4N9HA

Crystal structure of transcription regulation protein crp
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
201
structure length
201
Chain Sequence
PTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Structures of inactive CRP species reveal the atomic details of the allosteric transition that discriminates cyclic nucleotide second messengers.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
total genus 55
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4n9hA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4n9hA01
1R1VA 4HYEA 2DPDA 2HQRA 1J5YA 2P4WA 1Y0UA 4P5OA 3HSRA 4KT5C 4BQAA 4RD7A 5ICEA 5CVVA 1FSEA 4R52A 3ZMUA 2KIFA 5L3FA 2NS0A 2A6EF 4O9GA 2VN2A 2V79A 2XAFA 5IT9K 4K8FA 3QU3A 3JAMZ 3D0JA 3T8RA 4AQ2A 1IN6A 5A2QK 2LDUA 3TOAA 5DYMA 3SHRA 2IJLA 1EH6A 2NRAC 3W6KB 5JSOA 1KU7A 3EYIA 3IKVA 2A3SA 5E20A 3RYRA 3GYHX 3R0AA 2KJCA 4R8HA 3IDBB 3H92A 5K5OA 3PQKA 2KXLA 5DCFA 2CYYA 3KP7A 1FBUA 1LR5A 3EUHA 2LSOA 1YYVA 1JE8A 5D1IA 3QPTA 1VTNC 4LG0B 2EA4A 4PIYA 5KK1A 4RGSA 3JW4A 1S8NA 1XB4A 2ESHA 3LQQA 4ESBA 5HDKA 1XDUA 1LB2A 4A5NA 1G4DA 5A2QZ 1FBSA 5BPIA 2ETHA 4Q5SF 4PDKA 1IN8A 1J59A 5L3DA 3V7RA 4KICA 4TLFA 1XRUA 1JXSA 2DFIA 1BBYA 4BAYA 4YIFA 4IHTA 5I91A 1J0RA 3GWZA 1ZLKA 4Y17A 4YFXF 3O3KA 3QP5A 4ENNA 5FLIA 2PN6A 1H0MA 4E2QA 2H94A 1LKNA 4HV5A 1XGSA 4IVNA 1WA4A 2VBYA 3BP8A 5DCMA 4UNOA 1X8EA 2PBIA 3WGGA 2H27A 5F64A 4JTOA 2EFOA 4HX8A 2EFPA 4XFBA 3QACA 2TDXA 4AVBA 2JRTA 2ISYA 1SMYF 1YLFA 3WTUC 2KRFA 1XSVA 5TRDA 5ILUA 2HYGD 4F7ZA 1SD4A 3TO6A 1CX4A 4LLGF 3KP5A 2E9QA 1ZVFA 5FPXA 5LHGA 3F23A 5H6QA 4EWDA 1Y9QA 1W7PD 2GC2A 1YFUA 2VE9A 1B6AA 1BOAA 2Y75A 4UV8A 3FWEA 3N97A 3I53A 3QP6A 1FX7A 1HBXG 3LA3A 1Z6TA 2DU9A 3I71A 4LK1F 1X82A 2CO5A 3HOSA 3O14A 1ZH5A 4PGGA 2ZNYA 4FX0A 1D5VA 1FLIA 3KLNA 2K0GA 4AD9A 2D1HA 2WTEA 4LLOA 2IXCA 4WZCA 3HOTA 1PMIA 2YX7A 2RGVA 4HN0A 2G7HA 2XV4S 3MFKA 1I1GA 2HOEA 3P7NA 1YO5C 2L01A 1Z6RA 1DPRA 3RIRA 3F21A 2UY9A 1WKMA 4BXUA 5K5RA 3I0TA 1BC8C 1YW9A 5D4RA 1I6XA 2Q2EA 2OAZA 1WRJA 2P5KA 4CGZA 3CUQA 3DF8A 3IRQA 5CLSA 4D7SA 1LQ1A 3BROA 3IIAA 1ZLJA 1IN7A 3R4KA 3DQVC 2D5FA 2GA1A 4YRDA 1FI2A 2DW4A 5FQ0B 2JTVA 1ULYA 3P9IA 4KUMA 2ET7A 4ZZDA 3LZZA 4WVZA 2A07F 2HGCA 2ISZA 1HSJA 2MHFA 3U11A 1K6OA 1Z7UA 2A6HF 4HF1A 4MNUA 4Y15A 2HFHA 3E6DA 2FQ3A 4ASNA 3H1MA 3U2RA 1TQ5A 3MQ0A 4U0VA 3CF6E 1BJAA 2KJBA 2UYBA 3M8FA 4LFUA 4A12A 5DDGA 4LULA 3SCFA 4QM9A 1H9TA 1YFXA 1EPZA 1R58A 1K78A 2DO7A 3CEWA 1BIBA 3ELKA 2EA2A 4M72A 3ES1A 1XCVA 1YQAA 4KFCA 3IC7A 3GYDA 3Q9VA 4G6DA 4S04A 1W5TA 2DQRA 3FHZA 4RGXA 1H1MA 2OYZA 5JR3A 3BOQA 1UHWA 3HYIA 4JBAA 5JCTA 2NYXA 1YG2A 2FEZA 1G6NA 3HSFA 3C7JA 3C1DA 3I59B 3OF1A 2V6CA 4HW0A 3E5QA 3NEUA 1PDNC 5LRRA 2D45A 4KMUX 1CAWB 1UHMA 2FOKA 1D8JA 2IPQX 3HRUA 4IEVA 3J81K 3OV8A 4META 3S7EA 4Q47A 2GAUA 1FNNA 3Q5FA 2CAVA 3H7JA 3F8MA 4MGRA 4DQ2A 4GULA 4LEJA 2IXIA 3CJXA 2GC1A 2GZWA 4FBFA 3U9GA 3B02A 5D5VB 2QVSB 4XFGA 1XN7A 3K0LA 2VODA 3LSTA 4RGUA 1USSA 4I3PA 3KP6A 4IESA 1BI1A 1YW8A 1TW2A 1IXRC 3HTSB 4UVCA 3I7DA 3F72A 3MZHA 4P9GA 5I0UA 2VECA 5JFRA 2KIUA 4OIRF 2B5HA 1X3UA 1S3JA 2DK5A 2YSRA 1J9IA 4B29A 3MDPA 4Q48A 2MD5A 5J6XA 3EJKA 1B59A 2ACJA 2LF7A 4MTEA 1TQIA 1GVJA 4J1WA 4L9JA 3ULQB 2P5LC 2KIMA 2VQAA 1EYBA 1LRHA 3GXOA 3K1MA 4PGHA 1E2XA 5HVQC 4HBLA 2FE3A 2HR3A 4ESJA 3HHHA 4XF0A 5F6FA 4KDPA 4AIKA 2Z33A 1KYZA 2HQNA 2FRHA 4MTDA 3SFZA 2GWRA 1LDJA 1WSUA 4XBFA 2IT0A 4PCQA 5D5UB 2DCTA 3BCWA 4KWJA 5KVRA 3V8LA 2XLGA 3WGHA 2CAUA 1ZARA 3TO7A 2F5CA 3HRSA 3F6VA 1HW2A 4LD5A 4I0BA 3M1EA 3I64A 3DPTA 5DUIA 4ZZLA 2ZKZA 2YX4A 2D93A 5FGMA 3KSCA 2QBYB 1Q5OA 4KYWA 1LEAA 3JTHA 4N9HA 4ZH4F 4G94A 4OIPF 3G73A 5LEKA 1KU3A 2WFPA 4FHTA 1O5UA 4UXNA 3ETQA 4WF2A 1YLLA 3T8TA 3M7GA 2M87A 4Q0UA 4YG2F 2O0YA 4LUKA 2EFNA 3HT1A 1CAUB 3WTYC 1SAXA 3WW1A 2W24A 3CL1A 1XE8A 1CF7B 2O03A 2R7FA 1MJ9A 3FFQA 3V8JA 4FAHA 1Z1DA 4R79A 4HLYA 2HS5A 2ZMEA 2BV6A 2CQKA 3MPBA 2RNJA 2UYAA 3BDDA 3M8EA 3ZDSA 1LEBA 4XSXF 5AONA 2XROA 2EV0A 3GUDA 5K8SA 3CO7C 3UKNA 1STZA 4M73A 4MHGA 4I2OA 2C6YA 4P9FA 1NZCA 3D0SA 4HQMA 4BNCA 2OA2A 3K69A 3I58A 1MZBA 2L3DA 2RDPA 4U0YA 1U6GA 3GFIA 3ZN1A 4BHBA 1HW1A 3ECHA 1ZZCA 4IJAA 4IEYA 3DFGA 3H3ZA 3SMHA 2R7DA 2NAZA 2EV6A 1A04A 4MX3A 5CYVA 5E8IA 1PP8F 2GC0A 1FYLA 1AOYA 1RI7A 3BU7A 1WLTA 3NJZA 2JZYA 5HDGA 3WTSC 2W25A 3AAFA 1Y3TA 4AIJA 4LA3A 1ZAOA 3TOBA 4HVOA 1FYMA 5CU1A 1B1BA 4Q0PA 3ML6A 1U12A 4UBHA 1XSDA 5FLXK 3E97A 4P9UA 3WU0A 3S0MA 3D82A 5FFZA 5ICCA 4XFFA 4MGKE 4EWEA 3E6BA 2CFXA 2ZCWA 3RI4A 4KIBA 2VXZA 4Z2YA 5I93A 3H7YA 4L0YB 1HKTA 1QWRA 4PJYA 2OU2A 2L4AA 2O6GE 5KHKA 2LKPA 1NE6A 4L5IA 2MNGA 3JAMK 1X7NA 1R7JA 3CDHA 3GLXA 5I0TA 4CICA 2COMA 5CVUA 5HLIA 5BMZA 5AIQA 2UXNA 5BOXA 5BXXA 4CHUA 5E1ZB 2JT1A 2PQQA 3HHGA 3KFWX 1ON2A 4WWCA 1LJ9A 2ZNZA 3UKVA 2QYOA 3U0ZA 1YS6A 2HJIA 5FLXZ 3WODF 1IPKA 1IXCA 3FM5A 3NRVA 1L3JA 3ZN0A 2BGCA 4XFCA 5DD8A 2A69F 1MDMA 3IHUA 4JQFA 5FD5A 3ECOA 5E18F 5HI0A 3RKYA 4IEPA 3BJ6A 5KHIA 1TTYA 1GQHA 3VODA 4XF3A 3CO6C 2F4PA 4IEQA 4AVPA 1IW7F 3RPQA 1TLHB 1HXDA 2CW0F 4ZYDA 2IA1A 4MUVA 3O2PE 5HOOA 3ZPLA 4LTAA 1FSHA 1FWZA 3CJNA 4X6RB 3MEXA 2MA3A 2HZTA 4LA2A 1XMKA 2VBWA 3WTVC 4U7BA 5CVIA 3IRRA 1CAVB 4IRGA 2STWA 4X6QB 5D6EA 1IPJA 2OZ6A 1SFNA 1U78A 3RYKA 2OD5A 4NQWA 5D5XB 1R36A 2XLFA 5C6CA 1F1ZA 4AVCA 5I8YA 3VB2A 5BUVA 4ENMA 1NXMA 2ZKLA 2UY8A 3KP2A 4XF4A 4ZU5A 4GYIA 3FXRA 1WI9A 1XSXA 3LAGA 3OTFA 2M5WA 3FJSA 1PUEE 1RIOH 1QO0D 4HV6A 1V4RA 4WX9A 3I4PA 1O57A 5LBQA 3LWCA 4XF1A 3R61A 5J7MA 2PAKA 4AXOA 1GXPA 3TO9A 1U5TC 1ZZBA 2B0LA 2OZJA 1ZN2A 3ZMVA 4IPAA 2VT3A 1RNLA 1R5GA 3CUQB 4D0PA 5LLQA 4A0XA 3ZQ7A 3JSOA 1D3YA 4MQ9F 4GYGA 4PIZA 2HYFA 4M74A 5BQTA 2PA7A 5JI6A 3ZMTA 4O9EA 2MPFA 3OGJA 5CVJA 1YFWA 1MJBA 4RGRA 2UXXA 5LEJA 3KZZA 3J80Z 1SFUA 3K1NA 1QZZA 2X4HA 1GXQA 1R00A 1G3TA 1KU9A 1G3YA 5E1RA 2EVXA 2Z5UA 1LVAA 4HZFA 1T98A 3BPXA 4G7HF 2G9WA 3BPZA 2RKHA 4DNCA 1RZ4A 1IN5A 4I0AA 1REPC 4IRIA 2D1VA 1ZNPA 1UW8A 1K78B 1P2FA 1FY7A 2OQGA 4RS8A 1QXJA 3FXQA 2EK5A 3K9TA 3IWZA 4P96A 5L3BA 2PQ8A 3V8KA 1ZRDA 3F8NA 2VOPA 3SCHA 3CO2A 1LDDA 1OYYA 1T0FA 4XLNF 1UCRA 3TDZC 4HMZA 2L02A 3WTWC 1OI6A 2FNAA 4IEWA 2D5HA 1W7PB 2PFWA 3QPHA 1OYWA 4N0BA 3IKTA 2OPKA 2RVCA 5FFXA 5HDNA 5JSRA 1AWCA 2MH2A 1O3QA 2RV8A 3GX4X 4O3MA 4I01A 5E17F 3H1WA 4O5VA 4FX4A 3M9AA 1XMAA 5FCCA 1IXSB 2FSWA 3KLOA 4EJOA 4TV7A 2GQQA 3O6BB 3QOPA 3C3WA 4HF2A 1WWXA 3USSA 4YARA 5FLJA 4RAYA 3EETA 3V7CA 1JHHA 1KQ9A 4YIIA 5LGTA 5KHHA 3E6CC 4QGLA 3I54A 4HX4A 3JSPA 4IEUA 3KZYA 4EJTA 2XAQA 5I0SA 5D8KB 5BY5A 2XAHA 2XHKA 3GZ5A 3GVAA 1RGSA 3KP3A 4U88A 3T0YA 3TDUC 1QZYA 1IF1A 2BNNA 1ZGJA 3DPLC 3GFMA 5D6FA 3V4GA 3ABTA 3SHFA 5E8GA 1CAXB 2QCSB 4XSZF 3TQNA 1FYKA 5JAXA 2ELHA 2ZXJA 2O61A 5HS7A 5JR7B 2M45A 5ERIA 4U0WA 3J7AO 4EGYA 1SMTA 4U7DA 2FXAA 5FDBA 1O5LA 1ZGAA 4CXFA 4O6JA 2F5DA 2EB7A 2IA2A 1YHFA 1MJAA 3L9FA 3F8BA 1QPMA 1S7OA 3EDPA 1MGTA 2VC0A 4JK1X 3H9AA 5BS6A 4OMZA 1L0OC 1KU2A 4XFAA 4HDVA 5D5WB 1EP0A 1F5TA 1HW5A 3H3UA 2L4MA 2FBIA 5DV5A 2F5EA 2CV6A 3DN7A 4ONUA 3GF2A 2IXLA 3HRTA 1ZREA 1B9NA 4BHCA 1ZRFA 2VC1A 5I8SA 2BE5F 3NQOA 2I45A 2FBKA 2MLKA 4A2UA 2K02A 4E2GA 1ZRRA 2Q0OA 4QGNA 1HKSA 1LDKB 1RC6A 2BYVE 2V9VA 4MH0E 4UVAA 2HDCA 2HTSA 1MKMA 4HLXA 1ZZ6A 1ZX5A 1EY2A 5C8WA 1O4TA 5HLGA 5LGUA 3R6SA 1HQCA 1O7LA 4JTNA 4A6DA 4HN1A 1ZG1A 2LF8A 3VEPA 2ZMEB 2J5OA 4Z07A 2AXLA 3KEOA 4M9SA 4LB5A 1P4WA 1FOKA 4Q0QA 4EMSA 3FF5A 1OPCA 3L00A 3HIFA 2UZKA 1FPQA 2NNYA 1R23A 3CTAA 3NKTA 4I98B 2OBPA 3L7WA 3OOPA 4NHJA 1TBXA 4LJZF 1IRGA 4KU7A 2R3SA 5I8TA 2EWNA 1ZG5A 1CAWA 3BWGA 2XGXA 3WGIA 2P7VB 3SCGA 2MH9A 1Z05A 2GC3A 4KMFA 3PQJA 3NW4A 4I09A 4L5JA 2QQBA 1RUOA 5ICFA 4L9VA 2OZUA 2QUFA 1DZRA 3E5UA 2EV5A 3KGLA 4IEXA 2QVOA 3E3VA 3EHKA 4H0EA 5IT3A 1S6LA 4BYYA 2Z3YA 4ZU7A 3EQLF 2XL9A 4ON0A 5F1RA 2QJVA 3F8CA 5E1WA 3PFIA 1T2KA 4UV9A 3RPUA 1DGWA 4I7HA 3NL1A 4CDGA 1UFMA 3ELNA 1Q43A 4N9IA 1D8KA 3S2WA 2XAJA 3FX3A 3IBMA 4RB3C 4LLNA 1QNTA 2PEXA 4ZU4A 2PG4A 2FQPA 4XF9A 2A5YB 2XAGA 3SZPA 6PAXA 1BI3A 1S29A 4XEZA 1X8MA 3K1PA 4L9TA 5HS9A 4BH9A 3GEZA 4HAMA 2IXJA 1HKQA 4ORFA 2F2EA 3MAJA 1IUYA 4MZUA 1V70A 1Q3EA 4YFKF 4MGIE 4HSJA 2JPCA 2H09A 2IP2A 1OKRA 4JV4A 4CYDA 1O3RA 1QGPA 3W6JB 4WK8F 2XKOA 5ICGA 3ABUA 1FZPB 3K2ZA 3LAPA 4DINB 1PP7U 1ZYRF 1R1TA 3RKWA 1U3EM 3RNSA 5CJ9A 1SD6A 5CVRA 2EAAA 1VJ2A 2P8TA 4PZJA 3KETA 1E17A 3RJPA 3DXJF 1OYIA 5HLHA 1ZRCA 3L09A 1L3LA 3S7IA 2Y0OA 4IRHA 4ETSA 2P6SA 2VBXA 1O7FA 4L9NA 2A68F 2VT2A 1CF7A 4L11A 5FB2A 2W84A 4GO1A 1ZZ7A 1DDNA 2VOOA 1YWKA 3PLQA 3REOA 3RKXA 2PHDA 4UVBA 4Q29A 2IVMA 3RZZA 4S05A 4KA4A 3GFLA 2IRFG 4B09A 1J2XA 1FC3A 1XGOA 1U5TA 2FMYA 4PIXA 1OFNA 4EQQA 4QMAA 3SQNA 3WU1B 2K4BA 1I27A 4XFHA 4E70A 4MEYF 4HSLA 4HVQA 2ET1A 1W4MA 4G7OF 1EH7A 1YW7A 2WV0A 4WXCA 2JPBA 1FP2A 5D8LB 1UCXA 3RDIA 2IC1A 2PYTA 3KGZA 3LFKA 5DCMB 3WW4A 3H8UA 4AWXB 3MWMA 2PTMA 4HX7A 2Q4SA 4OIOF 1ZHFA 4LMYA 1BI2A 1SQ4A 5L3CA 3HTUA 5JVTA 4BIFA 1NE4A 4EGZA 1OR7A 1ZZ8A 3DL3A 2M1BA 2CWEA 2D2WA 1DUXC 4YFNF 3BPVA 3LWFA 1R1UA 1CGPA 3QRFF 4Z82A 3E5XA 4CO8A 3PNAA 1MD0A 2Z99A 4LUMA 2QQAA 3EBRA 2QDRA 1U2WA 2EFWA 1XGNA 4UUVA 3VOEA 3R60A 5DUKA 2QENA 3TNPB 2FNPA 1SEFA 3EYYA 4L0ZB 4OLLA 3FZVA 3HT2A 1OMIA 2V1DA 2V1UA 5ILSA 2EA7A 3VFZA 2DQLA 5IT9Z 4FT8A 2GH2A 1R5HA 3C18A 5LGNA 2FA5A 2YR2A 2L54A 3LA7A 2O1QA 2DT5A 3J80K 4WBBA 3MCZA 2H0VA 3PVBB 2GU9A 1J58A 3E6MA 4YNIA 3FHIB 1U8RA 1UB9A 5JHUA 1XD7A 3F8FA 3IDCB 2DAOA 4A6EA 4M71A 4OFGA 4QWQA 2ETEA 4G7ZF 1H1IA 2DTRA 3V7SA 1ON1A 2RN7A 3BALA 4IXAA 4RB0A 1TNSA 4YYOA 2WWYA 1T39A 4L18B 2V09A 3CLOA 2P6TA 5K5QA 1DGRA 5KHGA 3JTGA 5BPDA 2STTA 4EJUA 4KIFA 3WTZA 3HQXA 4MGZE 3F6OA 4M6XA 1XDSA 2PFBA 2ZBKA 1Q1HA 1ZZ9A 4ENJA 1JGSA 2QWWA 3GO5A 2XL7A 1KYWA 2VONA 3Q9SA 2QLZA 1CAVA 4J1XA 4IHSA 1KGSA 4LG0A 1OD5A 1QBJA 4L2NA 3FMSA 2H6BA 3IL2A 4EJWA 2E7XA 4Y13A 1ONVA 1TQPA 1IZ1A 1T6SA 2K9ZA 2AS5F 3ERED 2A61A 1YTYA 4M6YA 3FXUA 2E1CA 2ADUA 3WTTC 2WC2A 1S7AA 4HBNA 1XE7A 1G3SA 3QU6A 2DPUA 3P9CA 2M8EA 2D40A 4KNYA 1QXRA 3DEUA 4M9XA 1RUNA 3GBFA 3T5XA 1EV7A 4AVAA 3I5UA 2LNBA 3ST7A 4EJVA 4WXDA 5DEQA 4OOIA 2Q0AA 1B9MA 2VBZA 2O3FA 4LB6B 2W85A 4LGWA 1DP7P 3TNQA 3WE3A 4HQEA 1EH8A 2O8XA 2QQ9A 4R1HA 1VP6A 1SD5A 4KU8A 3BB6A 3EO6A 2GXBA 3ACLA 3ES4A 4GXOA 2XUBA 1K79A 4A5MA 2ZFWA 1WQ2A 1FBQA 5KBFA 1HSTA 3LA2A 3GFJA 1TNTA 2KKOA 1RTVA 1GQGA 5CADA 3H1YA 2Q8KA 1G3WA 2MLGA 1IAWA 4HDUA 4EV0A 1FP1D 3G3ZA 2M30A 1IN4A 3BZ6A 4ZYEA 4A0YA 3KE2A 2EJRA 2FMLA 2GIVA 1FT9A 3KP4A 3H50A 3NVCA 1UPIA 1KQ0A 3F22A 1GHCA 2G7UA 4KWLA 1JHFA 5J8FA 5H6RA 5EEGA 1P6RA 3DKWA 2YPRA 1R22A 3KCCA 4K2EA 3LOIA 3RYPA 3BY6A 2IXKA 2ZO4A 3ZMZA 1LNWA 3JZVA 1FXZA 4D7TA 4E2SA 2BNOA 1BN5A 5D4SA 3FMRA 5ILVA 5ED4A 3BJAA 3HSEA 1TQMA 2B9UA 2NNNA 4KL1A 4WCGA 1SFXA 1W5SA 2ESNA 4OU0A 1B4AA 2F5FA 2VE8A 5J8CA 1J75A 2PJPA 2PMHA 2XRNA 4MEXF 3FZ3A 4YSFA 2P17A 2MBFA 2W57A 3WW2A 1W7PA 2FBHA 2Z9OA 4KN4X 3FE5A 3M70A 3ZP5A 1BI0A 3OCPA 5FQ0A 1DZTA 5FLHA 4OIQF 3CUQC 3SXYA 4MQVA 5LRSA 3KMHA 4KWKA 3D5LA 2E1NA 1XGMA 3WW3A 1QQIA 4IETA 4Q0VA 2K27A 4ZYGA 5AVPA 3DP7A 2HKXA 1O3TA 2GA2A 1F4KA 5K1YA 5EZWA 4UXAA 1SD7A 2HTJA 1P4XA 2CGPA 2Q30A 4MGYE 5T3NA 2PI0A 4GCVA 2DLLA 3FMQA 3B73A 3ZMSA 3MZYA 2XIGA 3BJOA 1ODDA 4HF0A 3HRMA 4I02A 2Q1ZB 2FU4A 4Q4ZF 4QM8A 4G8XA 3J81Z 2CSOA 2UWMA 3RTRA 3LAJA 2K4JA 1NYWA 4AQ6A 4EM1A 1YIOA 2GXGA 3IWFA 5DD4A 5FPZA 3CUOA 4BHPA 1CAXA 2DBBA 4JVAA 3I59A 2QM3A 5AIPA 2PLYA 2Y48A 2K86A 2Y0MA 3WE2A 4FAGA 3R0JA 2CG4A 5J48A 1J3QA 4XETA 2OA4A 3F3XA 2HWVA 1TW3A 2Z69A 3OD0A 3L2CA 4QX5A 3U1DA 2XKPA 1O3SA 4XFIA 5LHIA 1DPUA 3LQRA 3TGNA 3U10A 4XLPF 2PAEA 3SXWA 5JSPA 2RC4A 5LHHA 1UD1A 1IRFA 1C0WA 4A0ZA 4NVPA 3UKTA 3EQEA 4EWAA 3GW2A 1YFYA 5KHJA 1JUHA 2OQRA 2HEOA 2QZ8A 4KN7X 2BEOA 4QXKA 2HKOA 2K7LA 4Q0SA 2DI3A 2ATFA 1H9GA 1ZG3A 1QY4A 2P7CB 1XCBA 3N4MA 4HA8A 5L3GA 2RQPA 5FO5A 1J7KA 5E16A 4H7LA 2IW5A 1USTA 2XLAA 1BC7C 2XVCA 4IF4A 4RAZA 4EM2A 4QGMA 3SZTA 2ZJ2A 5L3EA 4G6QA 4IEOA 4M9ZA 5FD6A 3GZ6A 4RB1A 4HOBA 4WXHA 2PMUA 3WG9A 2FF4A 1F9NA 4UHTA 3WTXC 1I1SA 1I5ZA 2IA0A 1U5TB 4HLTA 1BM9A 4IERA 4P55A 1KQ8A 1UIKA 1P4AA 2C0ZA 2H6CA 1MDMB 2V1XA 2E7WA 2X0LA 1P92A 1RL3A 3VHRA 2XASA 4EROA 3KEQA 1J3RA 4CZZA 5J3UA 3CLPA 4MV2A 4KIGA 1J3PA 1PM7A 4HVRA 2YU3A 2BBYA 4EVIA 4LLLA 5I0RA 4OMYA 5BV6A 2EFQA 5HS8A 1J1LA 5E1XA 2J5PA 5EEHA 3TKYA 4ZYHA 4IEZA 4F8AA 2QBYA 1UIJA 3ISPA 5EFUA 2BNMA 2MC3A 3HUGA 3FM3A 1YS7A 1K7AA 2VPVA 2O8QA 3C3VA 3NSTA 2Z2SB 3MYXA 1T38A 3M3IA 2B8MA 1YFHA 4G9YA 1Z9CA 2P5VA 3P9KA 1CAUA 2IXHA 3COAC 4B8XA 2DK8A 4OINF 4QLCU 3QAHA 1Z91A 4GGGA 5TJJA 4XRFA 4EM0B 1V3FA 4NB5A 2PAMA 2QNKA 2JSCA 3ZMDA 4ESFA 2N7GA 4UBGA 2PHLA 4AIHA 4ENKA 5BPXA 1SFEA 1VR3A 1BIAA 3G7DA 1WGPA 3DV8A 4RB2C 3ROUA 5H20A 1KA8A 3T1BA 1YUDA 3L2HA 1NHAA 4LK0F
chains in the Genus database with same CATH superfamily
3QODA 1J5YA 3WG3A 1Y0UA 1JYTA 3HSRA 4KT5C 4RD7A 4IOCF 2GXAA 3S1QJ 1X1CA 2P4EA 2KIFA 4UFJA 1ZBA3 5DTDA 2NS0A 1GYKA 1FOYA 3MIGA 1NG6A 3H36A 1UU4A 3B93A 5A70A 1EA3A 3D0JA 3T8RA 2VL4A 4AQ2A 3TOAA 1FIPA 2HVQA 1U0JA 3PJQA 2ZXIA 2HH9A 3Q8EA 5J37A 1F36A 5EHDA 3OYNA 3AFGA 1HB3A 2A3SA 3GYHX 2QEXI 2DBIA 5DMYA 4R8HA 2WBMA 3G6JB 4WVVA 3H92A 3CF5F 1AZDA 4GMP3 1RUH3 4KISA 3LOBA 1RVF1 1JTYA 4L5EA 1LR5A 5FZ8A 4UW6A 1XB4A 1N1VA 1R092 5HDKA 3GNEA 5JVVA 1VRH2 1QJX2 4YRVA 1FBSA 1SLLA 3RJ2X 3O1VA 2W95A 4BK5A 2ETHA 3MF9A 3KV9A 5M5XJ 2WZR3 4TLFA 3EUKL 2VPLA 2FDKA 1HN1A 5C3EJ 4FE7A 1J0RA 1RIRA 3KQ4B 3GWZA 1ZLKA 1S0EA 4YFXF 5C4JJ 4BY7J 1OC1A 4FPGA 2PN6A 2V26A 5CKNA 3B6AA 5K7PA 2KA3A 3H0DA 1PVXA 1HN0A 1WA4A 2VBYA 2RS33 1TL8A 3M2MA 2VIXA 4UNOA 1X1AA 2LP0A 2PBIA 3WGGA 5F64A 4B1MA 4JTOA 1LU2A 4XFBA 2ICWG 3RI8A 2TDXA 3FDYA 2D43A 1SMYF 4CDXA 4LLGF 3UYJA 3ZYGA 3HGGA 4YVSC 4Q8LA 5H6QA 3QH6A 3WDXA 3DEWA 1HQLA 1Y9QA 1H8AC 3AKQA 5HODA 4UV8A 3CKHA 3B5LB 1ND2A 1OCZH 3NJYA 3I53A 4MLOA 1U9OA 1QJU3 1D5YA 2A6XA 3LA3A 4MGQA 4DUXA 2CO5A 3A0HC 5HV4A 2TNFA 1BMV2 3I8TA 4FX0A 1D5VA 3LMMA 4AD9A 4LLOA 2YX7A 1BKZA 1JYCA 4BXFA 2XV4S 3WD5A 1I1GA 2HOEA 2R041 1PIV1 5C4XJ 2V4AA 4TN7A 1WHUA 3AK0A 1DPRA 5J1UA 2R7XA 4PJ0C 1CX1A 2R7RA 5CKQA 2VQCA 5FO7B 4BEHB 1CJDA 1OUXA 2UY9A 4IDZA 2CU7A 1AYN3 4A6SA 2YV8A 4BXUA 3HNBM 3IIIA 4BQ3A 1B72A 4H7MA 1YW9A 4V2GA 2Q8CA 2EAKA 3GLLA 4RBOA 2P34A 1W39A 3BUCA 2HWF1 3ABZA 4IEJA 3FLTA 2BRTA 2QDNA 2ZS6B 1AJOA 2GA1A 2RDNA 1WJCA 1QJY3 1FI2A 4AVSA 1K5JA 5FQ0B 3MKZA 3KYLA 2NVXJ 2ET7A 4E7KA 3LZZA 1GKBA 2ISZA 2HBUA 2WZPP 2XBO3 1V6KA 4YVWB 1Z7UA 3VBHB 4MNUA 4Y15A 4V2WA 4CYCB 2KL4A 3BG9A 3H1MA 2NLRA 1AYM3 3VKNA 4U0VA 4RFRB 4BE2A 3WDVA 1NY71 4XLAA 2KJBA 2BOJA 3RWKX 1A6CA 4LULA 4YZ4A 4QM9A 3T2PA 3RZOJ 1LJ7A 4BWOA 3I3EA 1K78A 1TME2 1BIBA 2W94A 1R1A3 1QVUA 4DYQA 2DQRA 5GTHC 2OYZA 4JBAA 2NYXA 2WN2A 4Y20B 1GZTA 3HSFA 3C7JA 4DMIA 1YIPA 4HW0A 4QXHA 2CRGA 4EJRA 4KMUX 3ASOH 1CAWB 1PO23 3BTAA 5T50A 4AEDB 1WJDA 3CP2A 1JU3A 1S0GA 3OUJA 2VMGA 4DQ2A 4GULA 1JYVA 1K5MB 1FPN2 4AEJA 1SACA 3AM2A 4FBFA 3IH3A 1W99A 2QQ8A 2X09A 3S5QA 4CCJA 4XFGA 1JJ6C 1H8TC 1RVF2 4CDUB 3LSTA 1RUJ1 4RGUA 1USSA 3KP6A 4OHWA 3NWKA 4A7KA 1TW2A 1UX7A 4QQHA 2GN7A 3FUQA 3QCWA 1X33A 3MZHA 4P9GA 1AU7A 2KIUA 4GIQA 1X3UA 4RR3A 1S3JA 2NXNB 4Q48A 1Z7S3 3EJKA 2CNAA 1WUVA 2ACJA 4BQOA 1TQIA 4CEWB 1X1DA 1GVJA 4A3FJ 4AF9A 4XONA 2QKDA 5CFCB 3AJZA 1EYBA 1H6YA 1LRHA 3RZDJ 3K1MA 3ZFGA 3B00A 5HVQC 2XF5A 4P9YA 4ESJA 4KDPA 3ENRA 4M00A 4MTDA 5EWSA 4YW3A 2GWRA 1WSUA 3BCWA 1Y8QB 3S2HJ 4DXRA 1JZ6A 3KS7A 2DTWA 3TO7A 2F5CA 3PVOA 3P5BA 2WQ8A 2GOXB 4LD5A 2VNRA 2QQIA 1NQDA 2ME6A 5DM6F 4ZZLA 3ZGKA 4P9IA 2YX4A 2B4KA 3V42A 4XM3A 3JBG3 4F92B 1H4HA 2XB0X 4N9HA 3O0XA 3MKWB 4ZH4F 3K4BA 2JDPA 3F9KA 2WFPA 1YLLA 1YOVB 3T8TA 3BG7A 1BEV1 2O0YA 5LB6A 3Q8FA 3WTYC 1UL9A 2W24A 3K77A 3N3HA 3U78A 1BXHA 1ZR4A 3HOYJ 3OPZA 2R042 1Z1DA 4HLYA 1IG3A 2A5ZA 1MBGA 1SCSA 3MPBA 3M8EA 1LEBA 2EV0A 3CO7C 3IAPA 4JRLA 1STZA 2NVQJ 4CPBA 5F27A 4P9FA 3WSOA 3D0SA 4HQMA 2X5IC 4BNCA 2L3DA 2A3YA 4U0YA 1GNYA 4CUBA 2BWCA 3TN92 2OJED 4W8JA 4XJ8A 3ZLIA 3BQYA 3ZSMA 1JYIA 3LE0A 5GLTA 2EV6A 1A04A 1XNBA 3UK9A 4FPFA 3IT8A 1FYLA 3L2WA 5B3SH 2JZYA 3WTSC 1R64A 1US2A 4LA3A 3ZQIA 5A1LA 3TOBA 4IGPA 3K4ZA 1JJ8C 3AP4A 1U12A 5L19A 5FLXK 3AMHA 3AZXA 3E97A 4P9UA 3WU0A 3BKZA 1XSRA 4XFFA 3E6BA 3HN1A 1NY72 2DCJA 4L0YB 1HKTA 5C7GA 2OU2A 4QPWA 1H9PA 1OFSA 1Z3YA 2V1NA 4L5IA 1NE6A 1SFPA 5DXDA 3JAMK 5FXXA 5AFBA 3CDHA 4Q4Y1 5I0TA 4F3QA 5BNPB 2WAAA 1UZCA 2Q8DA 4OQ8A 5C4WB 5HLIA 5BMZA 3T3YA 3VZKA 3J7MA 1BR4A 3HHGA 3PHMA 5FLMJ 2ZNZA 4Y22A 3AFKA 1AR83 5FKLA 3U0ZA 1YS6A 5FLXZ 4XAAA 4Q27A 3K3OA 1F43A 2ZEZA 3WXPA 5FO9B 1GOHA 5C70A 1SLBA 3WG7H 3IHUA 1JUSA 1LHVA 3ECOA 3JRAA 1BVP1 3P3NA 2X6WA 5FZOB 1FMD1 4C3JJ 2Q1FA 5B66C 3VKOA 4XF3A 4BQYA 4QDQA 4ZS3A 4IEQA 4NC6A 2CW0F 3HOVJ 1NXD1 2DCYA 2CUZA 2JG8B 3IMMA 4I0WB 2KIQA 3VBSA 3LSJA 1AR72 2QQOA 1FWZA 5FBJA 1H1AA 3W58A 2GH8A 1RUJ2 1FMVA 4XTMA 5JXHA 1XMKA 1R6RA 4U7BA 3FMGA 1CAVB 1LE8B 1KONA 3PTRB 1IPJA 2E32A 4RN5A 2ID3A 2XJTA 2OD5A 4M3CB 1VMFA 5JDBA 5C6CA 4YM2A 1HA8A 3O1MA 4BGDA 2W9XA 4IOAF 4RA0A 2ZKLA 3KP2A 5FROA 2MSYA 2JICA 2OX0A 2P37A 3J26N 2VTXA 2DVFA 5GAGJ 1ETYA 1OPOA 1TMF1 2O0OA 3FJSA 1PUEE 3POBA 1RIOH 4I3GA 1JT0A 3PM1A 3MHZA 4XL9A 2W7NA 5FK8A 2RMU1 5FMOL 4PLNA 2JSPA 5EZHA 1QOSA 1NAEA 1VFCA 2JDZA 1U5TC 3KVBA 5F37A 3IUOA 5IVYA 2ARAA 4BB3A 4Q4V1 3AYCA 1ZN2A 2EH3A 3ZMVA 5KHDA 2JDAA 2Q2EB 4UB8C 5JPMB 1R5GA 3CUQB 4D0PA 2A73B 2LR8A 3JSOA 2VQGA 1VBA1 2JDKA 4AEMA 2A75A 3POJA 2PA7A 5JI6A 5B5EC 1FOD1 3K4JA 4B1LA 1LFUP 2JA6J 1UMQA 5FAXA 2LRDA 5JXIA 3MFAA 3A01B 1MJBA 1H30A 3KZZA 3J80Z 1H8TB 2ZACA 3BU0A 1BEV2 3KWVA 4Y5SA 3C2BA 1Z77A 2X4HA 4Y26A 3ZYPA 1M06G 1G3TA 4PDWC 1G3YA 3N9QA 2EVXA 3G71I 3BLYA 5EG0A 4UW3A 3ABMH 4HZFA 3BPXA 1T98A 2EZLA 2BU9A 4K9SA 3NNLA 3ZIWA 5A1FA 1RZ4A 3N7MA 4N7UA 1Y39A 4RGKA 4RS8A 3S8PA 1IKPA 3ZFFC 4CU7A 3FXQA 5FXWA 1DQ1A 3IWZA 4P96A 4BMBA 3PNTA 3V8KA 4JX6A 3F8NA 4MHUA 5SV5A 3CO2A 2VASA 1LDDA 1PO13 2JJ7A 3BR3A 3P6BA 3T0BA 2W1QA 1OI6A 4W65A 4ZTJA 3ZXAC 4Y7NJ 4N0BA 3IKTA 1N3OA 3UETA 3VV1A 4Y1XA 1OQEA 1WJ5A 2GP5A 3WUDA 5JSRA 1DU6A 4IQPA 2FDIA 4FQZA 4DXZA 1AWCA 1BBT2 4R4ZA 1O3QA 2RV8A 5IFPA 1FNYA 4AW7A 1UYYA 5APAA 5E17F 4XBNA 1CIWA 1VPHA 2B46X 4Z2WA 4LBJA 1ZGWA 3S1MJ 4XOTA 2FSWA 2FZ2A 3JRGA 3EUAA 4FPKA 1JYWA 3O6BB 3QOPA 1RJ7A 4Q4Y2 3TOJA 2JVGA 1SHWB 2J1AA 1REDA 1ZA4A 3NAPC 1ORKA 3NV3A 2PMZN 2XAHA 2XHKA 3GVAA 1RGSA 3T0YA 3TDUC 1FTZA 3TAYA 1IDZA 3KD4A 1YIJI 1IF1A 1ZGJA 4JX0A 1V54H 5FZAA 1RMU2 4OCTA 5FUPA 4GWNA 3TQNA 1XMXA 2BGPA 3ALQA 2O8KA 2NZ9A 3WEZA 4NBQA 5JR7B 3AG2H 5F5CA 3CDLA 4U0WA 4Y4RA 4EGYA 4QSHA 2PLV1 1QIQA 3BZKA 4LITA 4CXFA 2JUCA 1VB2A 1YHFA 2NPIA 1MJAA 3LEIA 4NIGA 2DFCA 2W47A 3D5OA 1V5EA 1MGTA 2JKBA 3H9AA 2QQVA 4OI1A 5DUVA 2HBTA 1F5TA 5DV5A 2L4MA 2FBIA 1QGLA 1U5XA 2IXLA 4XABA 2M4KA 1OF4A 4EYUA 3L2YA 3VBHA 3HQUA 2I45A 2KM2A 1CPNA 2RR13 5HCBA 2XF7A 2K02A 1KS4A 2EIDA 1QKQA 1ZRRA 4KWUA 4QGNA 1APLC 1HKSA 1LDKB 2BW3B 2BYVE 2VULA 1D1CA 5FJHA 1ZM1A 1FATA 4MH0E 4G4FA 4FTSA 1MKMA 3H3LA 4BCUA 1ZX5A 4E7IA 1Z0HA 1TMF2 1MZFA 3VZOA 5HLGA 1E5IA 5J98B 5J36A 4FPCA 3R6SA 1HQCA 1UZZA 3RG0A 4A6DA 4X6AJ 2ELJA 3POGA 3VEPA 2JRMA 4HANA 1S2KA 1EUUA 3LKJA 3OUIA 4QPOA 3M3YJ 3FF5A 3L00A 3HIFA 1QPIA 4KNCA 2UZKA 1FPQA 4EEFG 3SH5A 3OYIA 4Y20A 4Q4V2 3PUIA 4G3YC 4MSVA 4NHJA 1TBXA 1PK6A 5FJKA 4KU7A 4JKKA 2R3SA 3LSGA 4V2FA 2WB1A 1CAWA 1W6NB 4IW3A 3LOCA 4NPLA 3WGIA 5HBAA 2CL2A 2QFEA 1Z05A 4ZZ5A 1OLMA 2E2HJ 4L5JA 2XB5A 3AXDA 4L9VA 3GZEA 2QUFA 5A7WB 4DRRA 2QQPA 2QVOA 1VBC3 3EHKA 2LBFA 4UF0A 1S6LA 2Z3YA 4CUAA 4DZJA 4XRMA 5IAVA 1W6OB 2OUMA 1Q8OA 2WNVB 2QJVA 1G9CA 5E1WA 1UZVA 2IEKA 4XDPA 3FKIJ 3I2FA 3S2WA 4M3CF 3WP4A 3OS2A 4IQ4A 4O61A 4XKBA 4CEWA 4EN8B 1MACA 1LEMA 2RS53 5IVJA 3BTLA 4M01A 5CFCA 2XAGA 1F5JA 1S29A 4XEZA 5A3TA 2X05A 1X3WB 4BH9A 2DV9A 1IG0A 2IXJA 1V0AA 1HKQA 4PFPA 2F2EA 2NN8A 4FETA 1HV0A 4W4ZA 1TEIA 4MZUA 3GCXA 3WCSA 1KEXA 1F4AA 4KITB 4MGIE 3VLBB 1ENHA 4ATFA 1G8WA 3SKJE 2R061 4KBBA 1O3RA 2KDOA 3IH4A 1B8IA 2CW7A 2XKOA 4BIOA 5ICGA 1UG2A 3K2ZA 3FBNB 5CQEA 3CDZB 5B1AH 2MEV3 3T2QA 5EP9A 1U3EM 4BS9A 1SD6A 1W0OA 1DQ6A 3THCA 3DXJF 3L2QA 2I74A 1HRV2 3L09A 1MS5A 1UU6A 3TW6A 4IRHA 2P6SA 4L9NA 2A68F 2VT2A 4GO1A 3O1UA 1BK0A 2F17A 3PLQA 3HC7A 4UVBA 4XNFA 4Q29A 3O1PA 1UNBA 2GBYA 3AMMA 4S05A 4PQQA 3RS6A 3ZN6B 1V5GA 1ST8A 2AACA 4PIXA 2CHHA 1FOXA 4A3IJ 1PVC1 4E70A 4HVQA 3D6EA 1EH7A 1YW7A 2WV0A 3ZFEC 3BI3A 2JPBA 2PYTA 1C5IA 1N25A 2RAEA 3WW4A 4RQPC 3TB0A 4Y52J 4HXCA 1AUYA 2ZGOA 2BBVA 4QPQA 4LR4A 2R7TA 3MW3A 4OIOF 3H42B 3BTZA 4LMYA 5FWEA 1BI2A 1Y1VJ 4HK8A 3CJIB 1SQ4A 4LBQB 2R32A 1DU3D 5L3CA 4FOQA 3O0VA 3PIJA 1PVEA 3C7GA 4GMP0 5F0HA 2QQKA 4UUTA 4MOAA 1MNDA 5C44J 3OPWA 1O4XA 4ZTFA 1DUXC 4Q8KA 4N8MA 4BPZA 3OMYA 1CGPA 2VZTA 4IL6C 1R71A 3PNAA 1MS0A 1UU5A 2FCTA 5EGOB 1TNRA 2QDRA 4QD2A 2CGOA 3PMSA 1GWMA 2CJJA 3RVHA 1NK3P 3VPRA 2WA3A 2QENA 4QB2A 3EYYA 2RS11 4CCDA 1P7IA 1D4M1 1AL0G 3VZLA 3NAPB 2R071 5ILSA 5BNPA 2EBIA 5HNHA 1VQNI 5LATA 1QOOA 1HB1A 4HKOA 1RITA 4P5HA 2O1QA 3S3MA 2ZHLA 4F91B 2XJUA 1ETWA 2KHMA 1ITYA 5DZFA 4LKFA 4YIRX 2PJRA 2OPTA 5D8AA 3AG3H 4B3AA 5JHUA 2DAOA 1RKWA 4M71A 1VB4A 3O8GA 4OFGA 5EDNA 4QWQA 2VY0A 2D5VA 1YRZA 4Y5TA 2IGNA 3V7SA 1YQ6A 3H1CA 4ASLA 3OUHA 3FL7A 2WWYA 4HSTA 4CEYB 2R6QA 4D94A 2P6TA 1OCPA 3JTGA 2STTA 2JA7J 3FBYA 5FP7A 3WTZA 4MGZE 1TWFJ 2VKEA 4H55A 4P00B 4M6XA 1XDSA 5J4VA 4JDOA 2RHPA 2EIBA 1Q1HA 1UOGA 3RWNA 5C5TA 1OR7C 2QWWA 1GT0C 5F08A 3CCYA 3A21A 1CAVA 3K4DA 2R7UA 1LE8A 2VZOA 5FZ3A 3GHNA 2H6BA 3VDXA 3OGRA 2E7XA 3VSKA 1TQPA 4CDQC 3ZQLA 1DF0A 5C5UA 1YTYA 5FZ7A 3WU2C 3FXUA 2ADUA 3WTTC 3VBUA 3VBOA 4ITCA 2V73A 1W36C 1IQDC 4QHOA 4FE4A 3GBFA 1R093 4AVAA 4ZY9A 3K7AJ 1VRH3 1K12A 2DYRH 5C9AB 4DYRA 4IXLA 2XQRA 2W85A 3TNQA 4LK7A 3I4MJ 1HQWA 2P3IA 1SD5A 3BB6A 4XJWA 3ES4A 3GALA 1LHNA 2XUBA 1UX6A 1IV8A 3IAM2 4A5MA 4XKCA 5HV0A 1FBQA 3NWTA 1DIWA 1HSTA 3I56I 3TEWA 2V9KA 3VZJA 2IBDA 2QQUA 3PUFA 3NNJA 3ERMA 2F48A 4OWRB 5FKOA 3A01A 5GLWA 1RUH1 4XLEA 1PUFA 1PJRA 5LA9A 5C3SA 5C8CC 4L92A 4QX1A 2A70A 3BZ6A 2OUJA 4NRQA 1GDTA 3KE2A 3H8RA 2HWE2 4G6TB 4NHLA 3VBFA 2W87A 2GIVA 5EEAA 4XR6A 5F5IA 5FJ8J 3NVCA 1KQ0A 3F22A 2B7EA 5EV7A 2L7ZA 1K4TA 1S0JA 4KWLA 3PIGA 5JUVA 1JHFA 4LE4A 2TBVA 5H6RA 2E63A 2HEVF 4KT6A 2YPRA 5AVAA 5IVBA 3ACGA 4EZHA 2CDPA 1R22A 2E51A 3LOIA 1LNWA 1FXZA 5JOYA 2W1UA 3RPUD 1PVC2 2WO2A 2BNOA 5KCMA 3RMXA 4BA6A 5ED4A 4HK9A 3BJAA 3A4CA 4D7MA 1V6LA 5DG2A 4WCGA 4AQSA 5LA1A 1Y0NA 2ESNA 4OU0A 3ZRGA 2VE8A 5FY0A 2PJPA 5LCWL 4CCLA 5DAXA 4YSFA 5A3MA 4II2A 4BQ4A 3MLJA 2DDBA 1S0FA 1WMEA 2I07B 4EQVA 3PNVA 4Q4W2 3WG4A 1SBEA 3M70A 5FY7A 3LIGA 2OQ6A 4E9KA 3K4KA 1PM4A 2ZZJA 1WJBA 1DZTA 5FLHA 1X2NA 4OIQF 4SLIA 5DUXA 2BFUL 5A3WA 4E6KG 3D5LA 2E1NA 1XGMA 1QQIA 4BDZA 1K42A 2ZA9A 1BYHA 3RZHA 2Z79A 2DCKA 3CCEI 2Y69H 5EZWA 5FZ6A 4DXSA 1GZCA 1US3A 1SLCA 4UXAA 1OH3A 1DGWY 4AU7A 2CGPA 4DY5A 4M0NA 2LC2A 4GCVA 4PSWA 2RS12 1D4M2 2H1LA 4GJYA 1CQ9A 5F32A 4QQPA 3SEQA 2Y6JA 5GP9A 1CD3G 1KGYA 1ODDA 3HRMA 3BIWE 3LQCA 4Q4ZF 2WZEA 1UYXA 5KXEA 4QM8A 9ANTA 4ES9A 3MKLA 1G9DA 4BQ2A 1YE9A 2K4JA 2DJNA 1PGW2 1YIOA 1AYN1 4AFCA 3CUOA 1TME3 4A3XA 4CDWA 2DBBA 4JVAA 3ZFEB 5C33A 1LOAA 1AL22 5FP9A 1J83A 1GUUA 4RQPB 3IM0A 1WLWA 1A35A 3LPFA 2CG4A 1J3QA 1LPQA 1YI9A 2B42B 3WNKA 1TW3A 3EB7A 5CYYA 2R7OA 4JDNA 2VCBA 1QJY1 5J47A 2CQQA 3U1DA 2VOKA 3PL0A 3U10A 4XLPF 3ZO0B 1LEDA 4GB31 4LO6B 3AL0B 1AF9A 5JSPA 3WDWA 2RC4A 4D7NA 1C0WA 2H8RA 1OD3A 4EWAA 1W6QB 1JUHA 1UOFA 3CBNA 3NAUA 5IOZA 2QSGX 5SV8A 2QZ8A 4QXKA 2BEOA 2B63J 3D1NI 4Y5Z0 1FPN3 1J09A 1ZG3A 4ZC3A 2P7CB 1XCBA 3BCAA 3PUQA 1J7KA 2BW3A 5E16A 2NQYA 4FPLA 3U4XA 1AR91 3T09A 1RVF3 3PUHA 1L7LA 4W6XA 1DQ4A 2XVCA 2PHFA 4QGMA 3SZTA 1YC61 2ZJ2A 2HEYF 4M9ZA 5FD6A 4RB1A 5DUWA 3JCIA 4HOBA 4WXHA 4YWAA 1Y43B 3MN2A 4C0BA 2IA0A 2DN0A 4HLTA 1BM9A 2CYFA 3A23A 4A3LJ 1UIKA 2C0ZA 1LHWA 4AYBN 1MDMB 2C4XA 2XASA 1PO21 2E1MB 2KPMA 5J3UA 3B7MA 1J3PA 3GGLA 2HWB1 2CY6A 2DFHA 4EVIA 4OMYA 3FFZA 5HS8A 1ETXA 5E1XA 3LDKA 5E88A 2EPFA 5FZBA 5A7NA 4AE2A 4ZYHA 3VL9A 1TZOA 4F8AA 2EZKA 1UIJA 3M3QA 1YNAA 4C90A 3HOUJ 4E8DA 2MC3A 1E3OC 1DU0A 3EPZA 1YS7A 2O8QA 3VZMA 3C3VA 5FWJA 1OF3A 1T56A 2Z2SB 3J8F1 1T38A 2B8MA 3DU5A 2P5VA 3KQRA 1CAUA 2IXHA 3COAC 3VD3A 2ZX2A 4OINF 2YBSA 3A7QA 2HU9A 4CDQB 4EM0B 1CR7A 2WNVA 1MZEA 4F55A 1OA2A 2DMUA 2ORZA 3WOGA 1W9WA 1ALYA 2Y38A 4ENKA 3MV01 5FLVA 1KQRA 4RB2C 1YUDA 3L2HA 4WM7B 1SBDA 4HYEA 4ZJZA 2DPDA 2ZGMA 2R043 1PIV3 2LFBA 4P5OA 4BQAA 2COBA 4DJAA 2BY1A 5CVVA 5ICEA 4HKWA 3ZMUA 3T30A 5L3FA 3E0JB 2FDFA 2WNUB 1T95A 1JW6A 4P9JA 5F0FA 3JBG1 3VYSB 2R7ZJ 3AP7A 5DYMA 2ZX0A 1MH3A 3MVPA 3LD8A 2X6XA 1YQ8A 1EAH2 2KJCA 3M1CA 3IDBB 4WM8C 3IB3A 3PQKA 1VQ8I 5DCFA 2L7FP 2CYYA 4LOCA 1OSGA 1FBUA 2KR2A 2XC7A 1HXS2 2KZGA 4D6SA 3EUHA 2LSOA 5BNOC 1YYVA 3QPTA 1VTNC 2EA4A 1MQTA 1LFPA 4RGSA 3JW4A 4I99C 1VIWB 2ESHA 1NCRC 1LB2A 1W90A 1G4DA 3I4IA 4DQAA 1REFA 1C8M1 5BPIA 2DXIA 4Q5SF 2P3JA 4PDKA 4PJJA 4RL7A 2IUWA 1J59A 5L3DA 3AMPA 1Z67A 4OULA 2VLAA 4YIFA 4IHTA 3ZN6A 2BDRA 1FAYA 3CDIA 3BN6A 2X1DA 2V5YA 3QP5A 1ULCA 3QYFA 2BVLA 2E34A 3ZYRA 1LKNA 2O8OA 4IVNA 3DEMA 3VDBA 1X8EA 2Q8EA 1UOJA 3K3NA 2QE3A 4PJLA 2WS91 3QACA 3I2OA 1YLFA 3WTUC 3CJIA 1T2XA 4LBQA 2KRFA 1XSVA 4DY3A 3JRDA 2Y30A 2YBKA 5G05L 2OTJI 4JAAA 1GZ9A 1H4GA 1SD4A 1CX4A 2D6MA 4GB32 1KZHA 5FKMA 2WO3A 2K9SA 5FTTC 4IE4A 2XPUA 4RDUA 2XB6C 1YFUA 1BOAA 2M34A 3OYMA 5FRMA 3MUY1 5B2GB 1OT5A 1IG7A 2ES3A 1FX7A 1HBXG 1I1EA 1Z6TA 2D7FA 1AR73 1AR92 4B47A 1X82A 3O14A 3V0BA 4PGGA 1RUJ3 2ZNYA 2M7AA 3S6PA 3RJRA 4E8CA 2D1HA 1FIAA 2CGNA 1SMVA 2IXCA 3H0GJ 2RGVA 3ZXLA 5CIRA 4GJZA 2G7HA 4HN0A 3N05A 3IZOA 1U8BA 5F8PA 4XRSG 3ILNA 4NHXA 2V5DA 2YC4A 2LROA 1ASJ2 1A78A 4OHXA 2R5YB 3TEYA 5J3LA 5K5RA 3I0TA 1W04A 1GV2A 4IX7A 2RJ2A 1AR62 2OAZA 1WRJA 4MFDA 1P7JA 2P5KA 2H1KA 2DA7A 1RUC1 2C26A 2DT7B 3FKJA 1LQ1A 2J22A 4FP2A 1ZLJA 4CEYA 5DZEA 3CCSI 4CCEA 3BODA 4YRDA 3J8F2 2JTVA 4AVVA 1ULYA 2DDUA 4ZZDA 4CDXC 2A07F 3TRSB 4ITVA 1NCQC 3CZUA 1HSJA 2MHFA 3POIA 4PQ9A 5GLZA 5GZEA 2DF7A 3U11A 4E7HA 1K6OA 2ZAHA 2A6HF 4HF1A 1RETA 4J6GA 4XZUG 4LT5A 4IV3B 4FFIA 3W9AA 3U2RA 1TQ5A 4JYKA 1D0ZA 3A0NA 4NDLA 5HLTA 3HKZN 3M8FA 4A3DJ 1BEV3 4QX0A 2GNBA 1YFXA 1Y4WA 1R58A 1A31A 2DO7A 3I3BA 3CEWA 5KC5A 1SPPA 1W5CC 1QNWA 5KXDA 2Y0SN 3ES1A 4GDFA 1XCVA 1YQAA 4M6VA 4KFCA 1EV11 5FYBA 4D0QA 4G6DA 2TRTA 1W5TA 4F52A 2XJSA 1QJFA 3O0WA 2ZJCA 4ZDLA 1YG2A 5C9AA 3OF1A 4AYBA 2V6CA 1QH6A 4HL0A 1RUG1 3E5QA 3NEUA 3W6VA 2VZ3A 2WYFA 4V2VA 2D45A 2M8GX 1UHMA 2IPQX 5JXJA 3M3CA 1CQTA 2GAUA 2ZMNA 1OOPC 2IS2A 4MGRA 5H9PA 2IXIA 4A7YA 2GZWA 3O1RA 5ABJB 3U9GA 3BVCA 3B02A 1AA7A 2VBBA 2ZGPA 5D5VB 4XICA 2J1SA 1V6IA 4NIHA 2HDWA 4IESA 3SFIA 4KG0A 1YW8A 5FZIA 4EN9B 4UVCA 3CCJI 1AHSA 3DBHB 5I0UA 2VECA 5FOBB 3OYFA 1C8M2 2YSRA 4B29A 2JA8J 5J6XA 3C7OA 3W21A 1B59A 1POV1 3M3OA 1K4SA 2LF7A 1YX5A 1VNDA 4BL0B 4CU8A 2W2IA 3OYWA 3W5MA 3A1YA 4L9JA 1M1EB 2R0QC 4Q4Y3 3UGFA 3B6CA 5A6YA 4EE2A 4PGHA 5DM7F 1PO11 4BUPA 5GLUA 2YS9A 3ZSEA 2LVSA 2Z33A 1KYZA 1K45A 2OF7A 1PMJX 2ZB9A 4IE7A 2HQNA 2JDHA 3SFZA 1O59A 4PCQA 2AGSA 4KWJA 1VBE1 2WS92 5KVRA 2PQSA 2MC4A 2HQAA 1HW2A 2DBNA 4JGYA 5FZDA 4LO4B 3I64A 4PUSA 3DPTA 2BP6A 5LD2C 2LALA 2D93A 1DGWX 1FYUA 1FMD3 4KBZA 2WA0A 3LSRA 1OJLA 3QPSA 4G94A 2EIGA 1WBFA 5LEKA 3NV2A 1GP4A 3ETQA 4WF2A 1K83J 4D9JA 2JD4A 1C1LA 4YG2F 5CNAA 3U21A 3L1PA 1JTZX 3POEA 4A6OA 3HT1A 2CW8A 5L7OB 3WW1A 4YW7A 1N77A 3CL1A 1XE8A 1CF7B 1IV6A 2EXKA 2B45X 4QHZA 3E1F1 5FV3A 2DFFA 2EICA 1Q8QA 3NARA 4COVA 1DQ2A 3V8JA 2VUJA 3MUZ1 2BOLA 5JHFA 2ZMEA 4KH9A 2CQKA 4Z6YA 3BR2A 5L9RA 4XSXF 3MV11 1MMDA 3TP3A 5K8SA 2J1UA 3T2TA 4M73A 4MHGA 1TMF3 4IGOA 2ZJRF 2E71A 5KNLA 2Y6GA 3I58A 1MZBA 3RI9A 3ZFGC 1U6GA 3ZN1A 2WV1A 3T2OA 3KIOA 4YFWA 2LY9A 3UL2A 4IJAA 1UKGA 4KI5M 1YEWA 1V6MA 2RMU3 3DFGA 1WFXA 3H3ZA 3OYJA 2CV0A 2NAZA 4GD4A 1U0AA 5I0DA 4GZ9A 1UAIA 3AC0A 3DECA 1AOYA 3NWSA 4Q4V3 2WSVA 1G9AA 3KYCB 1W6PB 5CU1A 2EIJH 3MLLA 4Q0PA 5EJ1B 3J7YJ 4UBHA 1XSDA 2RR11 2XPJA 1FOD3 3D82A 2YPDA 4KGQA 4MGKE 4YG3A 2JWTA 4Z2YA 2JD9A 2R7QA 3KZ4C 4U36A 4Q1PA 2YB7A 1MMNA 4FCAA 5EYXA 3N36A 4CICA 5CVUA 2AEYA 1EV12 5BOXA 5BXXA 3DTEA 5E1ZB 2JT1A 3KFWX 2Y6HA 5FP3A 1VZ0A 3THTA 5JR2A 3ZOIA 3FHNA 4DOUA 5IYCJ 1IXCA 3PFYA 1QDCA 1PNGA 2HDDA 4NRPA 1MDMA 4GXLA 2DCEA 5FD5A 1MEC2 1I9RA 1O4ZA 4IEPA 5KHIA 3Q8CA 1TTYA 4YVSA 3FIWA 2VPRA 1UMIA 1GP6A 4AVPA 1IW7F 2JA2A 2L7KA 4CXXA 1TLHB 2LS6A 4ISQA 4KG8A 3O2PE 2IS4A 1GZWA 3WF4A 4A3JJ 4CDXB 3CJNA 3MEXA 2MA3A 5JZGA 2XR4A 1VBC1 4UUSA 2D98A 1CIYA 5D6EA 1HRI1 1RR8C 1ND2B 1HF0A 2OZ6A 1U78A 3RYKA 4QQLA 2JIJA 3GF6A 1F1ZA 4QXCA 4M4PA 3HKZA 4E4HA 4AVCA 1V6OA 3VB2A 5BUVA 1HQNA 3KB5A 2XONA 3FUOA 2UY8A 3DKYA 4GYIA 4ZU5A 2RS51 4K3UA 2XRLA 1XSXA 3LAGA 3OTFA 2M5WA 3LSHA 2Y0SA 2WFF2 4OMDA 5K0UA 4HV6A 1V4RA 2W1SA 1ZKGA 1ULPA 3ZR5A 3CCQI 2OS2A 4C30A 3WNLA 1JTXA 4LO7A 2VD7A 4C2MJ 2HVRA 1HX6A 4C1WA 3ZR8X 4XF1A 5J7MA 2VZUA 1X58A 1VBE2 1N3QA 1ZZBA 1SDDB 4AYUA 1B72B 3ZXFA 2EILH 3JQWA 4A7ZA 3HQRA 2WBKA 2VKHA 2WNUA 4ES8A 4A0XA 2GM4A 4LORA 5JOWA 2PLV3 4GYGA 4PIZA 3HBLA 2HYFA 4M74A 1UYPA 3ZMTA 1SEUA 3A02A 3HJRA 1XNCA 3APBA 3BG6A 3THPA 3KLSA 2UXXA 3WF2A 3OR2C 3ECQA 1V9U2 3JUUA 4QKDA 5GJ6A 1GXQA 4QKFA 5E1RA 2Z5UA 1JHJA 1LVAA 1ACCA 2C9KA 4C3HJ 2G9WA 1TT0A 1IN5A 4I0AA 1WCQA 2VJIA 4XIDA 1K78B 1GWKA 3PU3A 2OQGA 2VQLA 3I9V2 4XOGA 2EIMH 4PLMA 4MVTA 1X36A 4Z8BA 4BQXA 1W28A 1DBNA 1UELB 2EZHA 3SCHA 1JZ2A 1T0FA 4INDA 3TDZC 2Y6KA 3WQ7A 4HMZA 3C2UA 1VQMI 2FQ4A 2FNAA 4PF1A 1Z0XA 3M3EA 5IHRA 5A7SA 1UZWA 3I2KA 5FFXA 5HDNA 3VB9A 3JRHA 1UAAA 4Z92B 2MH2A 1S0IA 1Z7LA 1W8TA 3SNMA 4UFLA 4OUEA 2JB8A 3H1WA 4O5VA 1Y9MA 1BK1A 3OIPA 2L7MP 3M9AA 2YUEA 5FCCA 1OKOA 4B48A 1ZQ3P 2HWD1 4QIWN 1IXSB 2W52A 3HNYM 4TV7A 2GQQA 4GKYA 3LNQA 3GTKJ 3Q0VA 3USSA 2A6ZA 5FLJA 2WNOA 4RHV1 4W1UA 5JMCA 1JHHA 3BTIA 2E6VA 2Y64A 5KHHA 1YQ5A 4HX4A 3JSPA 4M3FA 3KZYA 4EJTA 4RR3B 2XAQA 2XJVA 5LK7B 5D8KB 2L2OA 3GZ5A 4Q4X1 2BNNA 3JRCA 1G59A 3WHUA 3V4GA 1CAXB 1NA1A 2W39A 3KT7A 3ZFGB 2R5YA 3UESA 2ZXJA 5B4NA 1UG0A 3F0CA 2M45A 5ERIA 4MXVA 1ZBE2 4AC0A 3T4HB 1LENA 3PVEA 5FDBA 3AL6A 4O6JA 2P6HA 4BJ6C 3L9FA 3H5AA 1DLLA 2XJQA 2XWBB 3C8XA 2VC0A 4OMZA 5ACA1 5D5WB 1UXZA 3ZYIB 1E5HA 4N53B 3ZDVA 3GTMJ 2CV6A 2R063 5A3LA 4P08A 5A7PA 1ZREA 4PT6A 3P1IA 1URXA 3EYPA 3R4UA 1ZRFA 5I8SA 2EXHA 2FBKA 4AAPA 4A2UA 4IV3A 5TGTA 4NN0A 4D6QA 2V9VA 4FOVA 3LGRA 4RYDA 2V7FA 4C1XA 3DLLF 1NOVA 1E3PA 1EY2A 1O4TA 4E4ZA 2LKXA 4HN1A 4NHYA 2X5IA 2RE9A 5A3UA 3AKZA 1VQ4I 4QKNA 1QJX1 2AXLA 3KEOA 2F4OB 3CESA 4B4PA 1FOKA 4EMSA 2VZVA 1R23A 1JBCA 4BK4A 3S32A 3LPGA 4XLHA 2WUHA 3CZJA 2JMWA 4I98B 4NHKA 4XILA 3OOPA 4LJZF 1IRGA 1PVC3 4QPGB 5FKKA 2BTVC 1NKGA 1SDWA 4XUOA 1XG1A 2JDUA 2QF7A 1RUD1 4EZ4A 2AH2A 3SCGA 2MH9A 1QU3A 2GC3A 4CTEA 5ABJA 4I09A 2QQBA 3CU7A 3QD6A 5ICFA 3S57A 4JHTA 3CLQA 5IVFA 4FFFA 2LUWA 3E5UA 2EV5A 4JHZA 3AZWA 1W0TA 1ETVA 3LB9A 2YDEA 5H9QA 2VQHA 3VBHC 1QHGA 1QOTA 3F8CA 3J7AY 4UV9A 5J1RA 3NL1A 4CDGA 1P8JA 1UFMA 3ELNA 1Q43A 3DPUA 1D8KA 4MXWA 3FX3A 1VAMA 1XU2A 1BMV1 5LBFA 1ZBA2 3D4KA 2RS13 2E2JJ 1DQ0A 1X19A 1D4M3 2PEXA 2R073 4ZU4A 4ZKTB 3I3DA 3IDEA 1X4PA 3WHCA 2PHWA 3WNNA 1Q1VA 2JA5J 1X8MA 3K1PA 4L9TA 2CTVA 5HS9A 2AHQA 2QZ2A 3J7LA 3VKLA 3GEZA 2VCAA 4TWTA 4Y24A 5A7OA 5JLXA 3BZCA 3NJVA 2RREA 1UOBA 3MAJA 5FZ9A 1Q3EA 3W2AA 4HSJA 2FX0A 2JPCA 1LNSA 1PK6C 1IJWC 2H09A 2O9LA 4CU6A 1OKRA 1QZEA 3CP8A 4AEDC 2EQRA 1PHMA 3ABUA 3VYTB 1H89C 1YJ9I 2DA3A 3VBSB 4NIIA 1PP7U 3NKGA 3GHMA 5LW9A 3N9NA 1K5MC 5CG9A 5CVRA 2EAAA 4BM8A 1VJ2A 4PCRA 2BWAA 2B39A 3KETA 1E17A 3ITQA 5DUUA 1OYIA 5JLVA 5HLHA 2WZR2 5L7OA 4CDUC 3ZN4A 4YGDA 2VBXA 4LMFA 1CF7A 1CZVA 4L11A 1VAVA 4DEQA 2W84A 1DDNA 1YWKA 5HPOA 3DXUA 4GH4A 2BOIA 4R9BA 4BJ0A 4CCNA 2PHDA 5D21A 4Q4X2 2ZZQA 4XZPA 2RS32 3ABLH 4OUSA 4B4RA 3GFLA 3DWLE 2VMIA 1J2XA 1FC3A 5DS9A 1U5TA 2FMYA 4K20A 2XGCA 4CCMA 4CEWC 5FZCA 3AVSA 4EQQA 4QMAA 5F6LB 3SQNA 5CFCC 1C3HA 2K4BA 5IP6A 3HAGA 4AFMA 3FLPA 1FP2A 3RDIA 2KZVA 2IC1A 3KGZA 1D7PM 4EN7B 2VC9A 2HYXA 1MS8A 4HKLA 3MLKA 2PTMA 2Q4SA 1TE1B 5JI9A 1A34A 4F83A 3R0RA 4FFHA 4AHYA 5ACA2 1ZA7A 3HTUA 1O6UA 3H9GA 3T1LA 4LHLA 1ZZ8A 1RPWA 2E5ZA 2M1BA 1W6PA 2CWEA 3BPVA 2ZGSA 1YYNA 2HXIA 5EPAA 1FPN1 1S72I 3CIHA 4MO3M 3E5XA 4CO8A 4LUMA 2QQAA 3K4CA 1QHDA 3AYDA 3N7LA 1U5YA 4HNVA 1BJZA 2ZJQF 4YW6A 5EG0B 1YJWI 4CSWA 2WAEA 5HCFA 1OMIA 2V1UA 2L9RA 1GNZA 3BR5A 2DQLA 4FT8A 3C18A 1MS3A 1YIFA 2L54A 3LA7A 4CA0A 3W59A 2DT5A 1ZR2A 3MCZA 3VSLA 5E89A 3I97A 4OAZA 4PJMA 2H0VA 4A69C 2GU9A 5C3RA 3RZJA 1OVPA 2YG0A 4YNIA 4NOTA 1UB9A 1XD7A 5GKAC 1JZ3A 1G9BA 1FOWA 4HNTA 3A4UA 1POQA 1G2HA 2ETEA 2RJKA 4G7ZF 3K6GA 2DTRA 4NNJA 1TG7A 5H9SA 3BALA 4S2GA 4IXAA 4YYOA 3TEDA 4OZOA 3CMYA 4L18B 1RUD2 4ZPIA 5KHGA 2WSUA 5EF6A 3A03A 1YQ2A 3EXUA 5FY9A 2GNDA 2VCCA 4BLJA 2PFBA 1E5SA 2CQNA 5IT6A 4RAFA 3M8LA 5L9VA 2X10A 4AUXA 5IUQA 2XL7A 1DQ5A 2VONA 4O7XA 3C7EA 2DMQA 3LIHA 4LG0A 3CMEI 3FMSA 1COV1 3VN4A 2HXOA 4EJWA 1BL0A 4AFBA 2DA2A 3ERED 4M4RA 3U75A 2YBPA 4HBNA 2GNMA 3PJYA 3GTPJ 4KJZA 2D40A 4XJUA 5BNPC 2GALA 5C4WC 3IMNA 3LSEA 1EV7A 1ND3A 3I5UA 1A6IA 1LESA 4YEJA 2BGOA 4S2FA 4EJVA 4WXDA 3K4LA 4OOIA 1K6YA 1B9MA 1I5PA 5FPAA 1TZLA 5D8AC 1EH8A 3E7LA 2O8XA 2QQ9A 5CA6A 4R1HA 1QA6A 3C2GA 4KU8A 3ACIA 2E7QA 5IWFA 4QWNA 4RM2A 3MD2A 4QPIA 4RFT0 1LKXA 1GVDA 2ZFWA 4LBMA 1WQ2A 3TN91 3OPTA 4XBLA 1QQP1 2VOTA 2ZPXA 4Z1VA 1GQGA 2FZ1A 1LULA 3H1YA 2AO9A 2Q8KA 3K70C 1GOFA 3FXJA 2IFRA 2ZMLA 1IAWA 3O1TA 2ARXA 2ZC2A 2JG8C 1SBFA 2X29A 3G3ZA 2M30A 1IN4A 1FJLA 1OHFA 1ULFA 1MS9A 3WDTA 2VE1A 4GB33 1GP5A 5IOYA 3JRFA 1IPSA 1UPIA 5GZCA 4ZDPA 3H35A 2CV1A 5JI7A 5J4YA 5EEGA 1P6RA 4N90A 1BHGA 2X6OA 1UQXA 1AR93 2A7AA 2VJ5A 2IXKA 3GZNB 2ZO4A 4LO8A 4MGTA 3VBOC 1GSLA 3S3OA 4QTRA 2A3WA 4Y1ZA 2OT7A 4F3JA 2JG9A 2H8WA 5D4SA 3FMRA 5ILVA 3KM5A 1JKQC 2TUNA 3HSEA 2VNOA 4PHZA 4Y1UA 2NNNA 4M3DA 4XE9A 5J8CA 1J75A 2PMHA 3VYRB 3FZ3A 4XMAA 2P17A 2MBFA 2WT0A 1AKHB 1ASJ3 2WT2A 1PK6B 3WW2A 5FKCA 1LOGA 2W92A 3FE5A 3CC7I 2BHYA 3LSPA 1LHOA 2R16A 1BI0A 3BIEA 2YU9J 2HWB3 2JECA 4BDVB 3BPSA 3CMGA 3CUQC 3SXYA 5LRSA 1SLTA 4D1QA 3KMHA 4KWKA 4V1PA 4IETA 4R9AA 4ZYGA 5AVPA 2Z16A 3VDDB 1F4KA 4A44A 2WWUA 1AR71 4LG3A 1NTCA 1SD7A 4AI0A 2YZ4A 2HTJA 1ENXA 2CSGA 4QX2A 3J8F3 1MNEA 3FXKA 2DLLA 2LBFB 4UF0B 5FYCA 1JYNA 3FMQA 5EJ3A 1G86A 4ET7A 5ISLA 2XIGA 3VBFC 2VZRA 1YO8A 5FYYA 5GZGA 2E35A 1NX9A 4HF0A 4I02A 2Q1ZB 2XXZA 1T6BX 1YQCA 1VE0A 3DYOA 3VD4A 4G8XA 2RQQA 3RTRA 1SLAA 2DU1A 2G0EA 1S7EA 2ZOEB 4YW5A 5FPZA 5FY5A 4BHPA 3WF0A 1CAXA 1AJKA 3I59A 5BNNB 3M07A 2VBPA 2PLYA 2PHUA 3Q8AA 1OURA 5J48A 2CUJA 1UZ0A 4XETA 2BVMA 2UWAA 4XUTA 4Y33A 2O7OA 4U2AA 5CFDA 5LY2A 3MGUA 4XHXA 5JPNB 3DKXA 1OFCX 2FHRA 1RXGA 1O3SA 5LHIA 3GTGJ 2W5FA 4IL7A 3LQRA 3TGNA 5F5AA 4DUWA 2ORXA 4N53A 1B8IB 1K3IA 1E57A 4CCCA 3Q8BA 4A0ZA 3RCOA 3GW2A 5KHJA 3WV6A 1WZXA 2OQRA 2CV2A 2HEOA 1N1YA 4KN7X 4X8NA 1COV2 2P2KA 4Q0SA 1X3ZB 1W8NA 1QY4A 1AR82 1E5RA 4E27A 1X1BA 4HA8A 5L3GA 1HJFA 2IW5A 3VD7A 5FYHA 3VD9A 1USTA 3O12A 2XLAA 4PSXA 5DABA 4BMEA 4IF4A 4RAZA 3CCLI 1WD4A 3WLUA 4G6QA 1XS9A 4IEOA 3SYTA 4Y3OA 3HN3A 5IYDJ 1WW6A 4TTGA 3GZTB 2DCZA 2Y9ZA 3OOXA 1C8M3 1W6MA 2XJPA 1VBD1 1W36D 3S1NJ 4L9BA 4PI0A 2J7MA 4IERA 4P55A 2WA4A 3K48A 1PGL1 1P4AA 2V1XA 1P92A 5FR3A 4P1WA 1XPXA 2MG4A 3MW2A 2DMTA 2V9PA 4HVRA 2YU3A 4QPGA 1QQP2 2EFQA 4P02B 1J1LA 2YGMA 1T08B 5BNQA 2WN3A 4XURA 4IEZA 3IH2A 1IS3A 2QBYA 5EFUA 4LPLA 4XMIA 2BNMA 4YZ5A 1K7AA 2WS93 4COYA 3MYXA 1V55H 3WZ1A 1YFHA 1HLCA 4G9YA 1BBT1 3HOZJ 1ETKA 3MFCA 3CC4I 2EIEA 3GTOJ 1CZSA 4AI8A 4XDOA 2VL8A 4NQWB 1W9YA 2DK8A 4IZZA 4XRFA 1NLRA 2JSCA 4OI2A 1S5LC 1KD7A 3AZVA 2CU5A 2PHLA 1RHI1 1LU1A 4AIHA 1S2EA 5KXCA 3U1KA 1VR3A 2WLQA 2ADEA 1BIAA 2K9QA 2LK2A 1KDMA 2VMDA 2DDAA 1WGPA 2K85A 4L99A 2WINB 5I93A 2JN6A 4ANJA 2PJRB 2AC1A 2VUMJ 2BZTA 5D8AB 2VH9A 1RMU1 1FSEA 1W2OA 4R52A 2JUGA 3BOPA 1PGSA 2XQXA 2IS6A 5E3NA 2XGEA 2VN2A 4J01A 3CC2I 5FZHA 4YZ3A 3AB0A 5IT9K 3QU3A 3JAMZ 1IN6A 5A2QK 2LDUA 3HZJA 2IJLA 1RUC3 2IWGB 1EH6A 2NRAC 3W6KB 3UNPA 3O8HA 1KU7A 5E20A 5M5YJ 2Y0IA 3MIEA 4QAWA 4A3EJ 2WAOA 4QU1A 2KXLA 1XBFA 3KT4A 1VBB1 2IZWA 3GTJJ 4CH7A 1FEXA 4L8QA 5GALA 5F39A 3DEEA 2JIGA 1JE8A 5D1IA 2E19A 4BXSV 2HVSA 2CS3A 4PIYA 5KK1A 2JQ7A 1S8NA 3LF7A 3LQQA 4ESBA 5F1JA 2ZX3A 1Y8RB 2DYCA 4Q5OA 4YM0A 2E26A 5C3PA 1RINA 3KV4A 2I8DA 4XJ9A 2WNVC 5A2QZ 3VBUB 3SQOA 3VBOB 2I10A 3V7RA 1PX3A 4KICA 2ID6A 5JOZA 1XRUA 1JXSA 2DFIA 1BBYA 4BAYA 2WL1A 4QQ2A 4Y17A 4R9CA 3O3KA 1EV13 3QH7A 3FLRA 1WW7A 4E2QA 5IYBJ 4NC8A 4HV5A 1XGSA 3ZQHA 4ZHNA 3BP8A 3SH4A 4CCKA 1G8XA 1W8HA 3IV5A 5GLVA 2EFOA 4BJTA 2EFPA 3Q3SA 2HPMA 4BACA 4AVBA 1RUG3 2ISYA 1UMZA 2DOEA 3BC8A 5TRDA 2LREA 5EJZB 2BY3A 5ILUA 1IHMA 4F7ZA 3TO6A 2E9QA 1MEC3 1DYKA 2P3YA 4EWDA 3PDQA 4FTEA 1W7PD 1B6AA 2Y75A 3N97A 3QWLA 2XOMA 2XF6A 3BR0A 1PUFB 3F2ZA 1H0BA 3WHTA 2ZMKA 1WH7A 2DU9A 3I71A 4LK1F 2YGLA 1ZH5A 3VBFB 3TBDA 1ULEA 1E3HA 2ZGQA 2K0GA 3EUHC 2WTEA 3AG1H 3DTIA 1I50J 4WZCA 1JT6A 3I3LA 1RUI2 1OCOH 2SBAA 1NH3A 3D8CA 3P7NA 1FV3A 2L01A 5T5LA 1Z6RA 1VBD2 3ZR6A 5KWRA 1POV3 3F21A 1PGL2 4FOYA 4EN6B 3DKQA 5H9RA 2OW4A 2ZGUA 2HPIA 2AXTC 1YCIA 4OVEA 1BC8C 4FPYA 4JC1A 4K7JA 3ASIA 1WVRA 1Q8PA 3LDRA 5D4RA 2WFF3 1I6XA 3NRUA 3EMRA 4WVMA 3OEAA 4CGZA 2QQMA 3DF8A 4BZ4A 3IRQA 2OPWA 5CBLA 4OHZA 2CDOA 3MIBA 3ZKYA 1VQ6I 1WCUA 1IN7A 2HOSA 2VKVA 2HWC1 3DQVC 2FMDA 1VBE3 5EXOA 2DW4A 3P9IA 4KUMA 3CJIC 4UFMA 1C4RA 4GWJA 2X51A 2K3PA 3FK6A 3ORJA 1S2BA 1D0HA 2Y31A 2RV9A 1F15A 1QXPA 3WINE 4LKSA 2HFHA 3E6DA 2FQ3A 4ASNA 4FPEA 3CF6E 1D1AA 1BJAA 4HETA 5LASA 1QHHD 2DMPA 1H2KA 1EPZA 1HRV1 1RHI2 3SLIA 5K4LA 3ELKA 2X9DA 4K1YA 5M5WJ 4FSJA 1OLRA 2FD8A 3IC7A 4EATA 1MVQA 2RDSA 4S04A 4A3MJ 2HI3A 1H1MA 5FZKA 1G6NA 2GSYA 3NV4A 1REEA 1U9NA 4CDWB 1YRNA 1UXXX 3C1DA 3LFUA 3T0DA 2RM22 4FPOB 4K6BA 3SC7X 2R7SA 5AC91 2D97A 4D3WA 1D8JA 3OB8A 2YUSA 3HRUA 4IEVA 3J81K 1OXCA 2Z1DA 4META 3S7EA 1LECA 3Q5FA 2CAVA 3CJRB 3GCMA 3N7KA 4CEYC 1XOYA 2ME0A 1RUF1 3FXMA 3LEMA 1JZ7A 1DQUA 4OUMA 4W6WA 1N1SA 3POFA 1LFBA 1GNHA 5GPCA 4BJ5C 3K0LA 1VBB2 4GKXA 5DZGA 5IVVA 2DJIA 3KV5A 4KMQA 4BOWA 2Q8OA 3K2AA 4DPNA 4NE9A 3RMYA 2DUOA 3HTSB 3SDGA 4FPJA 4ZYAA 3I7DA 3F72A 3SZGA 2JX9A 1BJQA 4OIRF 2ZX1A 3GJAA 2J1TA 2DK5A 2EXIA 3ZXJA 1ODNA 5E8AA 2DVGA 3NMBA 3H5RA 4MTEA 1W0UA 3W3CA 5J40A 4JQTA 2P5LC 2KIMA 2VQAA 1JKRC 4AHWA 3KPHA 4B7EA 2HR3A 4XF0A 5F6FA 4HSRA 3ZOBA 1XPWA 4NO4A 3JQXA 2MEV2 2DCTA 1LDJA 4XBFA 2IT0A 5D5UB 1UO9A 2YYOA 2HYKA 3AMNA 2XSDC 2XLGA 5FK7A 2CAUA 1ZARA 1AKHA 4P9WA 3HRSA 4YZ1A 4I0BA 2VNGA 3M1EA 5GPAA 1LAJA 3DYMA 2ZKZA 3WNXA 3V64A 3JD71 5FGMA 3KSCA 3IPVB 1P9QC 3PIOF 1Q5OA 1JZ5A 1LEAA 3JTHA 1YXWA 2DUQA 3FC0A 4P9XA 3URFA 5C3OA 4OIPF 3ZKUA 3G73A 1O5UA 1OCTC 3HBKA 3VDDA 4CP9B 3M7GA 2M87A 2BV4A 1L7QA 1CAUB 1SAXA 3VHPA 3VWBA 2JE8A 1XQNA 1WD3A 2R7FA 4J25A 1MJ9A 3N35A 4YLZA 1HRI3 3FFQA 2PELA 1SFYA 4TLGA 3PUBA 2LH9A 1JN2P 1Q56A 1LOCA 4NUBA 3BDDA 1QVTA 5AONA 2ZHNA 3GUDA 4B44A 3UKNA 5JVGF 2GP3A 2EALA 4UFHA 2C6YA 1N78A 2VU9A 3NNFA 2DA5A 1A3KA 3GFIA 2RDPA 3UNGC 5BNNA 5HCHA 4C2UA 2VVDA 4XIOA 1HW1A 3ECHA 2EXJA 4NPRA 1GICA 3M4OJ 4QHBA 3K10A 1MZ6A 4XC9A 4YM1A 3OR1C 2HWC2 5CYVA 5E8IA 4B1RA 3NNMA 2GC0A 3BU7A 4WM8A 2UWCA 3OYBA 3LSIA 1JOBA 2F4IA 1B1BA 3PIPF 3ML6A 5BNOA 4ASMB 4A45A 3PO2J 3I3QA 4OHYA 2ADDA 2E36A 2NM1A 3Q9OA 2CFXA 3RI4A 1F8VA 4KIBA 3DPRB 1KRIA 5IK7A 2ZXQA 3B9IA 4PJYA 4FISA 2L4AA 2O6GE 3G1MA 2UU8A 2LKPA 2L9NA 1IGOA 4JGZA 4CP1A 1MQTB 4H2AA 2HWE1 1R7JA 1W8FA 5FZ1A 2COMA 5L9BA 5AIQA 1W8ZA 2FJ1A 4XLCA 2YC0A 2IGOA 2XVLA 2PQQA 3POSA 1ON2A 2AREA 2LG4A 4I6ZA 2ZSIB 2QYOA 2ZMEC 2ZABA 3AVRA 1I6HJ 2HJIA 1H2LA 3WODF 3Q0UA 1IPKA 2VNVA 2FDGA 4D69A 2R30A 3ZN0A 5FPBA 2BGCA 4UW4A 4XOPA 3UV9A 5M3MJ 4JX5A 2BXYA 2YFUA 2KT0A 3T08A 5JXGA 2FUG2 5HI0A 2VZSA 4N43A 5AC92 4IHYA 3RKYA 3BJ6A 1DGRM 1MMSA 1GQHA 1OQ1A 2VAUA 4DEVA 2VQ0A 4B4QA 3H9QA 4QX8A 1HXDA 3RZMA 1RUF2 3ZM8A 2R4GA 4ZYDA 2IA1A 1LOFA 1STMA 5HOOA 3M1HA 4LTAA 2Q5TA 4Q4W1 1FSHA 2G9GA 4X6RB 3A0KA 3HOWJ 4LA2A 5FYUA 2VBWA 3WTVC 4LJHA 2STWA 2C5DA 5DDJ1 3AL0C 3PU8A 4Z2AA 2V6EA 1SFNA 3L2VA 4NQWA 2HWD3 1CJPA 2XGDA 5KR7A 3V0BB 2X53S 5I8YA 4YGEA 1TNFA 4DNYA 4ENMA 1NXMA 1GBGA 4XF4A 4LKDA 3S5AA 3FXRA 4RHV3 4TYSA 1B35A 1JYXA 1NUKA 5TSWA 4IQJA 4NHMA 4QU2A 3OL4A 3HR9A 3PMEA 1QO0D 1GV5A 2PMZA 1W2TA 5IK4A 3TBIA 4WX9A 1WBLA 3IAQA 4II3A 4XPVA 1W03A 2DT6A 2JDMA 3LWCA 4Q4X3 5HCAA 4F93B 2W08A 4XUPA 1PGW1 3ZMOA 3RKQA 1GXPA 3TO9A 3CMMA 3OL3A 1ETOA 4ZONA 1JXNA 4A3GJ 1AL21 1RNLA 4FXKB 3V0AB 4QPYA 2JWPA 5LLQA 2E1MC 4E7JA 4Y4YA 3K4NA 3JD72 1D3YA 5A3NA 1NCQA 2D6NA 1RRJA 3OIOA 2VW2A 4IE6A 3DGTA 5BQTA 2K5CA 2A3XA 4O9EA 2MPFA 5CVJA 1BVVA 3OJBA 5GTIC 1YFWA 4BY1J 5A32A 2I2SA 4RGRA 4RS5A 3GMEA 5LEJA 2WWJA 2QTWB 3GJBA 3K1NA 5ACA3 1QZZA 4COWA 1R00A 4A93J 2G9ZA 3T1MA 2TCTA 5JZGC 2A6WA 1KU9A 3A0BC 1I3HA 3HM5A 4E7ZA 1OBNA 4NWVA 2BXZA 3BPZA 2RKHA 4XKWA 4IRIA 2D1VA 1ZNPA 4COUA 5A1AA 2VW0A 4XQWA 2WAFA 1P2FA 4JDMA 1W2AX 4C8DA 3RQ4A 1SPPB 1QXJA 1UKRA 4A3KJ 4BBSJ 4FP3A 4LK6A 2EK5A 5FYSA 3ZYHA 2IVIB 3K4AA 1RJ8A 2PQ8A 3B3QE 5K0UC 2B9SA 2E7AA 4DZGA 1OYYA 1YX3A 2A6VA 2LLKA 1UCRA 1QJX3 5CISA 3ZXSA 1F2NA 4WM7C 2L02A 3WTWC 3TL4X 4FTHA 1OOPA 2W46A 5A80A 1R081 2ZEWA 4DS0A 4IHVA 2VM9A 3JB8A 3QPHA 1OYWA 2ZXWH 2RVCA 4XXAA 3P5JA 2D6PA <