4XBLA 4WVMB 3GJAA 4WXCA 2EXJA 2YGLA 1QH7A 2K9NA 4QPIC 3LPGA 2WYSA 4M0HA 1BI0A 2WTEA 1V55H 1FAYA 4AOCA 5DDGA 2MEV1 3LEIA 3W21A 2FQ3A 1G4DA 1W6PB 3F95A 2ZBJA 2VZ3A 1AR83 2QZ8A 4PDWA 1XN7A 4AD9A 2DCKA 2H6CA 3HRSA 3NRVA 2DQRA 4ESFA 3VBFA 2VUDA 3K3NA 4UB8C 1X9TA 4RGSA 4AU7A 5DUIA 5DD4A 4HDVA 1LESA 2PTMA 4HA8A 4IVNA 3DYPA 4KH9A 2LRPA 4M72A 4N4NB 4FXKB 3GWZA 3K4CA 2XB0X 2HEWF 1BW5A 4HEA2 2LKSA 4I30A 4GXOA 3TDZC 4AFCA 3WINE 3LFIA 2EFPA 1J0RA 3WD5A 2CQQA 3W6JB 3DKXA 2JDNA 3LSTA 4X8NA 3CMEI 4AAXA 5F6LB 4YZ4A 1J59A 5JR2A 5L7OA 4QQ2A 1V54H 4G6DA 2WZR2 3C1DA 3ZVXA 5LBEA 1Y6IA 2N8GA 2GLOA 3U10A 4B1RA 2JEMA 3Q5FA 3U1XA 2M1BA 2PMWB 1NK3P 1W36C 5A7PA 2CGOA 3HOXJ 1BVP1 3ESWB 5FO8B 1VQ9I 2W57A 4BKXA 1N77A 1NA1B 2DN0A 4DNYA 4EQVA 2R071 3BUCA 3RGBA 4K6BA 3SHFA 2QYOA 3NAPC 4W6WA 4RS5A 3BCAA 3A03A 1HLCA 5FLXZ 4DY5A 3ZXKA 4Q4W2 3JAMK 1S2EA 2PAKA 2XBO3 1Y56A 1ZYBA 3BIEA 3PJYA 4P9XA 4CDWC 1BEV2 4K9SA 4JHZA 5GJ6A 4MGYE 4YZ1A 3W2VA 2UWBA 3HZJA 3MV01 3WNNA 3H3LA 1AF9A 3ZSLA 2XGEA 4AVSA 4QQOA 3GDBA 3ZIWA 1MKMA 1GWMA 2GC2A 5JOXA 2WFF1 5C4WC 2XKPA 5FZ0A 2W52A 4DOZA 5BNPC 3DP7A 4WVVA 2OZ6A 3USUB 3DWLE 1GR3A 1OUXA 4HRIA 4LO4B 2LTPA 3MIGA 3W5MA 2FOKA 3IB3A 2VBWA 5I0SA 3T0BA 2R7DA 4PQQA 3PVEA 4DXSA 1LAJA 5JHUA 4D6RA 4KWUA 3H1MA 1AL23 5I91A 5KXCA 4XOGA 3F8CA 1RRJA 3L2UA 4XK4A 5FY8A 4AQ6A 5CVRA 4GJYA 1OOPB 1VQNI 1MSFC 3KWVA 2HWC3 3FLPA 4UUVA 1TME3 1W6MB 5GAHJ 5F6KA 3F3XA 2M87A 2VNVA 4MFDA 2OTJI 1XYNA 4FFGA 1R082 2R3SA 2KIQA 2QZ2A 3R4SA 4BQ2A 2CWMA 3HOUJ 5LW9A 3SITA 3WF0A 2DCZA 2DFHA 2YSRA 2QQ8A 1W90A 3IH2A 4FFIA 1DQ1A 5FPUA 2KT0A 5FD6A 2M3AA 2QCSB 1ON1A 3AZWA 1PYVA 1A6CA 2DVDA 4KWJA 5I0RA 4JP0A 1UCRA 1F5TA 1LDJA 1POQA 1ERDA 1UX7A 2AR6A 2V7FA 1DZTA 5BYNA 2A05A 3H3UA 4RN5A 3RJRA 5E8IA 3HOZJ 3VYTB 4YWAA 1RB8G 3QBQA 2RMU2 4GIQA 1LGCA 3E5QA 5EG0A 2DTRA 4P9IA 1NQJA 1TWAJ 4MGIE 1E0EA 3DECA 3ZXGA 3T09A 1UHMA 4UF0B 3F8MA 5ICEA 4XF4A 1ZBA3 1W3VA 4YVSB 3JSPA 2PHXA 1LKNA 4Q0UA 3ALQA 2QBXA 2UWMA 1QQIA 3HL2A 2WAOA 1J9IA 5D8AA 2R4GA 3TN91 2GXAA 5BNNC 1FZPB 1W0UA 2QKDA 2LP0A 2JDZA 1V9U3 1R091 1Z67A 5A1FA 1IG0A 2VQAA 1YUDA 2WN3A 2W08A 4IEPA 1UZVA 5EZWA 4TLFA 2JG8A 4XPVA 4URAA 1YFUA 1GZWA 4WK8F 4G7OF 2OCEA 4S05A 2ZFWA 4K20A 1OR7C 3RJ2X 1TEIA 4A3XA 1WMEA 2CFXA 3RMXA 4IXLA 2O7OA 3WNLA 1AR82 4WM8A 2VUJA 3IKTA 2M34A 4H7LA 5FZIA 3EB7A 5CIRA 5HV0A 1RUH3 3G73A 4RFRB 1R9TJ 3K69A 5HOOA 3TYJA 3CQOA 4BQ5A 3FXOA 2H94A 4GWNA 3PNAA 4XW3A 5DAQA 4MGQA 1H2NA 3S2WA 4LKDA 4LBMA 2DA1A 5A7OA 1VBB1 1JMUB 4FE7A 5ABJC 3V0BA 2Q8DA 2B9VA 2W68A 5LA2A 3TDUC 4WXHA 2DU0A 3JBG1 4ZZLA 4CP9A 3ILNA 5HVQC 4DY3A 4PJYA 2FCTA 2OZUA 4DFSA 2F4OB 1RESA 5FY5A 2GNMA 2C5DA 3MFCA 4OQ8A 3VL8A 4YRDA 1ACCA 3BCWA 1FMWA 2GZWA 2DU1A 3V42A 4XZPA 3HUGB 1MJBA 2Z9OA 3F2ZA 2X09A 5C9AB 1K5MA 2AACA 3U37A 4XJUA 4ZU5A 1AWCA 5APAA 4LMFA 4RYDA 1VQKI 3DFGA 1GOHA 1O3RA 4YZ2A 2OQGA 3N9PA 3SCFA 1J09A 4GYGA 2FNPA 1REDA 4E7SA 2C26A 1UYYA 4FPJA 5IT3A 3WTYC 4CYDA 3RG0A 2PMZA 1OC1A 4M6YA 3CCYA 5F04A 4KT5C 2P4EA 1JHFA 5DAVA 3KB5A 3IKVA 4EQQA 3ZOBA 1N75A 2V79A 2XBO2 3PTRB 1Q8OA 4MG2A 3HD8B 4QXKA 1FATA 1UKGA 5ICFA 2M0CA 3DTEA 1RUF3 1WLWA 1MS3A 1LFBA 5E1XA 1SLBA 1MZ5A 3PTYA 1UMQA 2Z4FA 2WZR1 3I3BA 1ZZ6A 4BU2A 2X0LA 2D3PA 1YO8A 2P5BA 1VP6A 3GZUC 2A61A 1SANA 3WHBA 2AO9A 2FA5A 3L1PA 1ETXA 2L9SA 2W0XA 3AZYA 5I93A 2Y31A 4PJJA 2XAGA 1SBEA 3CLPA 2GAUA 3VYRB 1YQ8A 2ZHNA 5CKTA 3OYDA 3THPA 1YYNA 1QH6A 3ZYFA 4CE8A 2E36A 4XUPA 4PSWA 4XXAA 4L9VA 3CCLI 3JSOA 3S6PA 1SLTA 3AMMA 5FZ7A 3SYTA 1AJKA 3DEEA 5FO9B 3ST7A 5EGOB 5A70A 1AL22 1O4TA 2X1DA 4Z92B 1TQMA 4Q4W1