4N9HA

Crystal structure of transcription regulation protein crp
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
201
structure length
201
Chain Sequence
PTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Structures of inactive CRP species reveal the atomic details of the allosteric transition that discriminates cyclic nucleotide second messengers.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
total genus 55
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4n9hA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4n9hA01
3HT2A 5D6EA 4I09A 2XAFA 1ZRFA 2VBXA 4WBBA 3I59B 5I8SA 4EJVA 1XSDA 1IW7F 3FHIB 1CAXB 4MV2A 1SFEA 3VHRA 2WFPA 5I93A 4XFBA 5HI0A 4BHPA 1KQ0A 3KEQA 5HLHA 4FX0A 2K4JA 1B9NA 4HYEA 2Q2EA 1IPKA 2QCSB 4ZYHA 3CO2A 3RTRA 2RQPA 2GC2A 2EA2A 2N7GA 1XDSA 5E18F 3GVAA 4OIPF 5FDBA 5KHKA 2HKXA 2ETEA 4CGZA 1D8JA 1KU3A 1B4AA 4AIKA 3NQOA 1R1UA 2GZWA 4DINB 1FI2A 4D0PA 3MEXA 3C18A 3FXUA 3LFKA 4HZFA 2W25A 4RGSA 4L0YB 4RS8A 3SZPA 4QWQA 4HAMA 2ACJA 3FWEA 2UXNA 1WRJA 1T2KA 5FLXK 1UFMA 1NE6A 2UZKA 3DN7A 2HYFA 1OPCA 1TQPA 1YTYA 3TGNA 3F6VA 2MH2A 2PN6A 3USSA 4M6XA 2PEXA 3IDBB 5HOOA 1EPZA 3W6KB 1KA8A 2GWRA 5ICGA 2PG4A 4LFUA 2YU3A 5BPXA 5J3UA 1XSVA 1ZRCA 3LA2A 1OYWA 4PGGA 1IRFA 3IKVA 4RB1A 5I0SA 3HOSA 4MGZE 4F8AA 4OIOF 3J7AO 4UV9A 2X0LA 4AVBA 1SMYF 2FQPA 1QPMA 1NE4A 4LUMA 1UW8A 3JSOA 2DCTA 3BALA 2Z3YA 4L11A 5CVRA 3RI4A 2H6CA 1IUYA 4OFGA 4FHTA 4Q5SF 1IXRC 4KWLA 3ZMTA 2P5VA 2EFPA 3M9AA 1RL3A 3H3UA 4OLLA 5IT9Z 4UXAA 2QENA 3ELNA 2IXHA 1XD7A 1VR3A 4QMAA 4HA8A 2OZ6A 4HW0A 2A61A 4UHTA 1XGNA 1LR5A 1YHFA 4HF1A 1LDKB 1ZH5A 4J1XA 3DQVC 4OMYA 3HT1A 1LJ9A 4BYYA 1U5TA 1TQMA 4A6DA 1YW9A 2Y48A 4Y13A 5DUKA 5EFUA 1R36A 2O03A 5HDKA 5ILUA 1XE7A 1V3FA 3L2HA 3V7CA 1O57A 3F8NA 1MDMB 1FLIA 2PMHA 4L9NA 3UKVA 3ES4A 4UBHA 1Z05A 1F1ZA 3QOPA 1O4TA 4WX9A 3ULQB 3F6OA 4ZYGA 2QJVA 3CJXA 3F8BA 2GA2A 1SQ4A 4G9YA 3ISPA 2KKOA 4I3PA 1PDNC 4A0XA 2PFBA 1YFHA 4ORFA 3ZN0A 4NVPA 2VN2A 2LKPA 3NKTA 4LULA 4WZCA 1YFWA 2HQNA 3K1NA 5FFZA 5LEKA 1ZZ7A 3CJNA 3RYPA 3MAJA 5HVQC 1QO0D 2VBWA 1MGTA 4P96A 2IPQX 3D5LA 2VBZA 3H1YA 2O8XA 2IC1A 2WTEA 1EYBA 1T6SA 5CJ9A 1H1IA 1HBXG 1DPRA 2Q0AA 2F5FA 2GIVA 2XAGA 2HZTA 2VOOA 1O5UA 5FLXZ 1XDUA 3NSTA 4JTOA 3MQ0A 4MZUA 4UUVA 4UNOA 3H92A 3IBMA 1G6NA 2FMLA 1T39A 3COAC 3G3ZA 4A12A 3HIFA 3BDDA 2IXKA 4O9GA 1KGSA 4FAHA 5JVTA 1BN5A 4BIFA 1X7NA 4B29A 2K0GA 3GZ6A 2O8QA 2B8MA 2V1XA 5ICCA 4MNUA 2KRFA 2QNKA 1ZZ6A 3OGJA 1R7JA 3E5UA 4LK1F 2ZNYA 5E1ZB 2BBYA 2QBYB 3LQQA 2IXLA 3F3XA 5BV6A 4U7BA 2Z5UA 2H09A 3R60A 3LQRA 4BHBA 4NB5A 5ILVA 4HDUA 3PNAA 3DF8A 2DK5A 1EP0A 3F8MA 2Q8KA 2EK5A 4WCGA 3RKXA 4P9GA 4KICA 1E17A 2D45A 2O3FA 5ILSA 1Q1HA 2YPRA 5LGUA 2ZNZA 3F21A 4BHCA 2V79A 5LHGA 3GYHX 1YLFA 5DYMA 4CICA 1DGWA 4OIRF 3MWMA 3ABTA 4IEVA 2IXJA 3DPLC 1G3TA 1EH7A 3T5XA 3IHUA 4CHUA 5IT3A 3PLQA 1YFUA 4BXUA 2B0LA 1CAWB 4YARA 2HWVA 2P4WA 3I71A 2JZYA 1X8EA 1UD1A 4E2SA 4HSJA 1R1TA 2HEOA 2VODA 3OCPA 3ERED 1ON2A 3BPZA 5T3NA 4U0WA 1QXRA 5JAXA 3H7YA 4GGGA 3BJOA 5LLQA 4AVCA 1RUOA 4YG2F 4PIXA 3BY6A 5HS7A 5DCMB 2B9UA 1XN7A 5D4RA 4Q0UA 3HRMA 4IEXA 3EUHA 2H27A 4ENJA 5FQ0A 2LF8A 1Z9CA 2VPVA 3CL1A 4LMYA 3EJKA 2PQ8A 3GF2A 3CEWA 3MCZA 2IXCA 2QYOA 5K8SA 4A5MA 3T8RA 5FPXA 1OYIA 2PQQA 5H6RA 4D7TA 2NNYA 2A6HF 5E20A 2Q1ZB 4Q0SA 1HW1A 4IF4A 4O3MA 2Z9OA 4XF4A 4GXOA 4A0YA 1ZZ9A 1I27A 3IWZA 4UVAA 4MQVA 2V9VA 1Z6TA 3P9IA 1HSTA 2FRHA 4R8HA 1WGPA 3LZZA 3OTFA 2Z69A 3CUQB 3DEUA 4KIFA 3E3VA 2FXAA 2BGCA 2YX7A 4P5OA 3K2ZA 4OMZA 5CVUA 1H9GA 1UIKA 4IEYA 1LQ1A 2CFXA 1IAWA 5F1RA 3TKYA 1IN4A 2OQRA 3S2WA 1CF7A 4WXCA 2MC3A 5HS9A 1W5TA 5FCCA 4P55A 4MH0E 3L09A 4KIGA 4YFKF 1FYMA 4H7LA 4Q0VA 4QGLA 2EA4A 2VT3A 3EHKA 4XFAA 5ICFA 5L3DA 4KYWA 3BOQA 2H6BA 1YIOA 1WSUA 2QM3A 5JSRA 2Z33A 3HSRA 4JVAA 3ETQA 1ZG3A 2M5WA 4G7ZF 2PLYA 4LUKA 5D5WB 3L9FA 1SD6A 1CAVB 5JSOA 1J5YA 2XKOA 4P9UA 3R4KA 2EFWA 3DXJF 4EWDA 1B9MA 3KZZA 3G73A 3WG9A 3ZP5A 2JRTA 1K78A 1LB2A 3FE5A 1U78A 1DPUA 1O5LA 3J81K 3B73A 1O3QA 3ZMVA 2W84A 5A2QZ 2IP2A 3QPTA 4KN4X 3ECHA 2IVMA 1FYKA 5L3GA 1B1BA 1S7AA 4L0ZB 2BE5F 3I5UA 3NW4A 2L54A 5BPDA 1OFNA 1NHAA 2CAVA 4JTNA 2M8EA 2K7LA 3RYRA 1ZARA 2QVOA 3R61A 2WV0A 1IPJA 1S8NA 4ZZDA 1FXZA 3S7EA 3V8LA 3MFKA 3K9TA 3GO5A 2GC0A 2UY8A 1P92A 3K69A 5BOXA 4M9SA 3V4GA 4RD7A 3H3ZA 2HQRA 2CW0F 3CO7C 3FMSA 3F23A 3CUQC 1AOYA 3GFLA 1QY4A 3NRVA 1IXSB 3DFGA 3SCHA 3KGLA 3WTYC 5L3FA 4MEXF 3TO6A 3QACA 1XGMA 2VE8A 4FAGA 3OF1A 2R7FA 5JR3A 3IL2A 4Q47A 4CXFA 2RV8A 1RIOH 4XLNF 3HUGA 5HS8A 1WI9A 5BXXA 3VEPA 4BNCA 2ADUA 4M74A 4HLYA 3FMQA 2ET1A 3RZZA 2Y0OA 4EWAA 5FLHA 2PHDA 5D4SA 2F2EA 3IKTA 4A6EA 3T0YA 2EV0A 5D1IA 4G7HF 2HFHA 2GU9A 5EEGA 5CLSA 4B8XA 3GX4X 3SQNA 3TQNA 4ESFA 3WU1B 3MYXA 2ZJ2A 3FHZA 3ZMSA 1L3JA 1G3SA 4M71A 2XL7A 3KE2A 1J3QA 2OQGA 4IEUA 1SFXA 2A07F 1W4MA 3E6BA 2FBKA 2D2WA 3WTTC 2IT0A 1IF1A 2NAZA 3U11A 2DAOA 2Z99A 3PFIA 4N9HA 1G3WA 2DFIA 2GC3A 2ZO4A 1NZCA 1UHMA 5FGMA 4B09A 4IEWA 4GYGA 4QLCU 4XSXF 4HV6A 3BWGA 5F64A 4Z2YA 3VB2A 1RGSA 1F5TA 2L02A 1LVAA 5JR7B 4KUMA 2E7XA 2ZCWA 2RVCA 1V70A 5FLIA 2PJPA 4WXDA 4LB5A 3D82A 1IN7A 3WTVC 1IN6A 4MGRA 2YX4A 1IRGA 2ATFA 2XASA 4ENMA 1FPQA 3V8JA 4ZZLA 4FBFA 3HOTA 5LEJA 3J81Z 5E1XA 5TJJA 1YW8A 4OIQF 3TNQA 2UWMA 3KP3A 4IRHA 5I8TA 1PUEE 1UIJA 3WTUC 1XE8A 2XROA 2GXGA 1ZNPA 2PFWA 2A69F 1XGSA 1Q43A 2ISYA 5HLIA 3RKWA 2OAZA 2JPCA 2P5KA 1FOKA 3MZYA 4Y15A 1XRUA 2EFOA 4IXAA 2HS5A 2XVCA 3SMHA 1R00A 1SFUA 2XHKA 2BNNA 2EA7A 2DO7A 1Q3EA 2ZBKA 3WTWC 3WW2A 4IEPA 3WGIA 3Q9VA 4BH9A 5FD6A 1HSJA 1STZA 3C3WA 1S7OA 2HTSA 3GLXA 3O2PE 4JBAA 4LG0B 4IETA 4MTEA 2VC0A 1HKSA 4H0EA 1GVJA 4RAZA 2FE3A 1DZRA 2DW4A 4ENKA 4I0AA 1RNLA 4E2QA 1D5VA 2XIGA 2L01A 5BY5A 1LRHA 1I6XA 5E8IA 1IXCA 4XFCA 3M8FA 3RIRA 2XAQA 1W7PA 4HF0A 2K27A 2FMYA 3HTSB 1QXJA 3NL1A 1SD4A 5TRDA 4ZU7A 4IRGA 2O6GE 2OPKA 2O0YA 4BQAA 3HSEA 3DPTA 1DP7P 2G7HA 3ZMZA 2OA4A 3P9CA 3P7NA 4HX7A 3U9GA 1LNWA 1S6LA 5JSPA 1FX7A 3BJ6A 5LGNA 3HHGA 3EO6A 4O9EA 5J48A 2E1NA 5DCFA 2PHLA 4RGRA 5F6FA 4KFCA 5E17F 2YSRA 4WXHA 5DD4A 2V1DA 4G6QA 3RDIA 1R23A 2ETHA 1YUDA 2ZMEA 1SD7A 1W5SA 2LDUA 5DDGA 2XUBA 3BJAA 3SXWA 5LBQA 1CAUA 4IHSA 2D93A 3LAGA 3WODF 3BPVA 3V7SA 4UXNA 1EY2A 2KIFA 1R22A 4PJYA 3DP7A 4IEZA 2VECA 5I8YA 2IXIA 2PBIA 4NHJA 4K8FA 1XB4A 2F4PA 4L9JA 5E16A 4EJUA 2PAMA 3GWZA 3M3IA 1B6AA 1U3EM 2IW5A 3E97A 3I7DA 1PMIA 2OU2A 1YW7A 1V4RA 4ZYEA 2GQQA 3W6JB 1ULYA 1YG2A 1G3YA 2KXLA 3H8UA 2PAEA 2MD5A 3I0TA 1KQ8A 1MD0A 3M7GA 3QRFF 1FSHA 1YFXA 4G94A 3JSPA 4RGUA 4Q4ZF 3RJPA 3R6SA 4IPAA 1IN8A 5C8WA 1EV7A 3EQLF 5D8KB 1FZPB 2YR2A 5ERIA 4RB3C 3U0ZA 1D8KA 2QUFA 5L3EA 2EAAA 2Q4SA 2K9ZA 2EFQA 3LAPA 4G6DA 2FA5A 2W57A 3U2RA 4IHTA 2A68F 4EJTA 3BP8A 1ZZ8A 3HRSA 2IJLA 3GW2A 2QLZA 1FBQA 3E5XA 1Z6RA 4MX3A 5I0TA 1XCVA 4EWEA 4PZJA 4A0ZA 5BMZA 5KVRA 4Q48A 3EYYA 2BEOA 5A2QK 1BI1A 3HSFA 2EWNA 2F5CA 1ZN2A 3H9AA 4KIBA 2DT5A 3ZQ7A 1TQ5A 1YYVA 3ZMDA 3E6CC 3GBFA 3WW4A 1ODDA 5BS6A 5E8GA 1Z7UA 3MZHA 3JAMK 2HTJA 2CV6A 1TBXA 1L3LA 4D7SA 4EGZA 3GFJA 1W7PD 1YQAA 3RNSA 5JFRA 4XRFA 6PAXA 3U1DA 3FFQA 4HBNA 1A04A 3RPUA 1P4AA 2RGVA 4YNIA 4XF0A 3TOBA 1OR7A 1KQ9A 4EJWA 5DEQA 3I59A 1J7KA 1FSEA 2RKHA 4YIIA 2WWYA 3KSCA 4MEYF 1XSXA 1CAXA 3FXQA 5KK1A 3NEUA 1J58A 3EQEA 2HYGD 4AQ2A 4YYOA 3TO7A 5BQTA 2EV6A 4JK1X 2ISZA 3S0MA 1TNTA 4X6RB 5I0UA 1J2XA 1SMTA 2ZXJA 3WGHA 2CQKA 4HBLA 4FX4A 1DZTA 4M6YA 4X6QB 2MLGA 2VC1A 4HQEA 1BC7C 1R58A 1F9NA 4GYIA 4HV5A 1OYYA 1XCBA 5J6XA 2A6EF 1TNSA 3GUDA 3Q9SA 2XV4S 4LTAA 1J0RA 2ESHA 4HF2A 3HRUA 2DPDA 3IWFA 2NYXA 4KNYA 3OV8A 4L9VA 3C3VA 1U5TB 5KHGA 4M72A 1BJAA 5AIQA 2D40A 3FF5A 4M73A 3WW3A 4AIJA 1TTYA 3WGGA 3I58A 2QQ9A 3B02A 1USTA 4WF2A 2IA1A 2BYVE 1B59A 4KMFA 3T8TA 4LLLA 3H7JA 3HRTA 3O6BB 4WVZA 4A5NA 4E70A 4KN7X 4KL1A 2V09A 1F4KA 3LOIA 3OOPA 1T98A 2UXXA 2L4MA 1H0MA 3IIAA 2PAKA 2M1BA 1QGPA 4HDVA 1X3UA 1ZG5A 4IVNA 2W24A 3TDUC 2PA7A 5AVPA 3BB6A 2DK8A 4P9FA 5H6QA 1QWRA 5K1YA 3SCGA 1X8MA 3MDPA 4IEQA 4JV4A 1BIBA 2JTVA 2P8TA 1BI0A 3QU6A 1TQIA 4AWXB 1NXMA 3L7WA 4EQQA 1I1SA 2MNGA 2V6CA 2J5OA 4HLXA 4OOIA 1USSA 4S04A 1IZ1A 1ZZBA 4ONUA 1P2FA 3O3KA 1Y0UA 1WWXA 3JAMZ 4ENNA 1ZRDA 1P4WA 4JQFA 1HW2A 3HYIA 3ZDSA 1Z1DA 1REPC 3CDHA 3FXRA 2EVXA 2KJBA 3BROA 2UY9A 5J7MA 1E2XA 2CGPA 2OZUA 5E1RA 4ASNA 3C7JA 3TDZC 1O3SA 4LJZF 2EV5A 3CLOA 1ZREA 4Q0PA 5I0RA 2IA2A 1J75A 4I2OA 2FF4A 1R5HA 3GEZA 4XF1A 3K1PA 2M45A 1MDMA 1K79A 2JPBA 1U5TC 5KHHA 4KU8A 4L9TA 1TW2A 3VODA 1YWKA 3C1DA 5ED4A 5CVVA 1ZLJA 1GQGA 1WA4A 4NQWA 2XLAA 4XF9A 5EZWA 3CLPA 1H9TA 1EH8A 4XBFA 4LLOA 1MZBA 1T0FA 2KIUA 3I54A 1VTNC 1T38A 4L18B 4PIZA 3N4MA 2TDXA 3SHRA 3H1MA 1J59A 4ZH4F 3KP5A 4UV8A 3KZYA 3HHHA 1BC8C 2XAHA 2O1QA 4CZZA 4ON0A 4XF3A 2OA2A 1IN5A 4KA4A 1PP8F 3CUOA 2AS5F 1GXPA 4QM8A 1MJBA 4YSFA 4LLGF 2GC1A 4HX4A 5AIPA 5FFXA 3AAFA 2DQLA 1RC6A 1Q5OA 2E1CA 3KP6A 2CAUA 4HN0A 1H1MA 1PP7U 4META 1X82A 1FWZA 4XFHA 3KFWX 2VXZA 2ESNA 5JI6A 4ESBA 2MLKA 1UB9A 2WC2A 1JUHA 1WKMA 2XLFA 1QZYA 5HDNA 4QM9A 3WW1A 5KBFA 1XGOA 4ETSA 5CU1A 1MKMA 1ZGAA 2RC4A 3ZMUA 3EBRA 3KLNA 3JTHA 3LAJA 2D1HA 5FQ0B 3D0SA 2QBYA 4TLFA 5CVJA 1O3RA 3I53A 3WTSC 1I1GA 5FO5A 5DD8A 1TLHB 2FBHA 3WE2A 4XEZA 3REOA 3BU7A 1YS7A 2PMUA 3I4PA 5J8CA 2G9WA 3WTZA 4N9IA 1KU7A 4EJOA 5AONA 3ROUA 3E6DA 1CX4A 2ET7A 5D5VB 2IA0A 3N97A 1K7AA 2G7UA 4DNCA 4RAYA 1BIAA 1FYLA 3GFMA 2DU9A 5LGTA 2VE9A 1P4XA 1GHCA 3UKNA 3VOEA 3CF6E 2STTA 2MHFA 3FZVA 1SD5A 2RNJA 3F8FA 4EM0B 3GFIA 1TW3A 3F22A 1CAWA 1CF7B 5C6CA 4R52A 1OD5A 2DLLA 1VP6A 1QQIA 3ELKA 3V8KA 3QU3A 4M9ZA 4Q0QA 5H20A 4LA3A 2QQAA 4O6JA 5CADA 2C6YA 1ZLKA 5D5XB 2DPUA 1LDDA 2AXLA 1DGRA 2EB7A 4UVCA 3O14A 3DV8A 1ZX5A 2DQRA 1BM9A 3KMHA 4MUVA 5DCMA 4PIYA 2XKPA 2GXBA 1KYZA 4RB0A 4U0YA 2J5PA 4EM2A 4I01A 3NVCA 1BI2A 1U6GA 4XFGA 3L2CA 3FZ3A 3NJZA 5CYVA 1K78B 1JXSA 2Q30A 3ZN1A 4UBGA 1Z91A 3CO6C 4XSZF 2BNOA 2OBPA 1QZZA 4GCVA 3GYDA 4R79A 1LKNA 2VQAA 1FY7A 2FNAA 2P7VB 2QZ8A 3IRQA 4HLTA 2XAJA 2P17A 1XMAA 1R5GA 2NRAC 2XGXA 3QPHA 2ZKZA 3BZ6A 4IRIA 4YRDA 4RGXA 3CUQA 2R7DA 4F7ZA 4PDKA 3VFZA 1QNTA 2K86A 2BV6A 4AXOA 2ZFWA 3H1WA 2I45A 3K1MA 1FP2A 1SAXA 3JZVA 4PCQA 2KJCA 5BPIA 3J80K 2OYZA 3ES1A 5LHIA 5LRSA 3LSTA 2KIMA 2GAUA 2JSCA 5D8LB 2R3SA 3SHFA 2CO5A 4U88A 4HX8A 4EROA 1FBSA 3P9KA 4HMZA 4WK8F 2CWEA 3LA3A 2F5EA 4XLPF 1R1VA 1C0WA 1J1LA 2UYAA 5L3BA 4WWCA 2L4AA 4Z82A 1CAVA 2V1UA 3RKYA 4LEJA 1FT9A 5JHUA 3SFZA 1FBUA 5I91A 1RZ4A 3KGZA 4KWJA 1ZHFA 2EFNA 1WLTA 2FNPA 2K4BA 1VJ2A 2E9QA 1O7FA 3ZPLA 1AWCA 4QXKA 3FM5A 2FU4A 3JW4A 4EMSA 5LHHA 2Z2SB 1MJAA 1FNNA 4AVAA 1KU2A 2FSWA 2MBFA 3SXYA 4G7OF 1UCXA 3FM3A 3PQKA 1GQHA 4BAYA 5DV5A 2H0VA 2Y0MA 3PVBB 4CDGA 1HW5A 2COMA 4GO1A 1FP1D 3LA7A 1GXQA 1P6RA 1Y9QA 3HQXA 1JE8A 4MGKE 3GZ5A 3TO9A 4MGIE 1YS6A 2HOEA 3T1BA 3E5QA 1NYWA 3F8CA 4KWKA 4ZU4A 2DI3A 4XETA 2M87A 1OKRA 2OD5A 2Y75A 3EYIA 1QBJA 2RN7A 3SCFA 5HDGA 2A3SA 3F72A 2VBYA 4HQMA 5HLGA 3BPXA 4KU7A 2XRNA 4IERA 2QWWA 4S05A 3FX3A 4LA2A 4U0VA 2IRFG 1CGPA 4Q29A 2Q0OA 4O5VA 1UPIA 3UKTA 1O3TA 1HKQA 1MJ9A 1XMKA 2STWA 1S3JA 1YFYA 4Y17A 4A2UA 4UVBA 2NS0A 1O7LA 2DBBA 4L5JA 2PYTA 1LEBA 2FBIA 3JTGA 4I7HA 4I98B 4CYDA 1K6OA 5FLJA 5FD5A 2BNMA 2CG4A 4IESA 2L3DA 2ELHA 1EH6A 3D0JA 5D5UB 3DL3A 1ZGJA 3LWFA 2P5LC 1HKTA 2QDRA 4PGHA 1ZVFA 2XL9A 4RB2C 2PI0A 2FEZA 4LD5A 4KMUX 3RPQA 3MPBA 4HN1A 4AD9A 4GULA 4U7DA 4LK0F 4K2EA 2P7CB 2NNNA 1S29A 2XLGA 3GXOA 3IC7A 1ONVA 2K02A 1UCRA 2EJRA 3M70A 2FQ3A 4AIHA 3J80Z 4KDPA 4IEOA 5JCTA 1JHFA 3TNPB 3HTUA 5K5QA 1RUNA 4L5IA 1J9IA 1OMIA 4CO8A 3KP4A 5LRRA 3FMRA 2HJIA 3KCCA 1I5ZA 3KLOA 4QX5A 3M1EA 3R0AA 3WE3A 3E6MA 2DTRA 3IRRA 2QQBA 3ACLA 1LDJA 5EEHA 1W7PB 4I02A 4XFFA 4Z07A 2HKOA 1LEAA 3SZTA 3RYKA 2HDCA 1ZYRF 4M9XA 2CSOA 4G8XA 1ON1A 1BBYA 1SFNA 3ABUA 4EGYA 3WTXC 3K0LA 1DUXC 1KYWA 2GA1A 2E7WA 4L2NA 1HQCA 1L0OC 4AQ6A 4TV7A 4MGYE 4QGNA 4YFNF 2H94A 2JT1A 4HVRA 3BCWA 1YLLA 3ST7A 2M30A 1U2WA 2MPFA 1U12A 2CYYA 2RDPA 2ZMEB 1SEFA 2P6TA 3IDCB 5FB2A 1CAUB 2VONA 2QVSB 4E2GA 2LSOA 4EVIA 3QP6A 5E1WA 2C0ZA 4R1HA 2PTMA 2X4HA 3TOAA 4MTDA 4OU0A 2O61A 1D3YA 3PQJA 3ML6A 3M8EA 2FOKA 3G7DA 3EDPA 4LB6B 1Y3TA 2W85A 2VOPA 4LG0A 4IJAA 4YIFA 3H50A 5KHIA 2D5HA 3Q5FA 5J8FA 2P6SA 2VT2A 3FJSA 2D5FA 4J1WA 4FT8A 2MA3A 1U8RA 3DKWA 1BOAA 2LF7A 4I0BA 1RTVA 5K5RA 4YFXF 1ZRRA 2HR3A 4DQ2A 3QP5A 1FC3A 3KEOA 1OI6A 4ZU5A 1YO5C 1JGSA 1PM7A 2LNBA 5BUVA 1ZG1A 2A5YB 3V7RA 1HXDA 2F5DA 4HVOA 5L3CA 2B5HA 5ICEA 3KP2A 5CVIA 2GH2A 3KETA 2OZJA 3ECOA 4ZYDA 4HSLA 1ZAOA 4ESJA 3KP7A 1RI7A 1J3RA 2MH9A 4XFIA 1WQ2A 1UHWA 1J3PA 4HVQA 3U10A 1KU9A 5D6FA 4OINF 4LLNA 4LGWA 3EETA 3WU0A 1ZZCA 3QAHA 4EM1A 5DUIA 5FPZA 4QGMA 4MQ9F 4KT5C 5K5OA 1BI3A 4AVPA 2D1VA 5IT9K 2ZKLA 4N0BA 4EV0A 1DDNA 3R0JA 3OD0A 1G4DA 3I64A 3S7IA 2UYBA 2HGCA 5KHJA 3LWCA 4MHGA 1JHHA 3CTAA 4HOBA 3L00A
chains in the Genus database with same CATH superfamily
1X1AA 3DU5A 5SV5A 1XBFA 3WSOA 5I8SA 1VBD2 2O7OA 4GJYA 2X6WA 1W28A 1TME2 4LBQD 2JE9A 2ZEWA 3JQWA 5HI0A 1KQ0A 2YROA 5HLHA 1UY4A 1HRV2 3AMNA 1AR82 3RTRA 1TWGJ 1RUH2 2GC2A 2M2EA 2EA2A 4XMIA 3WF1A 4GDFA 2LTPA 3H3VK 3JBG3 3WNPA 4H3WA 5KHKA 3MKWB 5FZOA 5GLTA 4N43A 1D8JA 5EZGA 3MGUA 2OUMA 4MO3M 2HWD2 4Y7NJ 1VQPI 3BC8A 1IS6A 3IAS2 3M8JA 2J7MA 2VZSA 3C18A 3FXUA 4RFT0 3JRHA 1EV13 2RJLA 4HZFA 4GAZA 1YIPA 3HOYJ 2ACJA 2UXNA 2EIJH 1SFKA 1NE6A 1Q8OA 3UNGC 2UZKA 1APNA 1VRH3 3F6VA 2MH2A 2G1MA 3HB9A 1XPXA 4Q4X3 1UY0A 2PN6A 5FYUA 4M6XA 2PEXA 2ZGTA 5GKAC 2MGQA 3W6KB 3ZXFA 3B3QE 2PG4A 2IS1A 2ID4A 5EF6A 4CYCA 1FOYA 4QPGB 2X10A 1OYWA 1C8M1 2DVAA 3IKVA 4RB1A 3AFGA 1QNYA 4OUMA 4OIOF 2WNUA 1IOAA 1PHMA 3VUOA 4D5FA 5BNNB 1UAIA 2F5VA 4LUMA 1W6QB 2Y2ZA 2YBSA 1H0BA 4ARXA 1YI7A 1WCKA 5CFCC 4XK4A 1TZOA 5BNQA 4FHTA 1COV3 4UFJA 3ZMTA 2R7OA 2EFPA 5IT9Z 3OYIA 4UXAA 2QENA 2DFCA 1OVSA 2R0HA 2DOEA 1VR3A 3X29B 4R4XA 3FC0A 1QPIA 2W82A 4HW0A 4NPMA 4Y5TA 2JIGA 3T1LA 4MIMA 1LDKB 2DV9A 4C2UA 4OMYA 3S2DJ 4MVTA 3HT1A 3MIFA 1Y1WJ 1JZ3A 1RUJ1 1UYXA 1GANA 1YW9A 5DAVA 3AP7A 2Y48A 4QB1A 1IO2A 3KF3A 2WY8Q 1R36A 1A8DA 5IOYA 1F31A 1W8WA 4LO4B 4RQPC 2JE7A 4BEHB 2L9SA 1MDMB 4YGEA 2AUYA 4DZGA 3A23A 5GAHJ 5E88A 1F1ZA 3NMBA 4WX9A 3TL4X 1GLHA 4S2DA 1BVVA 3F6OA 3CJXA 5CG8A 1A3KA 1SQ4A 3SFIA 3SEZA 2KKOA 2EILH 3LSPA 5FFOC 1PNFA 1PDNC 1C1LA 5EJ1B 1YFHA 2EIEA 4NVPA 3HGGA 1PUFB 1G9DA 3DGTA 1FV3A 1YI9A 4WZCA 2DCZA 4P08A 1YFWA 2HQNA 3OYKA 3AKPA 1ZBE2 3RYPA 2ZS6B 1R4NB 5HVQC 2VBWA 2VTXJ 3ZYIB 2LBFA 2VZOA 3IH2A 2VBZA 1QJEA 1AR72 2O8XA 2IC1A 2WTEA 2ECBA 2EZIA 5CJ9A 1H1IA 2RMU1 4NRQA 4XJAA 1HBXG 2GIVA 3S6PA 1FNYA 3PMSA 2VOOA 5FLXZ 1C8M3 1FEXA 2QQOA 2KA3A 3N9NA 1PO22 4WZFA 5J1RA 5FV3A 3SNMA 1G6NA 2FMLA 1YE9A 5EWSA 4IO9F 2MEV2 5JVTA 5I0DA 2VW1A 2EICA 3NKGA 4BIFA 1LJ7A 2XGDA 3GZ6A 4CDWB 1ZM1A 5A7NA 2V1XA 2HNHA 2KRFA 3OGJA 1R7JA 3E5UA 4GFBA 3LIHA 2BBYA 4D69A 3ZR8X 2QBYB 4P14A 2A7AA 2B4KA 3F3XA 1Q56A 3AKRA 4QX2A 1SLBA 3KYCB 5BV6A 1N3OA 1SLCA 4PK4A 4OULA 1GOFA 1UZVA 4BHBA 2DK5A 3F8MA 4AGRA 5JOWA 1MMDA 1X4PA 1YC61 5ILSA 3F21A 4BE3A 1YLFA 1RUJ3 1W90A 4CICA 1DGWA 4M0HA 4XRSA 1G3TA 3JRIA 1JKPC 3WCRA 4B8EA 2VCMA 3W2VA 1T0FC 3IHUA 5IT3A 1UKRA 4LBKA 5BNOB 3CJIA 4EN8B 1TWCJ 3I71A 4XN3A 3WXPA 2HVRA 4E2SA 4NHYA 4R4ZA 1R1TA 1DQ6A 1R091 5HV4A 4JX0A 4U0WA 1QDOA 4C0HA 5JAXA 2V72A 4GGGA 1RUOA 5IVEA 2JDMA 4PIXA 5DCMB 3N35A 3HPNA 4Y5SA 5D4RA 2AEZA 2VKDA 4IEXA 1O8SA 2R7VA 2M34A 2IS4A 2VPVA 4LMYA 2VZ1A 2Z79A 4BMEA 2BFUS 2IXCA 3Q9OA 2QYOA 2J1RA 3WHUA 4A5MA 5FPXA 2RMU3 5F6KA 2DU0A 2L7FP 2PQQA 3HKZA 4Z6YA 3SDGA 1CJDA 1MPXA 3M4FA 4BS9A 2OQ6A 4Q4W2 4UVAA 3IDEA 4MQVA 3BTIA 2V9VA 4BBSJ 2ZZJA 5FMCA 1HSTA 2FRHA 4R8HA 2Z69A 1UU6A 4JGZA 2BGPA 1ZKGA 3POYA 2LTNA 2BGCA 1Q1VA 3K2ZA 1OA2A 4OMZA 5CVUA 3WQBA 1DLLA 1UX7A 1IAWA 5DUWA 3BG9A 1DBNA 3OPTA 3VD4A 5KC6A 3WDYA 1G9BA 1BKZA 1V9U1 4FTHA 2ZJQF 4H55A 3A2KA 5C9AA 1QQP1 4PJ0C 3EHKA 4YG3A 1WSUA 1ST8A 5IW0A 3ETQA 1ZG3A 2HBTA 4JQRA 3CCQI 4LUKA 3VLBB 5D5WB 1TE1B 1CAVB 3LEMA 4UW3A 3R4KA 2CU5A 2EFWA 2E34A 3OYBA 4EWDA 2VQ0A 3G73A 2E1MB 4XKBA 1MMGA 2JRTA 4HFSA 1K78A 1UOFA 1CIWA 2BY1A 3J81K 3B73A 2W84A 1ZQ3P 4XYXA 3FUOA 2IVMA 4PJMA 2V7FA 5L3GA 2W46A 4IE5A 1B1BA 2LK2A 2VVEA 2BXZA 1W6PB 2CJJA 2CAVA 4ITVA 4JTNA 4AG4A 1GMMA 4KGGA 3FUQA 3T30A 2K7LA 2PLV2 4FASD 4DYCA 1R093 2VW2A 3R61A 1O6UA 4GKXA 4ZZDA 1J83A 1FXZA 3V8LA 2KD7A 2X5IB 5D21A 3RQ0A 3GO5A 3BTAA 1REEA 2O0OA 4CDQC 1CJPA 4M9SA 3V4GA 2WA4A 3H3ZA 4AWDA 3WOGA 2DFBA 3CUQC 2EBIA 4LBNA 2Q8CA 4MHRA 1QY4A 1IXSB 2XJSA 5C3RA 4XN0A 3BZKA 3GZEA 3AC0A 3KGLA 4HRIA 1I1EA 4MEXF 2EXJA 3IM0A 3FBIB 5JR3A 3IL2A 4TLGA 2VY0A 3W59A 1W9WA 3HUGA 4COUA 1A35A 5HS8A 3VEPA 3HL2A 5DAWA 4AEDA 4M3CA 3K51A 1RVF2 1SVLA 1KQRA 3IT8A 1JUMA 1C57A 2XQXA 1LE8B 1WW7A 1WLWA 4EWAA 5D4SA 4A6EA 2EV0A 2VQHA 5D1IA 4A93J 2VMIA 5C3QA 4B8XA 2RNGA 3SQNA 1V9U3 1Y1VJ 1GNHA 3TQNA 2BRTA 5FZAA 1QQP3 3FHZA 1NCRC 1UN1A 3FLTA 1G3SA 3VL9A 4M71A 3KE2A 4IEUA 1SFXA 2FBKA 4CTEA 1IF1A 4QPQA 3OYWA 5H9QA 4LBJA 5HV0A 1VBC2 5A70A 1UU5A 3PFIA 4BJ0A 1KFXL 3S5AA 2DFIA 4B09A 3QCWA 3BPSA 2LROA 1VQ6I 4LBLA 4KUMA 2DOFA 2RVCA 1A34A 4QPOA 1SLAA 3CC2I 1KGYA 4A41A 4Q26A 4WXDA 1IN7A 2DMPA 3HR9A 1IRGA 2ATFA 3OD4A 1H9WA 3LEIA 2HDDA 4CCOA 3HOTA 3LIGA 2WO7A 5E1XA 4Q27A 1YW8A 5CFDA 3MLLA 3TNQA 1U5YA 4YM0A 4UT5A 2LY2A 2XROA 1ZNPA 2ISYA 2ZFUA 2JPCA 3IMMA 2HWB2 3MZYA 2OJED 3CP8A 1AZDA 1S0JA 1UMHA 1LGNA 2DDUA 2D6LX 2EFOA 4IXAA 5LK5A 3VN4A 3PFYA 3SMHA 2E6VA 2BNNA 2VBPA 2GMEA 5E6HA 1VBA2 2R49A 1MZEA 2DO7A 1Q3EA 2ZBKA 4G4FA 3WTWC 3J7HA 3WW2A 2XVGA 1DFQA 3HMYA 5FD6A 4N53A 4NWVA 1EKEA 2RM22 3TYJA 3AXEA 4JBAA 4IETA 3I3MA 5LATA 4CUAA 3CF5F 1DZRA 1ULPA 4I0AA 4CEWA 1RNLA 4E2QA 1D5VA 3TEXA 5J1XA 5BY5A 3DCQA 3TEZA 2FX0A 3OBTA 3ZKYA 3RIRA 2XAQA 3GGLA 5EJCA 4IRGA 3O8GA 3KVAA 2O0YA 1WJBA 1H2MA 1DP7P 5H9PA 4CUCA 2PHXA 2OA4A 2OQ7A 1HF0A 2EINH 3W6VA 3P7NA 4COVA 2NYYA 4NC7A 4XOPA 1AVBA 4D7YA 5J3LA 1FX7A 2HYJA 1G9FA 4Q5OA 5FLMJ 3HHGA 3EO6A 4O9EA 4MGSA 1WBFA 2E1NA 2PHLA 2YSRA 2V1DA 4AHXA 1R23A 1YUDA 2XUBA 1E5IA 2JUGA 4IHSA 3KZIC 3WODF 1I50J 3V7SA 3LOBA 2QQPA 4UF0B 2CQ7A 2DCEA 1US2A 1GZWB 3A0NA 3TMOA 3DP7A 4Y1XA 2VECA 2ZSHB 3CCMI 4A3LJ 5JZGA 5FY1A 1UZCA 1K12A 4NHJA 3BTYA 4Y3OA 4EJUA 4H2AA 3HOUJ 4X8NA 4Y1UA 2IW5A 2W52A 5LWBA 2WSUA 5J1UA 2C24A 5IVCA 2CQNA 4ZYEA 2GQQA 1JYVA 1ULYA 3ACGA 4ZYAA 1G3YA 3BGAA 2EALA 2PAEA 5F0CA 2CDOA 2MD5A 1MBFA 1MD0A 2JICA 3QRFF 2GBYA 3BR5A 1JU3A 3JSPA 4XIDA 5HCAA 1DGLA 1X1CA 3PVNA 3EQLF 2XWBB 4SLIA 1LOGA 5ERIA 1D8KA 1W3VA 4RN5A 2IVIB 2Q4SA 1VQ8I 2IEKA 2TNFA 1WJCA 3ZPYA 2YB7A 2QQNA 2W57A 5FZOB 2AHQA 4EJTA 2XOMA 2WO2A 4N43B 1HJFA 4UAPA 1Y9GA 4C2MJ 1XCVA 2KHMA 1DYKA 1YJ9I 1W8OA 1BI1A 4F83A 2JDKA 3HSFA 3H9AA 2DFFA 2DT5A 2RS31 4JGYC 1YNAA 5HPOA 4LLFA 5BS6A 2YMZA 3K4LA 1TBXA 3URFA 5DM7F 1L3LA 4PSXA 3CMGA 3Q0VA 2J22A 2HDWA 3PURA 2W94A 5JFRA 1OJLA 4AZZA 3WDWA 1S7EA 2LG4A 6PAXA 4HBNA 4CYCB 1W9YA 5FP9A 4LHSA 4QQ2A 2RGVA 4YNIA 3CMYA 1ALYA 3MUZ1 3KV5A 3TN91 3TOBA 3ZXDA 3I59A 3N7MA 1J7KA 2WWYA 3HNMA 4YIIA 3KSCA 5KXCA 5FBZA 2GNMA 1HLVA 3HDDA 5J36A 2WNUB 3NEUA 4AQ2A 4YYOA 1GWLA 5FZIA 2X53S 3JQXA 3ENRA 4JK1X 4GMP0 4NUBA 1ENSA 1FNZA 3AMHA 2ME0A 1SZBA 3G2BA 1SFYA 2ZX2A 1SMTA 4FX4A 1KRIA 1DZTA 2W39A 4M6YA 1K45A 2MLGA 5LY1A 3WG7H 4NN0A 2RS52 3LL7A 3I55I 4HV5A 1OYYA 4A3GJ 2B39A 5J6XA 1Y8RB 1OUSA 1WCQA 2ESHA 2WAOA 2DPDA 1W0NA 2NYXA 4KNYA 4L9VA 1IZ3A 2W00A 1AR91 4Y1VA 5LD2C 5ACA1 2VIXA 4AGVA 4M73A 2RS12 3WDUA 1C28A 4KG8A 3B02A 3FXMA 3LSMA 1USTA 2WN2A 2IA1A 5C3SA 4XQDA 2TRTA 1X9PA 1B59A 1ASJ1 4DZJA 3U14A 4URTA 3OL3A 4LKEA 3RZJA 4KT6A 4WVZA 4A5NA 4E70A 2L9RA 3FBYA 4KN7X 4KL1A 1F4KA 3OYAA 1LPQA 1T98A 2UXXA 3IIAA 2PAKA 3TEYA 3O1MA 3RWNA 1OA3A 2WA0A 3UGGA 5C8CA 1JZ2A 1NZIA 4NMIA 4IVNA 2VZTA 3LCPA 5K7ZA 4YFWA 5AVPA 4CDXC 2DK8A 3VDAA 4S2HA 4LBOA 2RS33 1UU4A 3MO4A 3ZO0B 4PJJA 2P8TA 3QU6A 2KLOA 1FMD1 1I9RA 4FPOB 3L7WA 3AKZA 5FZDA 4EQQA 2LBFB 1I1SA 2V6CA 1QIQA 1UHSA 1V6OA 1IV8A 4XJ8A 3O3KA 3AZWA 3TN93 1JYWA 2I8DA 1HW2A 3ZDSA 5FO9B 1D0ZA 3CDHA 3FXRA 3I2DA 3I9V2 2UY9A 5J7MA 1E2XA 1FIAA 2A6TA 1O3SA 5IK4A 4LJZF 1ZREA 3VBRC 3LMMA 3C7EA 1A6IA 4DW6A 1R5HA 3GEZA 2P2KA 4FETA 2JPBA 1U5TC 2NZ9A 2WBMA 4PLMA 4B4QA 2BOLA 5FROA 1YEWA 3OBAA 2BGOA 4B3NA 1CD3G 4BY7J 3KHBA 1XS9A 3W3CA 2MSYA 3QODA 4D7NA 2RREA 5EZWA 3CLPA 1EH8A 5FZGA 1Z78A 4NOTA 3OIQA 3I54A 1T38A 4L18B 4ZZ5A 2LRDA 1FX5A 4B47A 2C1FA 1QJU1 1DGWY 3SHRA 1AR93 3HHHA 2XH6A 3ZXSA 5KXBA 1BC8C 4XUNA 2O1QA 4CZZA 5ACA3 1SVOA 2XGCA 4ON0A 3Q8AA 2QQLA 2UWBA 1IN5A 4V2WA 3ZN6A 5HLTA 1W03A 1DYPA 3DPUA 2J1UA 5EG0A 1ASJ3 2EAKA 4GJZA 5C71A 5DTDA 5FUPA 2B46X 3AAFA 3CJIB 4PT6A 2WT2A 5GM0A 2ZJPF 4HN0A 2VOWA 4IX7A 5A7WA 3HPHA 5FJHA 5GLUA 1MSEC 2P81A 1OPOA 4HNUA 1VAVA 2MLKA 1R1ZA 1JUHA 5FP4A 1WKMA 1RUG1 5FWJA 2XLFA 1F5FA 1PMHX 3OSDA 4LPLA 4QKDA 4XDOA 1LVKA 1FMD3 2O8OA 4FQGA 3TOJA 1YQCA 3HOZJ 4FVVA 3UL2A 4INDA 4OZXA 1TLHB 3WE2A 4AW7A 4XEZA 1YS7A 3I4PA 4XCBA 1WBLA 4NROA 1E5RA 3WTZA 4N9IA 1W0PA 4V19K 2BHYA 1H8AC 3KYDB 3I2JA 3E6DA 4FPJA 4RM3A 2GNTA 3R05A 4JGZB 4UFHA 2X05A 1HB2A 4OHYA 2WDBA 2D43A 1D4M1 1SMVA 3UKNA 5IVBA 2STTA 1JZ5A 4CEYC 3M07A 2VNOA 4A3EJ 1JUSA 1H8TA 1TW3A 5IK8A 3F22A 1ZR2A 1CAWA 2WNOA 3VZNA 5IVVA 3DPRC 4R52A 1OD5A 3QU3A 4M9ZA 3SKJE 5C9AB 5H20A 5HXVA 1DLCA 2A05A 1RUI1 4GB32 5D5XB 2DPUA 2VJ4A 2AXLA 5GAGJ 3LD8A 2EB7A 4UVCA 5CYYA 2DQRA 3KMHA 4MUVA 3ZFFA 3BLYA 5JDBA 3KF5A 2W87A 1IGNA 1QJU3 4FQZA 5LA0A 1Z67A 4XOGA 4EM2A 2NN8A 3VDBA 2JD4A 2KDZA 4XFGA 1MACA 3L2CA 3FZ3A 1D0XA 5CYVA 1K78B 4QX7A 2XPUA 1QJY2 4X8PA 1WCDJ 4G9SB 1B35A 1Z0HA 2IUWA 4MXVA 2VQAA 1ND2A 1FY7A 1TZLA 2P7VB 3SEPA 4HLTA 1XMAA 1R5GA 3M3OA 3OGSA 5EEAA 5KC5A 3WDTA 3G4SI 2FBEA 4IRIA 4YRDA 3IH4A 4RGXA 5J40A 1DP3A 3QPLA 3Q8FA 1RUG3 2LOOA 4UFLA 1W0OA 1ND3A 2XPVA 2YZ4A 2AR6A 1FOWA 3RCOA 2V9PA 5KWRA 2KJCA 1GT0C 3J80K 1OBNA 1DQ5A 5T5OA 2Z1DA 5D8LB 2CGNA 2WLQA 4M3CF 4C8DA 2R3SA 2ZOEB 4MLOA 4HX8A 3RSJA 3P9KA 2Y30A 4HMZA 4WK8F 3LA3A 2F5EA 1UF2C 1ITYA 1PJRA 1SCRA 1OCZH 1EUUA 5A32A 3DF0A 3RI8A 4LEJA 1FT9A 5I91A 4AEDB 2ZC2A 4M3CB 2VNVA 2ARXA 2VXRA 4BQQA 4GXLA 1O7FA 1C3HA 1AWCA 1D4M3 1DQUA 3EPZA 2O14A 4PDWA 1HRI1 2FU4A 4JYKA 5T54A 4JKKA 4EN0A 1NA1A 5JVGF 3DYOA 2FSWA 3SXYA 3FM3A 2H0VA 4YM1A 2ZKNA 3PVBB 3VV1A 4GO1A 1FP1D 2ZXHA 1KS4A 1GXQA 5GZFA 5E3LA 2DDBA 2K3PA 4MGKE 2LD5A 1RUI3 3GZ5A 3SLIA 4A4AA 1GV9A 5FKNA 4HT1T 2HOEA 3OYWB 3N9OA 5E79C 3PL8A 2XAUA 3E5QA 1NYWA 3F8CA 2KFDA 1YRZA 3T2QA 2OD5A 4V2FA 3PO2J 2A3SA 2VBYA 2UURA 4XW3A 3VKNA 3AKTA 2XRNA 2RDNA 4IV3A 2DVGA 1NH3A 4U0VA 3NWTA 2IRFG 2Q0OA 5KR7A 5JUVA 1S0BA 4YLZA 4A3FJ 2STWA 1RUE1 5FZLA 3BOWA 1O7LA 1QHGA 4L5JA 2BP6A 4HSTA 3OBZA 1K6OA 4JZRA 3OJBA 1MMAA 4ATFA 2CFOA 4V1PA 2OUHA 4JP0A 2L7KA 3MIBA 3VBOA 1POV1 2K85A 2AACA 3PNVA 5D5UB 5FZ6A 1GP4A 3DL3A 3T2TA 3OR1C 3Q0WA 2W91A 3NNLA 2XL9A 2VL8A 4Y20A 3CC4I 4RB2C 1WJFA 2FEZA 4LD5A 4YW7A 3RPQA 2HEVF 1PVEA 3ZXEA 3WP5A 3B5LB 4R9AA 1OCRH 5GADJ 4CU8A 1S55A 3J26N 3VYSB 2CSGA 4CXWA 2FQ3A 3OSFA 2J42A 3CD6I 4N53B 5B4NA 2D7FA 2XDVA 3HTUA 5T52A 4L5IA 1AXZA 1JYNA 1JGGA 3EXUA 1S2EA 3KP4A 3DBHB 2HJIA 3KCCA 2Y6HA 3WVJA 4QPIA 3THDA 4CEWB 1HRI3 3BCAA 2BPA2 3BG6A 1TVGA 3AXDA 4L8QA 2QQBA 3ASOH 1LDJA 2ID6A 1OKOA 2HKOA 1WH5A 1D5YA 5DUXA 4AFMA 4XUTA 3EB7A 3HBZA 1Y4WA 5ISLA 2HDCA 5M3FJ 1ZYRF 1ON1A 5F6LB 1SFNA 4EGYA 1RMU3 3WTXC 3S1QJ 3BKZA 4TWTA 2GA1A 3MUY1 4L2NA 2ZX0A 1L0OC 2D6NA 4TV7A 5DZFA 1BVP1 4P1WA 3CCVI 1AL22 1LOBA 2WL1A 3ST7A 5IK5A 3AZXA 2LKXA 1U12A 3WNKA 4BQXA 3ZX7A 1ZK8A 5FB2A 2QVSB 1X1PA 4E2GA 4EVIA 4BDZA 1S4CA 2WAAA 3AP4A 3J7NA 4XUQA 1JZ8A 1UZYA 3FL7A 1MS5A 4CE8A 1RUE3 4MGQA 2DT6A 1XNAA 2GH8A 2VUJA 5JZGB 2AO9A 1ZRIA 1CZTA 2W85A 4LG0A 3TB0A 4QU2A 1POV3 5J8FA 3VBHC 3FJSA 4FT8A 4ZDPA 4XIOA 4TSVA 4XQWA 2HI3A 4DQ2A 1MQTC 1OI6A 4ZU5A 3EYPA 2FMDA 2VO5A 3GALA 3HEIA 4AI2A 5ICEA 2RR12 2GH2A 4XKCA 4AAPA 1ZA7A 4ZYDA 4HSLA 4IGPA 3M8LA 2IZWA 4ESJA 4LNVA 1RI7A 2VXJA 1UHWA 3UJOA 3K3OA 5FXZA 1WCUA 3U10A 2XPJA 4LLNA 5LW9A 1GNZA 3WU0A 1IQDC 2E35A 4UFIA 1LESA 2E7TA 3ABZA 3B01A 3Q0UA 1ULFA 3GBGA 2RJ2A 4EV0A 1DDNA 1PGW2 3OOXA 4E6KG 2ZMEC 1HXS1 3I64A 3WG1A 3AZYA 3DKQA 5JPNB 4B3XA 5DDJ1 3JRGA 1SLLA 1RHI2 1Y0NA 4ASMB 2VU9A 5LZ6A 1NQJA 1TWFJ 3CTAA 4HOBA 4XLEA 2E36A 3L00A 2E5ZA 3H42B 4I09A 2XAFA 1ZRFA 4XUOA 3WG2A 4DNYA 4NRMA 3I59B 1FMWA 2JN6A 4EJVA 1YITI 5M5XJ 3PTRB 1LOAA 1SFEA 3B6AA 3VHRA 2DMUA 2FD5A 5JPMB 1J09A 4XFBA 4BHPA 3KEQA 1OOPA 5F8PA 1W8TA 2VCBA 3RGBA 3ETPA 1B9NA 4GWMA 4GWIA 4B3AA 2Q2EA 3ASNH 3UKGA 2HYXA 3CO2A 2ZGPA 4ABZA 1XDSA 4OIPF 4YZ5A 1VQ7I 3G71I 2WRAA 3BI3A 3AL0B 1VBE1 1YQ8A 4CGZA 2PJRA 4MG2A 1U5ZA 3WV6A 4ZXKA 2BBVA 1RUD2 2CTVA 1VQOI 2XJPA 2X6OA 4WM8C 5FRMA 2XXZA 2L0KA 3LFKA 2XBO2 4N4NB 4FPCA 4RGSA 3SZPA 3S32A 3FWEA 2QA4I 1T2KA 1VBD1 4L0PA 1SBEA 2HVSA 2HYFA 2WAEA 2QF7A 1TQPA 5KNLA 1DGRM 3WINE 4A3IJ 4PI0A 3TGNA 3T3YA 1YOVB 3ZLIA 1S2KA 5HOOA 1R081 5ICGA 1NKGA 4LFUA 2YU3A 5BPXA 3AYAA 2L2OA 5J3UA 4AVTA 3P3NA 4M3GA 4FOYA 3WNNA 3T2PA 4CCMA 1QGLA 4PGGA 4M6VA 2JRMA 3KQRA 3POJA 1ETVA 5GZDA 4UV9A 5C8CB 3U37A 5FZ0A 4ET7A 3FXOA 2FQPA 4TYSA 2FZ2A 1NE4A 4K1ZA 1UW8A 1OR7C 2DCTA 2Z3YA 3ACHA 1HXS3 5CVRA 3PHMA 1DGWX 4BQ3A 1V6IA 4XICA 4Q5SF 5DDJ3 4D0QA 3I3LA 1NY71 3M9AA 1BR1A 4OHWA 2IXHA 4PJNA 4F55A 3FISA 3T0DA 1RUC1 2A61A 4OMDA 5ERLA 4IOAF 3ORJA 1YHFA 2KP6A 4HF1A 4RGGA 4AL9A 3MZ8A 2Z42A 1I3AA 3DQVC 1X3ZB 1ZELA 4I76A 1C8NA 2OPWA 1TQMA 3AG4H 4A6DA 5DUKA 2JG8A 3KT4A 5HDKA 4QXCA 3ZOBA 3V7CA 1V5FA 3S1MJ 4ZZ8A 1O57A 3S1RJ 5H2FC 4CCDA 2VZPA 2R6QA 1H8VA 1Z05A 2FDFA 3WY6A 1O4TA 1BEV1 2YG0A 1VBE3 3ULQB 3PUIA 1YI2I 4G9YA 4I3PA 2VUCA 4NPRA 4YW6A 1D0GA 4AU7A 2PFBA 4QPGC 4YEJA 3IAQA 2E71A 2LUWA 2IFRA 4FOVA 2VN2A 3WP6A 3HQRA 3WNMA 4LULA 2L7ZA 2WZPP 3K1NA 5FFZA 5LEKA 1VBD3 5T5JA 3PMEA 3MAJA 2XPWA 1T56A 5BNNC 3AP6A 3C7HA 3K46A 1MGTA 4CPBA 1Y8QB 1V5GA 1BR4A 1B8IA 5DXDA 3ZN6B 1R083 1EYBA 1T6SA 1F5JA 1VBB1 3HG9A 4O61A 5EG0B 2A6ZA 1DPRA 2F5FA 3NSTA 3MQ0A 4G12A 1IKPA 4ZTFA 4UUVA 2VBBA 4FSJA 2WB1N 1R1A1 5A7WB 3COAC 3O12A 1AX1A 3BDDA 2IXKA 4O9GA 5JR2A 3MD2A 4FAHA 3TW7A 1BN5A 1X7NA 4B29A 4ES8A 2K0GA 2QQMA 2GLOA 3GBWA 1OHFA 2O8QA 5BNPA 3THTA 4MNUA 2QNKA 4QHBA 3WT3A 2ZHNA 2K9LA 5JLWA 4LK1F 2ZNYA 4QHZA 1ZBE1 2I5UA 3LQQA 2DUPA 1V54H 4CRQA 3VDDA 1SBFA 2IXLA 2WN3A 2LC2A 1ZBA1 4QSHA 2WO1A 3LQRA 3WUDA 5ILVA 5F5IA 1JJ8C 3PNAA 3J7AY 1RUC3 2EK5A 3WHTA 3RKXA 3DWLE 1E17A 1YHQI 5TISC 2O3FA 4A69C 1Q1HA 2ZNZA 3IZOA 4BHCA 1OH3A 5J47A 3GYHX 5GLVA 3LSHA 4N90A 5J98B 5E3OA 1FAYA 3GJAA 3AG1H 4OIRF 3H5NA 5FUNA 3ABTA 4IEVA 2IXJA 4IHWA 1VQNI 1XQNA 5KXDA 3DPLC 1Z7S1 1Z3XA 1VLNA 3MPPG 5E3MA 4YGBA 4CHUA 1XNDA 1H8TB 2ZGQA 1CAWB 4FPYA 1BEV3 5F2SA 2JZYA 3IPVA 1MVEA 1E3HA 1R49A 4HL0A 3MIDA 2R5YA 2Y34A 3ERED 5AFEA 3L2RA 2WUHA 4XZUG 2EQRA 3I2KA 1QXRA 4CU7A 1JKRC 3RZOJ 3H7YA 1BA5A 3ZFFB 4YG2F 2WWSA 3BY6A 5HS7A 2ZJCA 5K7FA 3ATGA 3EUHA 5JOZA 2H27A 3BT9A 3EJKA 2PQ8A 3T0BA 3CEWA 5K8SA 5AFBA 4CDWC 4E8CA 3T8RA 1Y43B 2G4IA 5D8AA 1VBB3 2MFZA 5E20A 1B35B 4K3UA 1W6MA 5EHDA 3SQOA 2HPMA 2Z9OA 4A0YA 1ZZ9A 4QQHA 4AGGA 4XORA 3IWZA 3POIA 1L7RA 1R1A3 4AAXA 4AFBA 2XJRA 1WA6X 3VBFA 1WGPA 1W2UA 4F91B 5EXOA 4L9BA 2HWF2 1ENHA 5A3WA 4ZPIA 2I10A 4K40A 1H9GA 1EV12 3RKQA 1ND3B 1K42A 2JMWA 4RL7A 4FPEA 4HXCA 1IN4A 2YC4A 1EJ9A 4S0HB 1ZBE3 1AX0A 5HS9A 1VRH2 1W5TA 5FCCA 4P55A 4MH0E 3WF2A 3L09A 4Q4X2 4YFKF 1FYMA 1ZBA3 2F4LA 2VB6A 4KYWA 2M9HA 2R7QA 5BNOC 5JSRA 5GTHC 2M5WA 3MFAA 2RV9A 1J5YA 1LHWA 2G19A 2NMOA 5FUIA 5FY7A 2VQGA 1B9MA 1YX3A 3A03A 3KZZA 1Z7S3 1REFA 2ZAHA 4EEFG 1MSFC 2PXJA 1LB2A 4BQ1A 1DPUA 1O5LA 4NDLA 4PDWB 3ZMVA 3QPTA 4KN4X 3ECHA 1W9TA 2WADA 4L0ZB 2BE5F 1NA1B 3I5UA 1S0CA 1OFNA 3RJRA 2HPIA 1A6CA 2BJSA 4KJZA 4SBVA 5IUQA 1UG0A 3RMYA 4DOZA 4P9IA 1JBCA 1R9TJ 1S8NA 3S7EA 1N77A 3K9TA 4URAA 5F0HA 2GC0A 1V6LA 4ITCA 3VBUA 1OQDA 3A0HC 4IHYA 2VPRA 4RD7A 4ZS3A 2CW0F 1BYHA 1LU1A 1F35A 4HETA 2SBAA 3F23A 4M4PA 4P9XA 5B1BH 3CCUI 1VQKI 1IRZA 2UV1A 1URXA 4R9DA 2VNRA 2H1LA 3DFGA 4IV3B 3SH3A 3N9LA 2V73A 3SCHA 3TEDA 3K4KA 5FZCA 3K48A 5L3FA 3U75A 2VE8A 3OF1A 2OW4A 2LM3A 1OQYA 2OXBA 2VKEA 1NK3P 1WI9A 4P9JA 4BNCA 4M74A 2QQWA 3FMQA 4CZSA 4RR3A 3D6EA 4CDUA 4XMYA 3VBOB 3CDIA 2PHDA 4XILA 4DOUA 3T0YA 2QSHX 3L2VA 4A3BJ 1BW5A 2ARBA 1Q8PA 4CCNA 4G7HF 3FKJA 2HFHA 1X2NA 5B3SH 2O8KA 5CLSA 4Y20B 1IQAA 2BUKA 4BCUA 4Q8LA 4ESFA 4IGOA 2E1MC 1AJOA 2Z5WA 1L3JA 1BQPA 2XL7A 4LHNA 1J3QA 1X4OA 2A07F 3CKHA 1DQ4A 5F5AA 1W4MA 3KHCA 3NV2A 3S3OA 4N9HA 1G3WA 4GD4A 4F3JA 4JCKA 1KS5A 3A4UA 1PX4A 4XSXF 2X5IC 4Z2YA 5C4XJ 3D3AA 4QPIB 1W5CC 4LK7A 2FDIA 2ZCWA 3AZZA 4Q4V2 1V70A 2GP5A 2D5VA 3UK9A 2PJPA 3MBWA 3D82A 1T8IA 4CCKA 5IY5H 3HJEA 4ZZLA 3CQOA 4FBFA 3RQ4A 3QYBA 4U2AA 2GOMA 3AX4A 3J81Z 1UY3A 3W58A 2JUCA 2X9DA 1UYZA 2UWMA 1RKWA 1PUEE 1WLCA 3WTUC 2KRHA 2HOAA 3R4UA 2PFWA 4B1RA 1FPN2 1Q43A 1MVQA 1RUJ2 2VJJA 1REDA 4KGQA 2OAZA 2MYSA 4AI0A 1ULDA 4CCLA 5L7OA 2XVCA 3ZDVA 2XHKA 2XR4A 2EA7A 1LECA 3ZYJB 1OA4A 2DA5A 2DFHA 3CMAI 2ZMNA 4IEPA 2DOAA 3WGIA 1HSJA 4RLFA 2HTSA 3GLXA 3O2PE 2BHZA 4LG0B 2BERA 4MTEA 4LKSA 3KM5A 4RAZA 4GKYA 4ENKA 2NOGA 3OIOA 4XFCA 1OISA 1W7PA 2EIMH 3NL1A 1QXJA 2O9LA 1SD4A 5TRDA 3HOXJ 3CJRB 3RVHA 2OPKA 3HSEA 4RA2A 3AZVA 5J96B 1K4SA 2HBUA 4HX7A 3U9GA 4IV1A 5GPAA 3EUKL 4BKXA 4LG3A 5J48A 3TW6A 4YW3A 1SCSA 4RGRA 3ZQHA 4KFCA 3B7MA 4FPGA 1QF3A 4HSRA 3FN9A 2ETHA 2XJVA 1SD7A 1DGRN 2LDUA 4ASLA 3FHQA 5DDGA 2WZR1 2JWPA 1LKXA 3SXWA 2BW3A 1H2KA 1ERDA 2M0MA 1QOTA 3MLJA 1BBT1 1EY2A 5F04A 1H1AA 3KX2A 2F4OB 1R22A 4PJYA 3N7LA 4IEZA 3P5BA 4BJTA 1O4ZA 4NPLA 2PBIA 2WINB 1NQDA 1XB4A 4NC8A 2VJ5A 3BQYA 1OCOH 2PAMA 1U3EM 2Y69H 3E97A 4XLHA 4LE3A 1PMIA 4P9LA 2OU2A 2E53A 3W6JB 4P9WA 2YPDA 1X36A 3PSFA 1YG2A 2W47A 4ZKTB 5GJ6A 1CR7A 2HYKA 3ZQFA 4NAMA 5T55A 3N7JA 4Z92B 3I0TA 5JXGA 3OUIA 1FSHA 2FQ4A 2Y6KA 4PHZA 3GF6A 4EN6B 1H88C 1QRYA 1EV7A 4LO8A 5D8KB 1OOPB 2R4GA 4GA9A 3K75B 2R7UA 4RB3C 2Q2EB 4Y24A 4FISA 2CRGA 2PHFA 3Q8BA 2EFQA 3LAPA 4G6DA 3HN3A 3ZFEA 1B09A 3IAPA 2FA5A 1R092 1KDKA 1ETXA 1IUFA 2PJRB 1QVTA 2IJLA 3HRSA 3GW2A 2YFUA 4IQPA 2OC6A 1LOCA 3GJBA 4BOWA 4AQSA 5IYBJ 1ZN2A 1TNFA 2YYOA 3ZMDA 2ADEA 3GBFA 1ODDA 4II2A 1IPSA 4C0BA 3PUSA 3THCA 3TAYA 2HWC2 3APBA 2ECCA 4OHXA 1LAJA 4KI5M 3K77A 3ZSLA 5A6QA 5IT6A 1A04A 1QOSA 3CP2A 1VAKA 2MD0A 4XF0A 4EJWA 3C8XA 4OCTA 2WZR3 3DLAA 1TWAJ 1XSXA 2YBPA 5GZCA 1CAXA 1STMA 3FXQA 5KK1A 2Q1MA 3JD72 1BBT3 4GALA 4UB6C 1QJX2 5BQTA 1VPHA 2JWTA 1FV2A 1V9U2 3C2UA 2EV6A 1TNTA 4A3JJ 4X6RB 2LLKA 1QQP2 2CQKA 4B4CA 2CY6A 1WMXA 3MHZA 1D1BA 4X6QB 3LNQA 4EQVA 5EDNA 2VC1A 4HQEA 3N9MA 2V9KA 3PU3A 4GYIA 1XCBA 1WKYA 4FPLA 1VB2A 4QT6A 2ZZQA 3AYCA 4K20A 3Q9SA 1PK6A 2A6VA 4LTAA 4HF2A 1WGXA 3PIJA 1V00A 4N43C 3C3VA 5KHGA 4MFDA 1AYM2 2VOTA 1U0AA 5JIAA 3G6EI 4RAFA 5AIQA 2D40A 2R1BA 3O1TA 3WW3A 4AIJA 1TTYA 3ZQLA 3WGGA 2JG8B 2IXSA 2ZJRF 2FDKA 1JODA 2Y6LA 4W6WA 3E0JB 2JB8A 1CZVA 5FXXA 5FKKA 2EZHA 3DKXA 3T8TA 2RHPA 3H1CA 3V56A 3O6BB 4IQ4A 4CXXA 4L92A 4PFPA 1DZQA 5DPNA 1MMSA 2M1BA 2Q5TA 4HDVA 1ZG5A 5T5LA 3IH3A 2RS51 4AHYA 2WO3A 2W24A 3TDUC 1NG0A 2PA7A 1HQLA 5A3TA 3U21A 5H6QA 4DYRA 2HXOA 3SCGA 2KQRA 1X8MA 3WHCA 3FHNA 2VQCA 2XUMA 1BI0A 2WNUC 1TQIA 3AG2H 1NXMA 1VI0A 2VZVA 4OAZA 4EJRA 1IV6A 2MNGA 2XHNA 3DCFA 2P6CA 3I4IA 1B8IB 4HLXA 4YFZA 2CUJA 2HLEA 1PZ8A 3K4MA 4ONUA 2HZDA 4BXXJ 4COYA 4A6OA 2QKDA 4JQFA 4W50A 1REPC 3UT0A 3BROA 2X09A 5E1RA 3C7JA 2ZGUA 3CIHA 5M0TA 3BTXA 5FKBA 2DYCA 3E1SA 3POWA 3W2AA 4XF1A 3VL8A 2M45A 1K79A 5BNPB 4YZ3A 1S72I 5DG1A 4L9TA 1GUIA 5FMDA 2YXSA 1GOGA 2Q8OA 4J00A 2DXIA 2IVJA 1SAUA 4N8MA 5ED4A 3VDDB 4FTSA 2KL4A 4ES9A 4BLIA 2V4AA 4RDUA 1WA4A 3WX5A 4NQWA 2FCTA 4XF9A 1H9TA 2NS8A 3HJRA 5GZGA 4KNCA 1MZBA 1VTNC 3S17J 2Y64A 4DXZA 1J59A 4LORA 3O8HA 5CKTA 3KZYA 5F27A 4HKWA 1RR7A 4QPYA 4XF3A 1Y9MA 1FOD1 3CCLI 2X6YA 4E4HA 2AS5F 2F17A 4QM8A 1MJBA 4JX5A 4KMQA 2KZGA 4B7EA 3PM1A 4HX4A 5IVFA 2BV4A 3IB3A 2HOTA 2A3WA 5FFXA 2JG9A 2Y33A 1UELB 1IG3A 1RC6A 1JI6A 2E1CA 1EAH1 3IPVB 1UL9A 2R5YB 3K6GA 2R0QC 2RS53 1X82A 4ZONA 3KFWX 2D6PA 4WVWA 3M1CA 5JI6A 1ULOA 3J7MA 2WC2A 3UETA 5K7PA 3FXLA 3NV3A 3WW1A 1XGOA 2NXNB 5H9SA 1MKMA 3ZPOA 2A73B 3KLNA 5HCHA 3LAJA 2P3IA 4D3WA 2JSPA 2CL2A 1O3RA 5FO5A 2JENA 2M4GA 2FBHA 3VD7A 2Z16A 3REOA 2HQAA 4P9YA 2TBVA 5D8AB 5F39A 3BU7A 3AFHA 4YRVA 5FYMA 5J8CA 1W6MB 3CQZJ 4EJOA 4B1LA 3BG5A 2WAQA 3VBFB 1CX4A 2COBA 2G7UA 4DNCA 4QX8A 1FYLA 4AFCA 4YW5A 5CKQA 2AH2A 4J25A 2VE9A 1MS9A 2R7SA 1ONAA 2GOXB 2RNJA 4NBQA 4A7YA 4EM0B 3OYJA 5C6CA 5ABJA 1S0GA 3V0AA 3H3LA 4XIKA 1VP6A 3V8KA 3KT7A 4Q0QA 1SBDA 4LA3A 2QQAA 4O6JA 4L97A 5CEHA 3I2OA 2BW8A 2P5BA 3GXUA 1VFCA 1DGRA 3O14A 1AUYA 4BXSV 3S15J 3OBRA 3CJIC 1TT5B 1AL0G 1LOFA 2XKPA 1ETOA 2XF6A 2J5PA 5FKMA 2HEYF 5FIXA 4I01A 2QKMB 4AM3A 1FOD3 1JKQC 3RZLA 2D3RA 3H9QA 2W08A 1L7QA 1K61A 1GZ9A 4XJWA 4A3ZA 1LKNA 5A1AA 2QZ8A 2XAJA 1EAH3 4P5HA 2ZKZA 1BMV2 3MIEA 2DF7A 4YWAA 4Y52J 4RFRB 2G9ZA 3VFZA 2BZDA 1QNTA 4GB31 2QGUA 4RSUA 4X6AJ 2IFWA 3O0VA 2ZFWA 3VBUB 4GQ7A 1FP2A 4E7IA 5J4YA 2QZ2A 3DTIA 1SAXA 3LFMA 4JGZC 5EYRA 5LHIA 5LRSA 1W6NA 4QD2A 2GAUA 3AG3H 1N47A 4ZC3A 2B42B 4XLPF 3WF3A 4HKLA 1H4HA 2V4VA 5FYIA 3PUAA 1FBUA 5C9AC 5DAPA 3KGZA 2VCAA 4KWJA 2X1EA 2FNPA 2E9QA 4RR3B 4CDUB 4QXKA 2GMPA 3FFZA 1YIJI 2RS32 4EMSA 1G2HA 5LHHA 1N78A 1UWWA 1OPMA 3ZSJA 4AVAA 1KU2A 4MYEA 4YW1A 4BAYA 2ZSIB 2QQIA 2Y0MA 1M4WA 3OG2A 1Y9QA 3HQXA 1N25A 3G1OA 3O1OA 1JYCA 5FYHA 1VE0A 2WT0A 4IE6A 4M0NA 1JN2P 3T1BA 3FMGA 4ZU4A 3SYTA 3I3QA 4OI4A 4Y4RA 4XETA 1OKRA 2PQSA 5GPCA 2RN7A 5LCWL 2XF7A 3SCFA 4AFAA 5HDGA 3ZRGA 5FXWA 3ZMNA 3F72A 2XJUA 4KU7A 4IERA 4F92B 3JRCA 2X48A 1CONA 1JS9A 2GN3A 4S05A 3FX3A 4W6XA 5HCBA 4QX3A 4Q29A 5FZ4A 1UPIA 1UMZA 2XVKA 3HNBM 3S5QA 1S3JA 1HN0A 5IYYA 1T2XA 2W2IA 3DYPA 2PYTA 2BOIA 4CYDA 2JXAA 5FLJA 1N3PA 1RUF2 2X85A 1JT0A 2BNMA 2CG4A 2L3DA 3NWSA 3MW4A 2ELHA 1G9CA 2E7QA 3D0JA 2F6CA 3QQAA 4YELA 4IDZA 1HKTA 1GVDA 4PGHA 1ZVFA 4AEDC 3IAM2 1AR92 4KMUX 5M3MJ 1S2BA 3ZSMA 2VMFA 3U07A 4BBRJ 4AD9A 4KISA 2JA7J 4GULA 5EZHA 2P7CB 1GU3A 4E27A 5L7OB 1K5MA 4K1YA 1S29A 4BACA 4AQTA 2OX0A 1ASJ2 2XLGA 2K2SA 1BXHA 2K02A 4A3XA 4AIHA 3J80Z 1VNDA 3E1F1 3LOCA 2BY3A 2LRPA 2GXAA 1SLTA 5FYYA 4Q2FA 1Z7LA 1J9IA 2P0WA 3VDCA 5FY0A 2JA8J 3K3NA 4OQ9A 4ZXEA 1GQPA 1Y7BA 5DS9A 4AFDA 5EEHA 1W7PB 1FMD2 4I02A 4XFFA 4Z07A 1LEAA 3FIWA 1AA7A 2X6XA 1OFSA 3LEKA 3SZTA 1F4AA 2JA6J 4FTEA 5DZEA 4NR1A 2E2IJ 4IV1B 1UY2A 1MBHA 2NVYJ 1A78A 4AQ6A 3CC7I 2H94A 3PIPF 3BCWA 3QYFA 4XONA 1XNBA 2CYYA 5CFDC 4PLNA 2DA3A 2M8GX 3IDCB 2MG4A 2BW3B 3ZGKA 1ENXA 3DLLF 2XSDC 1IJWC 3D8CA 3IP4B 2VONA 4YVWA 4OYUA 3NJYA 4A3CJ 1UMIA 4IXLA 4LIVA 5IP7J 1GYKA 4JHTA 3TBDA 4MTDA 4OU0A 4AEKA 1A36A 3VSKA 1W2TA 1TP4A 4V2VA 2RG4A 2WKKA 5F3CA 4B44A 1Y3TA 1KZHA 4XCAA 2DA7A 5JMOA 1I3QJ 3ZQIA 2VMCA 2PHRA 1RC9A 2JJ6A 2P6SA 2VT2A 1D7PM 2D5FA 4J1WA 2ZPXA 1V6JA 1GBGA 2YFZA 4I0BA 1QJU2 4N53C 3J9SA 2YGMA 4XXPA 2K9MA 3VPRA 4NIIA 4BDYA 2A5YB 1HXDA 4HVOA 5L3CA 4CEWC 4CH7A 2ME6A 1DG6A 2OZJA 1JW6A 4COZA 5IPAA 2TUNA 1ZAOA 1V6NA 1DIWA 4XABA 4V2GA 1OQEA 4Y26A 2Y6FA 4DXRA 4HVQA 1QOOA 3ZFEB 2DUOA 5D6FA 3NJVA 2R5ZA 3JB8A 3QAHA 5FPZA 4DS0A 4QGMA 4MQ9F 1RUG2 1ORKA 3I2IA 4MSVA 2G9FA 5CQGA 1ETYA 4AVPA 2R071 2D1VA 2ZKLA 3VBSA 3R0JA 1AX2A 1G4DA 4CP2A 3S7IA 5FYVA 3VHOA 5TGTA 5KHJA 3LWCA 4IE0A 1GV2A 1UPSA 2VE1A 1PX3A 1LNSA 2HEWF 4NAOA 2W1WA 2YU1A 3JUUA 3HT2A 5JZGC 4AK3A 1SHWB 4E8DA 2VBXA 4WBBA 1JUIA 4BUPA 4PBOA 1MZ6A 4QKNA 1XSDA 5L9RA 1IW7F 4YW2A 5DAQA 1CAXB 4MV2A 1JXNA 3MKZA 1S0DA 2GALA 3BU0A 1UY1A 1D1CA 2WWJA 2FCVA 2NVUB 2XJTA 1CZSA 4FX0A 2VZRA 2A6WA 4HYEA 4NHKA 2QCSB 1W8ZA 2RQPA 2N7GA 3PTYA 2QSFX 3GVAA 3CMMA 2GNDA 5A6XA 1NK2P 2HKXA 1RUI2 2NVXJ 5K7HA 2G0EA 1P7IA 4JRLA 1HOMA 5HNHA 5IK7A 4AIKA 3NQOA 2GZWA 1PNGA 4FP3A 3EMRA 1PK6B 2JE8A 5EGOA 2W25A 5L36A 2CV1A 4QWQA 1AJKA 2BWAA 4IW3A 3T4HB 1R64A 3RS6A 2DURA 3DN7A 3BYWA 4DFSA 2H1KA 4Y5Z0 2ZMKA 2ZEZA 4E4ZA 1KA8A 2GWRA 2VH9A 2QCOA 1JZ4A 1WWYA 3LA2A 2QKLB 3AMQA 4LMFA 5FK8A 2P37A 2NVQJ 1IRFA 2FZ1A 4ASKA 5I0SA 1GOHA 4DEQA 1MBGA 2L5QA 3J7AO 3UGHA 2HU9A 2X0LA 1MBEA 3NAPA 1MNEA 1E57A 2BVMA 3IIIA 4EN9B 2R073 1SMYF 1SLIA 3GZUC 5M5WJ 3K4DA 4XDPA 3LSIA 4L11A 1JKOC 4QDQA 3GTJJ 2VUDA 4YVSA 3CESA 4XMAA 1HN1A 2PHWA 1GP6A 4OLLA 1WMEA 3AYEA 4M3EA 3DECA 2DA4A 4QKFA 4Y22A 3ZSEA 2M3AA 2DTZA 2AC1A 3VZMA 3LGRA 1ZGWA 1XGNA 3AL0C 2DVDA 5IJRA 1GR3A 4J1XA 2WBKA 1W6OA 3KEYA 3H9GA 4Y13A 3BZCA 2OCCH 1YQ5A 2CUZA 2O03A 2E1OA 5ILUA 1O4XA 3RZMA 3DU6A 1KJLA 3F8NA 3OIPA 1FLIA 2PMHA 1HB3A 4L9NA 2ZGRA 1X2MA 3O1SA 1MS1A 4DMIA 2IGOA 2DT7B 2ZXIA 2QJVA 3CNAA 4O7XA 1GUUA 4IOCF 1RMU2 4B48A 4XNFA 3ISPA 2HH9A 2ZGOA 3HC7A 4C2TA 1BJQA 4NQWB 4A0XA 3DBRB 2VMHA 4Q4Y1 4ORFA 3ZN0A 4CZCA 3C2GA 2QQJA 4QX1A 3NKTA 4LBMA 1QVUA 4FE4A 2WT1A 2GMMA 4A3KJ 1YXWA 2YPJA 2PX9A 1DDLA 5C8CC 4OHVA 2JDNA 4RGAA 4YM2A 3X2QH 1LEDA 4E9KA 3BQZA 1NCQA 2IPQX 3CCRI 4OMCA 4OAYA 2OUJA 5CPRB 4OWRB 4HPKA 1RUE2 2PMWB 2R042 1I39A 1DP0A 1O5UA 4W8JA 2JG9B 2XC7A 4WM7A 2XONA 2DWRA 4BPZA 4QX0A 3H92A 3IBMA 5FY5A 1T39A 5FOJB 3G3ZA 4A12A 1PM4A 2VKVA 3PUBA 3ZXGA 3BR6A 1KGSA 2R7XA 1WMDA 4DIQA 3M7AA 3QPSA 3FLPA 2X8KA 3DEMA 4H14A 4Y4YA 4XKVA 2XJQA 4GWJA 1UKGA 5E1ZB 1Q8QA 4QDRA 3GTGJ 2PMZN 2P1BA 2WZEA 3J7ZI 3HXLA 2ZX1A 3R60A 4NB5A 4D6RA 3BOPA 3DF8A 1EP0A 5FP3A 4KICA 3O5SA 3O1PA 5LGUA 2V79A 5LHGA 3I3BA 3ZFGA 4JAAA 4M00A 3CJQB 3K2OA 2BXYA 2ZA9A 5EYYA 1X1BA 4QXHA 2VOXA 4JQTA 1WZXA 3JRFA 2RE9A 5C3OA 3WD5A 4D94A 3PUQA 3WR0A 3T5XA 1YFUA 4BXUA 2GDFA 4HK9A 1G7YA 1QEXA 2A6XA 4YARA 3MFCA 1US3A 5ABJB 1JJ6C 3H35A 4BK4A 3V0AB 3HOVJ 1X8EA 4LQRA 2ZXWH 2W95A 1PIV2 3OCPA 5JXHA 4DJAA 1MS4A 4Q4Y3 2FJ1A 9ANTA 2B7YA 3BJOA 4D7MA 1G9AA 1VQMI 5FY9A 3HNYM 2VNGA 4Q0UA 4K21A 1UYYA 5HNFA 4ENJA 5FQ0A 2LF8A 1U0JA 3MCZA 3IKWA 3THPA 1DCSA 1YYNA 4BJ5C 5H6RA 4D7TA 2BVVA 5EYXA 1GSLA 5FLVA 2A6HF 3HOBA 2Q1ZB 4Q0SA 4CPBD 5F1JA 4O3MA 4XF4A 5APAA 1I27A 4D6QA 3D5SC 3P9IA 1S0EA 2P6HA 1ZTRA 4N4OB 5FYCA 5C5TA 3RFRA 3DEUA 1OLQA 4FFHA 3E3VA 2FXAA 2R16A 4XE9A 2P34A 2JDPA 4P5OA 3OYCA 1UIKA 2VG9A 1LQ1A 5F1RA 1QU3A 3HOWJ 2ZBJA 2OQRA 1NLRA 1V6KA 3S2WA 4WXCA 2MC3A 1W99A 3WF0A 5FZHA 2GIZA 4KIGA 3ZSKA 1W6NB 3RZDJ 4H7LA 4Q0VA 4QGLA 2EA4A 2VT3A 3K70D 5ICFA 5L3DA 2J1SA 1YIOA 2WZ8A 4OQ8A 2QM3A 3C2HA 1H8TC 3ZQQA 2Z33A 3HSRA 2NM1A 4JVAA 4RS5A 2PLYA 1LGBA 4XBNA 3L9FA 2NQYA 4GH4A 4DPNA 2XKOA 4P9UA 3OUHA 2OV7A 2K9QA 3VSLA 2VI6A 2DU1A 5FYZA 3WG9A 2HWF1 2E2JJ 3ZFFC 3L2YA 2AENA 5A2QZ 1M1EB 2ZACA 1HXS2 1FYKA 1H2NA 3NW4A 5EP9A 2Z4FA 1E5SA 1F2NA 5DDJ2 2FDHA 2JVHA 2M8EA 3ZXLA 1EA3A 5BNGA 2W1OA 1TNRA 3RYRA 1ZARA 1MS8A 3ZVXA 2FDGA 1B35C 2JIJA 4EE2A 2UY8A 1TT0A 3CJTB 1P92A 3FBMA 2VKHA 5DG2A 3K69A 4IL6C 5BOXA 3BG3A 1OC1A 4BY1J 4A7KA 4XOTA 3FMSA 1YJLA 3DEWA 2EPFA 1OSGA 1HX6A 4D8MA 1HB4A 3F0CA 1ND3C 1UOJA 3T4VA 3NRUA 3TO6A 3QACA 1Z21A 2JA5J 1LU2A 3LDRA 4FAGA 4D9JA 2AGSA 4Q47A 1RKTA 4XTMA 1IHMA 4CXFA 4C3HJ 4O65A 1CIYA 2VGDA 1O59A 5C4WA 2ADUA 4RLQA 4HLYA 3WP3A 5EV7A 1O4YA 3VHNA 2Y0OA 5FLHA 3IKTA 3MIHA 1HLCA 3LSJA 3A01A 1SDWA 4DXSA 2GU9A 1X1DA 4M3BA 1AF9A 3GX4X 1XMXA 3OYNA 1XTAA 1WW5A 3CZJA 3A7QA 1S1AA 3MYXA 2ZJ2A 5E89A 5DUUA 3ZMSA 3PJRA 4PDWC 3VKMA 1R082 1DU3D 1K5MB 1RB8G 3I56I 3WTTC 2D2WA 2XB0X 2NAZA 1NA1C 3DXTA 2WNVA 3MMYB 4AIDA 2A6YA 3HAGA 5IHRA 2VMGA 2GC3A 1NZCA 5FGMA 1TMF2 4IEWA 3Q3SA 1GLNA 4C3JJ 4QLCU 4HV6A 4LITA 2KZVA 2TEPA 2HWF3 5LK7B 2LP0A 3R0RA 3VB2A 1F5TA 5JR7B 2E7XA 2M4KA 4BQNA 3T09A 2A5ZA 1W3XA 4FFGA 1LHOA 3WTVC 1IN6A 4LIUA 4MGRA 2YX4A 1NY72 2XASA 4ENMA 4IV3C 5LEJA 4UOJA 4DYQA 4AF9A 1JOBA 5TJJA 2W68A 4OIQF 3BTCA 5I8TA 1RUC2 2E26A 3H8RA 3ILNA 3VZLA 2GXGA 2A69F 4BISA 1ZA4A 4II3A 1QMJA 4DBRA 3GHMA 3RKWA 5AC91 2P5KA 3OGGA 3VBOC 2Y0SA 2HS5A 3NO8A 2DYSH 4YVWB 1R00A 1SFUA 1PO11 4Q4V1 2QQUA 2KIQA 3RZHA 1BEV2 3PVOA 3SZGA 3C3WA 1BK0A 1CPMA 4H0EA 4FTBA 1GVJA 3HQUA 4BQOA 3BTJA 1RETA 1LRHA 5E8IA 1UZWA 1PZ7A 4A44A 4HF0A 5C70A 1FPN1 2O6GE 2R7TA 1YIFA 2G7HA 2JX9A 1G59A 3ZMZA 4QPIC 2EZLA 5M5YJ 1VBB2 4D5CA 2JDZA 1LNWA 5FREA 3OYGA 4JHZA 5JSPA 3BJ6A 1S0IA 1HQNA 1FTTA 2VMEA 4BQWA 1R1A2 1DQ1A 5DCFA 5F6FA 5E17F 4WXHA 2OS2A 3RJ2X 3W5MA 3GM8A 5FMOS 2KISA 4U87A 2R5ZB 1SG3A 3FHAA 1TEIA 3S3NA 1DHKB 2VXDA 1F9KA 3AP5A 5K0UA 1CAUA 5DMYA 4UXNA 1YQ2A 4GMP1 4UUSA 5J37A 3VBSB 3GZAA 2PMZA 1W9SA 1OF3A 5KXEA 3GTLJ 3PJYA 1U9NA 1V0AA 1ZBA2 4K8FA 1W05A 3HUGB 5E16A 3MEPA 3GWZA 4RGKA 3M3IA 4XUPA 1B6AA 3I7DA 2FCUA 4LHLA 1K4TA 1YW7A 2VBDA 4DUXA 4FFFA 3O7OA 3IDAA 1BCXA 4YZ4A 1LOEA 2A1XA 3GZNB 2CW7A 1JH5A 2E2HJ 2XB6C 2H0BA 1FYUA 5AC93 1GZTA 3ZMOA 3M7GA 1YFXA 1Z7S2 4XL9A 4TN7A 4RGUA 2LW8A 1W0UA 2PELA 4OUSA 1RXGA 4L5EA 1UJ8A 3RJPA 5A3OA 3OGRA 3R6SA 4B7KA 4IPAA 1IN8A 5C8WA 5SV8A 1PO13 2XB5A 2FUG2 4CSWA 4Q4V3 5EIYB 4DY5A 3V0BA 3U0ZA 2QUFA 5L3EA 4PF1A 2YS9A 3SKVA 1ETKA 2K9ZA 2F48A 3N9PA 1J1TA 2EF6A 4FCAA 3U2RA 2MW8A 2XWJB 3UGFA 1LCLA 5DAXA 4AI3A 1ZZ8A 2QLZA 1FBQA 1KXGA 1X19A 2A5WA 3E5XA 2HWE2 5I0TA 4MX3A 4EWEA 1OQ1A 2KT0A 5KVRA 3EYYA 2BEOA 4LKDA 3VHPA 3CU7A 2DCYA 2EWNA 2F5CA 2XG3A 1SACA 5EGOB 1FPN3 4KIBA 4UB8C 1YYVA 5EJZB 5KCMA 3WLUA 2F4IA 4XLCA 2ARAA 5E8GA 2WLPA 3JAMK 2HTJA 1VF9A 1GP5A 1YJWI 2QEXI 3MV01 4EGZA 5IFPA 3GFJA 2OKXA 1W04A 2L9VA 2R061 4LO6B 1W7PD 1HC8A 3RNSA 3K2AA 1VAMA 1C4RA 3CZ6A 5CFDB 2ORXA 2L7MP 5JVVA 3RPUA 4TTGA 1QH7A 2YHJA 3F95A 2X51A 5DEQA 5IYDJ 5C4JJ 1FSEA 3T1MA 5CAZA 1GWKA 4Z2WA 1WJEA 1NXD1 5CFCA 4XTPA 3TP0A 3OS2A 3EQEA <