4N9HA

Crystal structure of transcription regulation protein crp
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
201
structure length
201
Chain Sequence
PTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of inactive CRP species reveal the atomic details of the allosteric transition that discriminates cyclic nucleotide second messengers.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
molecule keywords Catabolite gene activator
total genus 55
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4n9hA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4n9hA01
2K86A 5LHHA 3I4PA 1VP6A 5BXXA 5FLIA 3LQRA 4L5JA 5E8GA 4TLFA 3GFMA 3BCWA 2L01A 3V4GA 5J6XA 2KIUA 2UY8A 1U3EM 2VE9A 1Y3TA 5ICFA 5J48A 2BBYA 1H1IA 1XDUA 1CAXA 4H7LA 1BJAA 1W7PA 2XL9A 4HVOA 1S7AA 4BNCA 1WKMA 1YLLA 4WXHA 2RV8A 3G7DA 3DF8A 3IBMA 1ZAOA 4XBFA 1BBYA 5TJJA 3BDDA 3JTHA 1REPC 2FU4A 4LUMA 3HT2A 2COMA 2ZKZA 4FX0A 3C3VA 1O7FA 4IEZA 3UKVA 2EV0A 4IRIA 1T38A 1QY4A 1CAXB 4G94A 3SFZA 1YYVA 1ZARA 2N7GA 3ZMUA 1J59A 2Z3YA 1QGPA 2VC1A 3TO9A 3ULQB 5DCMB 2GU9A 2DQRA 5JR3A 3TNQA 4I7HA 5E8IA 1J5YA 2XGXA 3O14A 4MV2A 1Z6RA 2BV6A 1T39A 1SD6A 5L3BA 2FNAA 1J75A 4XF1A 2V09A 4X6QB 2V9VA 5JSRA 4O5VA 1D3YA 1XCBA 2GA2A 4ESBA 1RGSA 4G9YA 2BNNA 4P55A 3V7RA 4Z2YA 4WCGA 2CG4A 3CF6E 4L0YB 3HT1A 3CO2A 3M7GA 4LGWA 1YTYA 3H7YA 3IRRA 1TQIA 1OR7A 2XV4S 4ENJA 5D5UB 4HN1A 1CAUB 3HHGA 2HKXA 3RPQA 2QCSB 3ZMDA 4UVBA 1WGPA 4HW0A 5DCMA 4Q5SF 3WE2A 1QWRA 1LEBA 4UBGA 2FSWA 3H1YA 4IEOA 4ORFA 4O9EA 3KP2A 3DV8A 2HYGD 3B73A 1NZCA 4HSJA 4GXOA 2IW5A 3MFKA 4RB3C 2V1XA 5L3GA 2STWA 3HQXA 1UB9A 5KVRA 1Z1DA 5D5XB 3P9KA 1K79A 5H6QA 2BE5F 4MQ9F 1QNTA 1W5TA 1WQ2A 3TO7A 3VHRA 5JAXA 1CAUA 2OZUA 4L9TA 2PFWA 2IXKA 4U7DA 4XLPF 3Q9VA 3TO6A 1UD1A 2K9ZA 3LAGA 3I59B 1XB4A 3Q9SA 4JTOA 1J2XA 4UHTA 4IRGA 3IDCB 2K27A 4ZZLA 3KEOA 3FXQA 4ESJA 2A3SA 3PQKA 1AWCA 2L4AA 3BZ6A 2BNOA 3DL3A 4LB5A 3RNSA 3J7AO 3CO6C 4MGZE 2HJIA 3CTAA 2M5WA 3WGGA 3H1WA 3E6MA 5DEQA 2MLKA 2P8TA 3GFLA 2FMYA 2ET7A 2K4JA 4YIFA 2XASA 3I59A 4M73A 3M8EA 3P7NA 4PGHA 1XCVA 2VECA 2VBWA 3NEUA 5D8KB 3FX3A 3L00A 3E6CC 1DGWA 3M3IA 3T8TA 1J3QA 5LHIA 3ZMZA 5H6RA 3SCHA 2EFNA 4P5OA 3K1MA 3NW4A 4R8HA 5FFXA 4G8XA 1FP1D 3REOA 1TNTA 2JPCA 1H0MA 2PAEA 2F5EA 1XE7A 1ZLKA 5KHKA 4EGYA 2C6YA 2IT0A 4QGNA 3P9CA 2QWWA 2CV6A 3C18A 1G3SA 2NNYA 5AONA 2GA1A 2HOEA 2CAVA 2HQNA 1ZRCA 3ZMSA 2IA1A 1CX4A 2PQ8A 4MGIE 1ZYRF 2QDRA 4MH0E 4RB2C 5I8YA 2A07F 4N9IA 1Z9CA 4AIJA 1TW3A 5LBQA 3GUDA 2BGCA 2Q2EA 4FX4A 2PEXA 2GC0A 3ZN0A 1NHAA 3KP4A 4LEJA 1R1TA 2O8XA 3F22A 1J1LA 1XGOA 2ZNYA 2O1QA 3RYKA 5ERIA 1L0OC 3FM5A 3CLPA 2RVCA 2DQLA 2VONA 5FD5A 1ZLJA 2K7LA 3VODA 2E7WA 3LAPA 3JZVA 2R7DA 6PAXA 2OD5A 4IEXA 2QQAA 3JW4A 3OGJA 5ICGA 4AVPA 3KE2A 1O5LA 5CVIA 4R1HA 3U10A 1RC6A 1XE8A 3GBFA 4MGRA 3G3ZA 5KHHA 1R23A 2AXLA 1RIOH 1USTA 1QZZA 3WTSC 2XLGA 1G3TA 1USSA 3D82A 2A61A 5FQ0B 1R7JA 1ONVA 1UHWA 2VQAA 2ETHA 4L9NA 2ATFA 1HBXG 4LG0B 2BYVE 2D5HA 4MTEA 2PQQA 3MWMA 1IN8A 3S7IA 2EFQA 2MBFA 3ABTA 5E1ZB 1B4AA 1J3RA 4U0VA 1W4MA 1ZHFA 2MA3A 4HDVA 3QU3A 4Q48A 2P17A 1O57A 2K4BA 2IVMA 2Q0AA 1IAWA 2ACJA 5F6FA 3V7SA 3BROA 4UVAA 1RZ4A 4RGSA 4F7ZA 4LK1F 3WTVC 1TBXA 3H3ZA 1MZBA 4NVPA 1FNNA 4IXAA 2QZ8A 4KDPA 2IXHA 4EJWA 4Y13A 1OYYA 4CXFA 5FLJA 4I98B 1I6XA 4RS8A 1SFEA 3AAFA 5ILUA 1G3WA 4O6JA 3ZN1A 1NE6A 3CJXA 2DAOA 4QM9A 3ZPLA 1KU7A 2VPVA 4IVNA 4ZU5A 2A69F 4Y15A 3FJSA 3R0AA 4LJZF 2NRAC 1SFUA 3KP5A 1R00A 4ZYDA 1UCRA 5LHGA 1ZRFA 1FZPB 4AIHA 1QQIA 3M1EA 3FHZA 3JAMZ 4U7BA 2XKPA 2F5DA 3RKXA 2D40A 4G7HF 3ZMTA 2RGVA 4HYEA 3F72A 5FB2A 1YHFA 2CWEA 1CAWA 1JXSA 5BS6A 5L3DA 4EGZA 1PM7A 3V8KA 2NS0A 1EPZA 3WW4A 2XUBA 4XFAA 1PP8F 4KYWA 5BPDA 5AVPA 4BH9A 3ZP5A 5KBFA 2UZKA 3M70A 4IHSA 2G7UA 2KJCA 4M9ZA 2Y0MA 3K0LA 3OF1A 3HRMA 1A04A 3BJOA 4U0WA 4QGMA 4PZJA 1XN7A 3JSOA 3E6BA 4EMSA 4EM0B 5I8SA 5JSPA 3QPTA 2Z2SB 1XSVA 3F23A 3OD0A 4KWLA 4XEZA 4I01A 2UYBA 1Z7UA 5JHUA 1O3TA 1U2WA 4OIPF 2HKOA 5F1RA 4XFGA 4PIZA 3FZ3A 4ZH4F 2F2EA 1SAXA 4Z07A 2XAHA 4R79A 1VR3A 3J81Z 1HSJA 3IL2A 3PQJA 3KP6A 3E5XA 5E1WA 4JK1X 1YIOA 3GYDA 5L3FA 3H7JA 3HOTA 1AOYA 4G7ZF 1YW7A 2FE3A 1TTYA 2HR3A 4ENNA 2BNMA 3ECHA 2XL7A 2MHFA 2ISZA 1F1ZA 2OU2A 2RKHA 3J80Z 2E7XA 2D2WA 5L3EA 2VC0A 4IESA 3RDIA 5BPXA 1WA4A 1O3QA 4AD9A 1ZZ8A 3IIAA 1KGSA 3LWFA 1UCXA 2WTEA 1FSHA 3ECOA 1KU3A 4FHTA 5BOXA 1ZG5A 1T6SA 4I0BA 1Z05A 5JFRA 5D4RA 4WXDA 3RTRA 2Q30A 3RJPA 4DINB 1R22A 1QO0D 5CYVA 2QVSB 2QJVA 3S0MA 2HEOA 1KQ0A 3GX4X 4J1WA 3MYXA 1IPJA 1WWXA 1XGMA 1PUEE 2H94A 4Q47A 1CAWB 1LQ1A 4EV0A 3H92A 1X7NA 4QX5A 4S05A 3QAHA 2EFPA 3WTUC 2MC3A 3WW2A 1U5TC 1ZG3A 1J3PA 4M74A 4LFUA 3F21A 4JTNA 5I93A 2HDCA 4MZUA 1MJAA 2MPFA 1LRHA 2DPDA 2F4PA 3SCFA 2HS5A 3BWGA 3CUOA 1Q5OA 4IEYA 3WTYC 3S2WA 1BI0A 2FMLA 1JHHA 4EM2A 5BY5A 4WVZA 2FBIA 4LLLA 4ZZDA 5BUVA 1B9NA 2CAUA 1R5GA 2FQ3A 5DD8A 3T5XA 1IN6A 4RGRA 4WF2A 1XMAA 1U5TA 2XROA 2OBPA 5E17F 1SMTA 3OOPA 2BEOA 3ZMVA 3WE3A 1J7KA 3FHIB 1FOKA 2M30A 1IN7A 1ZGAA 2ZJ2A 2JTVA 4A6DA 3KGLA 2Z99A 3ST7A 3T0YA 3LQQA 5CVVA 3HSFA 1P4XA 4CGZA 3WW1A 3KMHA 1WRJA 3LFKA 2PMUA 2IA2A 2WC2A 2KKOA 3I58A 3L2HA 3COAC 2QVOA 4D0PA 3WTWC 1R58A 3RZZA 3HRTA 1T98A 4OIRF 3EYIA 1IF1A 5BQTA 2GQQA 1XSXA 1H9TA 4A5MA 1BN5A 5AIQA 4NQWA 4IEPA 3HSRA 3BALA 1KU2A 1ZN2A 2Y48A 4A0XA 5I91A 3WU1B 3H9AA 4PIXA 2IXJA 1F4KA 2QQ9A 4DNCA 3OCPA 2YSRA 1L3JA 5FPXA 1NE4A 3TOBA 1SFNA 1QXRA 2WWYA 2YPRA 1WSUA 3ZQ7A 3DPLC 2OA4A 4PCQA 3IKVA 4YG2F 1P92A 2HWVA 4KNYA 3I0TA 1ODDA 1SQ4A 5DDGA 1OMIA 1RL3A 3HHHA 1D8KA 5HLIA 3SXWA 2MD5A 2XIGA 4YRDA 5HVQC 2R3SA 3KFWX 4Q0SA 1S7OA 4KIFA 3O6BB 3C3WA 5E1XA 2QBYB 1W5SA 3IWFA 3ERED 2TDXA 3V7CA 4YIIA 4OMZA 1BI1A 2GC2A 3ES4A 5E16A 1QPMA 4AVCA 1T2KA 2LF8A 5T3NA 5HOOA 2STTA 3QRFF 1JGSA 2VOOA 1IN5A 5HLGA 1KA8A 1DPUA 4KICA 3RKWA 4HMZA 4LLGF 2EB7A 3EJKA 2LF7A 2XAJA 3FMSA 2F5CA 1MDMB 2GWRA 2ZFWA 2VBZA 4Q0PA 5I8TA 2V1UA 5ED4A 3GZ6A 4L2NA 4WK8F 1QBJA 2PMHA 2Q8KA 2MH2A 3K69A 4XRFA 3J81K 3BB6A 4DQ2A 5HDKA 1WI9A 4XF0A 1P2FA 2DK5A 4LTAA 1YFXA 5D6EA 3BP8A 1T0FA 5AIPA 5KK1A 2EA7A 2ADUA 1IW7F 1EP0A 1C0WA 4LUKA 2LKPA 1UFMA 1ZZBA 4LULA 3B02A 4IHTA 2J5OA 3NQOA 4KIGA 2ESHA 1MD0A 3E97A 4JQFA 4U88A 2PLYA 1EV7A 2XVCA 2QENA 4OIOF 4MX3A 3T1BA 1OFNA 2QLZA 4Y17A 3BJ6A 2YU3A 1FBUA 1B59A 2PI0A 4L9JA 2WV0A 1E2XA 4MTDA 3H8UA 3BPXA 3F8CA 4YFKF 5FDBA 4CO8A 5EZWA 1P6RA 3KLNA 2K02A 1ZX5A 4P9FA 1BC8C 2GH2A 5A2QK 3LAJA 1BIAA 5HDGA 5CADA 2H0VA 3H1MA 5KHJA 5DYMA 2DLLA 4HVQA 1IRGA 2FNPA 3ROUA 4FAGA 4BYYA 4BAYA 3M8FA 2MNGA 2QM3A 2V1DA 4GO1A 4HX8A 3HTSB 2VT3A 3SZPA 2ESNA 2RC4A 4KMUX 3TGNA 4KL1A 1DZTA 1HXDA 1ON1A 2X4HA 1FY7A 1GQGA 4A2UA 2HTSA 3LWCA 1LB2A 5ILVA 2D45A 4KIBA 1ON2A 1YFUA 3TDUC 4I0AA 4BHBA 1PDNC 4EVIA 4M72A 3GO5A 1YG2A 4NHJA 3K1PA 3E5UA 2B8MA 3LA2A 3KLOA 1K78B 3ETQA 4P9GA 3O3KA 1HSTA 3F8BA 4HX7A 1XMKA 1GXPA 2PAMA 3WGHA 4H0EA 5BMZA 3GEZA 4OMYA 3R60A 5CVRA 1IRFA 2CW0F 3BU7A 3CLOA 4QGLA 1Y0UA 4F8AA 3FF5A 4MUVA 4ZYEA 1CAVA 1X8MA 2B9UA 3L9FA 1HQCA 2IP2A 1GHCA 2MLGA 2W84A 4XF3A 3LA3A 2IA0A 1O4TA 5D8LB 3FMRA 5FLXZ 4HLXA 3ZDSA 2QQBA 4P96A 4ZYHA 1JE8A 2OQRA 4XETA 3H50A 3USSA 4G6QA 2ZBKA 1UIJA 5IT9Z 2PHLA 2GXGA 4E2GA 3PNAA 3MZHA 1STZA 4HZFA 5JVTA 4OU0A 5JCTA 2EV5A 1XGSA 4Q4ZF 1Y9QA 4JV4A 2RDPA 1V70A 1ZRRA 2V6CA 3KP3A 1BC7C 1I5ZA 2Z33A 2IXLA 3WTXC 3LOIA 5CVUA 4HV6A 4AVBA 3QOPA 3W6JB 1CAVB 4A12A 5K5RA 5K5OA 4A6EA 5H20A 1B6AA 3SXYA 1MJ9A 3U2RA 4HSLA 2CQKA 2ISYA 4K2EA 1ZZ9A 4X6RB 1FBQA 1XD7A 1J58A 2F5FA 2FA5A 4B09A 1ZVFA 3NVCA 4M6YA 1IPKA 2XRNA 4LB6B 2KIFA 4I02A 4EJOA 3PFIA 3PVBB 3FZVA 2RQPA 5E20A 1S29A 4FBFA 2LNBA 3F8MA 3CO7C 3F6OA 2EFWA 2VE8A 3LA7A 2O03A 1ZZ6A 2EWNA 4FT8A 3E6DA 1RUOA 5D5WB 1XDSA 5ICEA 1XGNA 5JR7B 3HYIA 5JI6A 4J1XA 1YWKA 4Q0UA 4M6XA 5JSOA 3Q5FA 1SEFA 2CFXA 4EJVA 4Q0QA 3IDBB 1KYZA 3H3UA 1ZZCA 4YFXF 1YO5C 3DPTA 3TOAA 2GXBA 4L5IA 3KGZA 2VXZA 2XKOA 3FE5A 4ZU4A 5DCFA 4XLNF 3HRUA 1FI2A 3MDPA 1KQ9A 1R5HA 4JVAA 3R6SA 1TQ5A 5C8WA 5J7MA 5DD4A 2XLAA 5LRRA 4CICA 5IT9K 4CDGA 1TNSA 4E70A 4L9VA 5D4SA 2DK8A 3I5UA 4N0BA 3IKTA 5BPIA 4HN0A 4RGXA 2D93A 1OKRA 4BHPA 3FFQA 3GWZA 1LVAA 3IWZA 1CGPA 3DXJF 3SHFA 1LEAA 3BJAA 1YFHA 4BQAA 4IRHA 2P5VA 4G6DA 3NL1A 1K7AA 2HYFA 1P4WA 4UBHA 2DT5A 2DW4A 5EEHA 4FAHA 1MGTA 2Y75A 4EWAA 1H1MA 4UUVA 1BM9A 2G7HA 4KWJA 2NYXA 4WX9A 2IC1A 3V8LA 4CHUA 1QZYA 4L18B 2P7VB 2VN2A 1NXMA 2GZWA 5D1IA 3QPHA 1RNLA 4RB1A 1JHFA 2RNJA 3OTFA 4IPAA 2L4MA 1RUNA 2VOPA 3RIRA 1MKMA 4XF9A 3GF2A 3K9TA 1V4RA 1LKNA 3MAJA 2H27A 4EJTA 5CU1A 3ISPA 1LR5A 4LG0A 5FFZA 4KN7X 3GW2A 1UPIA 5CJ9A 1Q43A 1OYWA 3FM3A 1ZGJA 4HDUA 4M9XA 4GYGA 3GFIA 1ZRDA 5DV5A 4KMFA 5HLHA 2EV6A 1EH6A 1TQMA 2YR2A 2B5HA 3K1NA 4HF1A 3VFZA 3HTUA 1ZNPA 3GLXA 3ACLA 3MZYA 4AQ2A 3WTTC 4TV7A 2Y0OA 3D0SA 1Z6TA 3DN7A 4O9GA 3CJNA 2W24A 2W57A 3OV8A 4QLCU 1EY2A 3R4KA 2EA2A 4XF4A 3I71A 1D8JA 1FYMA 1Z91A 3N97A 2DI3A 1FC3A 1YQAA 4LLNA 4I2OA 5LEKA 3W6KB 1G4DA 3VOEA 4ASNA 5FD6A 1I1SA 4M9SA 2FEZA 4ZYGA 3VB2A 1U6GA 5CVJA 4Q0VA 2K0GA 4WXCA 2LSOA 1BI3A 1FP2A 1U8RA 2P6TA 2PTMA 3O2PE 5FLHA 3K2ZA 2UY9A 2PN6A 1GXQA 4HQEA 2Q1ZB 1ZREA 2KXLA 1O3SA 1FYLA 1KQ8A 1PP7U 2LDUA 4RD7A 2WFPA 4HBNA 2CYYA 4IF4A 1ZG1A 5DUIA 5LEJA 2EJRA 1E17A 2JPBA 4B8XA 3JTGA 1DPRA 1UIKA 1EH7A 3DFGA 1GQHA 1TW2A 3VEPA 3QACA 4GULA 3EUHA 4HLYA 1K6OA 1YFYA 5KHGA 4HBLA 2ZNZA 3D0JA 2JRTA 2P5KA 3R61A 1SMYF 4AXOA 3U1DA 2ZKLA 1B9MA 2UXXA 1VTNC 3I64A 3M9AA 4KFCA 2D1VA 3TNPB 3EETA 1JUHA 3ELKA 2IJLA 5F64A 2O61A 2O8QA 4KU7A 5C6CA 1J0RA 4PIYA 2C0ZA 3UKTA 4LMYA 1VJ2A 3S7EA 1S8NA 2X0LA 3MCZA 2PJPA 3V8JA 1B1BA 2XAGA 1YUDA 1DZRA 5K1YA 3F8NA 4RAYA 2UYAA 5I0SA 1XSDA 1J9IA 1PMIA 4AVAA 3F3XA 4UV9A 1FBSA 2VODA 1F9NA 1G3YA 5KHIA 2ETEA 4QWQA 3SCGA 4Q29A 4BXUA 5K5QA 1SD4A 3F6VA 2E9QA 2QYOA 1SFXA 5LLQA 1LJ9A 1U12A 2OQGA 5J8FA 2GC1A 5K8SA 1ULYA 5E1RA 1V3FA 1HKSA 2IRFG 4UXNA 3SMHA 1R1UA 1H9GA 4YYOA 5FCCA 3SHRA 4K8FA 1BOAA 3WGIA 4R52A 5FLXK 1IXCA 2PBIA 4QXKA 3I54A 1IXRC 2XAFA 5HS9A 3KP7A 3MEXA 4UNOA 5HS7A 1Q3EA 1FSEA 2FBKA 3KSCA 2Z5UA 2PA7A 4BHCA 3HSEA 5BV6A 5FO5A 3HIFA 2EVXA 4UV8A 2FOKA 2D1HA 2KJBA 2DFIA 5LGTA 2GIVA 1HW1A 3MQ0A 5L3CA 4RGUA 4MEXF 1HW2A 4EROA 4PGGA 4KA4A 1HKTA 4GCVA 1U78A 2L3DA 5LRSA 3RPUA 3TDZC 4KU8A 1FYKA 4GYIA 2IXCA 1Q1HA 2FXAA 4KUMA 4M71A 1EH8A 1FLIA 4YFNF 2PHDA 3BPZA 2P5LC 3P9IA 4L11A 4UVCA 4WBBA 5I0TA 2H6BA 2VT2A 3KZYA 3U11A 1U5TB 2XAQA 4HQMA 3EQLF 1X82A 3EO6A 2PAKA 5D5VB 4E2QA 1NYWA 2OA2A 2JT1A 1R1VA 3HOSA 3EYYA 5J3UA 2O0YA 2V79A 5IT3A 3E5QA 2D5FA 1ZZ7A 4LLOA 4MNUA 4XFCA 4IEUA 1TQPA 3GVAA 4HOBA 3QP6A 1FPQA 2CO5A 5J8CA 2YX4A 3IC7A 3N4MA 1YLFA 1O7LA 1L3LA 2M87A 4XFBA 2AS5F 3WW3A 1RI7A 2CGPA 3LZZA 3GXOA 4AIKA 2KIMA 4RAZA 4ESFA 2QUFA 2I45A 4S04A 3CUQA 3RKYA 3GYHX 4BIFA 1LDKB 1MJBA 2P7CB 2W85A 2EAAA 3WODF 3CDHA 4MGYE 3WTZA 3HUGA 1S3JA 2YX7A 4HF0A 2A68F 2E1NA 5HI0A 2Z69A 3E3VA 4CYDA 5ICCA 2M45A 2Q4SA 4LK0F 4N9HA 2FF4A 4I3PA 4D7SA 4ENMA 2XHKA 5FQ0A 3SQNA 4A5NA 5ILSA 2FBHA 4ON0A 4YARA 3GZ5A 1XRUA 2JSCA 1DGRA 3JAMK 3CUQB 2UWMA 2QBYA 3D5LA 2HTJA 4JBAA 1OI6A 4PJYA 1SD7A 5EFUA 4IEWA 2NAZA 1GVJA 3CUQC 3FMQA 4E2SA 3CEWA 4KT5C 3BOQA 4HVRA 4O3MA 1YS7A 3HRSA 5TRDA 1DUXC 1FT9A 4HA8A 3WG9A 4P9UA 1TLHB 3UKNA 2Z9OA 2A5YB 2HGCA 4MHGA 2W25A 3EDPA 3C7JA 1IUYA 4UXAA 4XFHA 2M8EA 5D6FA 1G6NA 1LNWA 2UXNA 1DP7P 2VBXA 1MDMA 1R36A 1KU9A 3ABUA 5I0UA 5LGUA 1D5VA 3DQVC 4Z82A 4XSXF 2EA4A 4LA3A 2DCTA 4OINF 2DPUA 4LD5A 2O3FA 2O6GE 2PG4A 3IHUA 4QMAA 1IZ1A 2ZXJA 3TQNA 3JSPA 3TKYA 3LSTA 3ES1A 3L7WA 4MQVA 2J5PA 1KYWA 3ELNA 2OAZA 1O3RA 3KEQA 4EWEA 3U0ZA 5LGNA 1DDNA 1FXZA 2L02A 5A2QZ 1YFWA 2FRHA 5EEGA 4A0YA 3QP5A 4GGGA 3NRVA 2HQRA 5DUKA 1BI2A 2ZMEB 3FXRA 4IERA 4WWCA 4QM8A 5FGMA 1YS6A 1SD5A 3MPBA 5E18F 3KETA 1LDDA 3DEUA 1X3UA 4A0ZA 3KCCA 3GFJA 2R7FA 2IPQX 1O5UA 1FWZA 4D7TA 4XFIA 1OYIA 4EJUA 4IETA 3QU6A 2ELHA 3WU0A 1WLTA 3T8RA 1X8EA 5FPZA 4G7OF 3RI4A 3RYPA 1QXJA 2ZO4A 3F8FA 3C1DA 2ZMEA 4OFGA 2XLFA 2L54A 4HX4A 2KRFA 2VBYA 3IRQA 4AQ6A 4RB0A 3KZZA 4OIQF 4YNIA 2H6CA 4ONUA 1EYBA 4U0YA 2M1BA 2DTRA 1I27A 2ZCWA 3U9GA 1P4AA 4EWDA 1UHMA 3ML6A 1ZH5A 5HS8A 3I7DA 3J80K 3CL1A 1LDJA 4ETSA 3NJZA 2Q0OA 4ZU7A 1CF7A 3RYRA 4IJAA 3EBRA 3NSTA 4LA2A 4KN4X 1YW8A 3R0JA 2GAUA 1K78A 3BY6A 2CSOA 4I09A 4ENKA 2EFOA 3PLQA 3EQEA 5CLSA 4META 1I1GA 1UW8A 3L2CA 2HFHA 1S6LA 1YW9A 4IEQA 3FWEA 3SZTA 4OOIA 3FXUA 3NKTA 2ET1A 2PFBA 2GC3A 3G73A 1FX7A 1CF7B 3EHKA 2DU9A 1OPCA 4HF2A 1HKQA 2HZTA 4XSZF 4HAMA 4WZCA 2MH9A 2JZYA 3DP7A 2B0LA 4IEVA 3I53A 4CZZA 4MEYF 3L09A 2P6SA 2E1CA 4HV5A 4NB5A 1F5TA 3DKWA 1OD5A 1BIBA 2OZ6A 2A6EF 3BPVA 2EK5A 4PDKA 2RN7A 1IXSB 5HDNA 1W7PD 4OLLA 2FQPA 4AWXB 2OPKA 4KWKA 1IN4A 4EQQA 4HLTA 4MGKE 4B29A 2IXIA 2OYZA 1RTVA 2PYTA 2DBBA 4EM1A 2A6HF 4YSFA 4XFFA 2OZJA 2P4WA 2H09A 2QNKA 2NNNA 1W7PB 4L0ZB 2G9WA 2DO7A 5I0RA 1HW5A
chains in the Genus database with same CATH superfamily
1DGRN 1F9KA 1BZWA 4BPZA 2FDFA 4NMIA 3VZOA 3BCWA 1BLZA 2H8WA 1POGA 2VQTA 3N9QA 1Y3TA 1Y1WJ 5ICFA 2IS4A 5J48A 1UG0A 4IGQA 1PK6A 4LO6B 4E6KG 4H7LA 1WH5A 4PJNA 1W7PA 5FPUA 3LSMA 3M3CA 1H4GA 5A3PA 3J9SA 1PO21 2QE3A 2CV0A 3VBFB 2R6QA 4LR4A 3WDUA 1Z21A 2JDAA 3M3QA 2MG4A 4XBFA 1BBYA 1GT0C 1X2NA 2ZXHA 3BC8A 2WNVA 2JICA 2ARBA 5BYNA 3C3VA 4JKMA 2Y2ZA 4F55A 4AUXA 1O7FA 3L1PA 1DLCA 1TMF1 3C8XA 2VZTA 1QY4A 1CAXB 5ACA2 3SFZA 1YYVA 2YU2A 2Q5TA 4EN6B 4A93J 3ZSKA 3S93A 2Z3YA 1G9DA 3C7GA 2QKLB 2VC1A 2GU9A 5F5IA 4AE2A 5E8IA 2LK2A 2XGXA 3O14A 2DDAA 2LG4A 3OPTA 5FY0A 5L3BA 2WYSA 4V19K 3NNGA 1BJQA 2QA4I 3IAPA 3CP8A 2AEYA 2VPRA 4HT1T 1D3YA 4HK8A 2GA2A 1RGSA 3S2DJ 3BG7A 4Z2YA 2CG4A 3D8CA 1W99A 1YTYA 1W9SA 1D2QA 2QBXA 3IRRA 3PJQA 4IV3B 3HHGA 1AA7A 2HKXA 2QCSB 3HB9A 3AMNA 4B1LA 4R9BA 4HW0A 5DCMA 1W6PA 4EN9B 2EPFA 3WE2A 3SKVA 5KHDA 4UBGA 2FSWA 4ORFA 3WT3A 3KT7A 3FL7A 4GXOA 1ND2C 1YJ9I 2V1XA 4HONA 5J1UA 1COV1 5KVRA 2XH6A 3OJBA 3AZZA 1OCPA 3JD71 3P9KA 4KT6A 3HN1A 3KHBA 3P3PA 3T4VA 1WQ2A 4AK3A 1CAUA 4LKSA 2PFWA 1VBB2 1GWMA 2YXSA 4N43B 4JTOA 4L0PA 1J2XA 4XLFA 4UHTA 3ZXSA 1WLCA 5SV5A 2GLOA 4RQPA 2DBNA 3RQ0A 3HGGA 3OOUA 2QQPA 2A3SA 2ZTNA 1YCIA 4C9YA 2HQAA 1W90A 4AI3A 3QBQA 1MZ6A 3K70D 5C71A 5IP7J 3BZ6A 2BNOA 1HF0A 3RNSA 4LB5A 3CO6C 2BFUL 3CTAA 2M5WA 3CJTB 3WGGA 3E6MA 3QCWA 4LIVA 2R49A 4GJYA 4Q4V2 1CN1A 1WJBA 2F17A 2LROA 4EEFG 4DYQA 4DZPA 3QH7A 2VBWA 3SFIA 3NEUA 1RUF3 4AFAA 4UFHA 3L00A 1DGWA 3D6EA 2CQ7A 3M3IA 3WF2A 3O1TA 5H6RA 2JN6A 3ZX7A 1I3AA 4R8HA 1SPPB 1Y56A 5FFXA 4G8XA 4IDZA 3H8RA 1SVOA 3REOA 2I2SA 2JPCA 2QQIA 2VOXA 3TN92 2FDIA 3ENRA 4GWMA 1AXYA 4UFIA 2G19A 1BMV2 4NOTA 5KHKA 2Z5WA 4NR1A 1NA1C 1VIWB 5K0UB 4MXWB 3BTCA 3P9CA 2QWWA 1K4SA 2VXRA 1BBT3 1IS4A 2WLQA 4Q26A 2PHRA 2GA1A 3R4DB 3FIWA 5KC5A 1ZRCA 2XJUA 1CX4A 3OYDA 1ASJ3 1KRIA 4Q4V1 1NCRA 5F32A 2A5ZA 3NV1A 4AIJA 1W8OA 1LOCA 2P34A 3INAA 2HWE3 1QJY1 2GC0A 4ASKA 1IS6A 1C8NA 2AR6A 1AR91 4LEJA 2PELA 3N3HA 2O8XA 3RYKA 5ERIA 2VW2A 1W1WE 3KF5A 2RVCA 3FBNB 2DMUA 3A4UA 2R7DA 6PAXA 2G9GA 3JW4A 4PFPA 4BQWA 3BTJA 2WO2A 4F83A 1O5LA 2F4LA 4R1HA 3ASIA 3DLLF 3MW2A 3W5MA 1NK3P 1RIOH 5LWBA 4YZ2A 5DG2A 2O5RA 1PX3A 1HV0A 3HXLA 4XMIA 2A61A 3NAPC 5FQ0B 2RM22 2ETHA 2ATFA 1X58A 1HBXG 2RS32 2FDGA 2NPIA 1WW6A 3MF9A 2EFQA 3LSHA 5E1ZB 1B4AA 4CYCB 1J3RA 1W4MA 2R7RA 2W95A 1D0YA 1A35A 2P17A 2O14A 4OI1A 2K4BA 2ACJA 4LPLA 3BROA 2RDNA 4UVAA 1U5ZA 2HXOA 3K4JA 4IE4A 2EF6A 4NVPA 3LDKA 3IV5A 2BP6A 4EJWA 4NPRA 1VBD1 5FZCA 4P9JA 1O4ZA 3IDEA 4MXWA 1WFXA 2Y6GA 2W3JA 1LHVA 1B35B 1NE6A 3AKRA 4QM9A 3Q3SA 2VPVA 4IVNA 4CDUC 4Y15A 1OCRH 4DRVA 2KM2A 1SFUA 3KP5A 4A42A 3BZKA 4AL9A 4WVWA 1VQOI 4U7BA 2RV9A 2F5DA 4CP9A 3OYWA 5ANQA 1WWYA 1JHJA 1G2HA 3CMGA 1R9TJ 5B66C 1YHFA 3K2AA 2VZSA 2CWEA 2HWD3 3BTZA 3GTMJ 2ZX1A 5BS6A 4EGZA 2VKHA 3V8KA 1DP0A 1EPZA 2UWAA 2XUBA 3I3MA 4A3IJ 5BPDA 5FYSA 1TVGA 1Z7S3 1QQP2 2LFBA 3CDIA 3O5SA 4HKOA 2WT1A 2Y0MA 3K0LA 1WKYA 4WM7C 1JTYA 2F4OB 4N53B 3OR1C 3OY8B 5FZEA 2C9AA 1UKRA 1OOPC 4ZJZA 2E51A 2E1OA 4Y52J 2DT6A 4CDQA 3MD2A 1JU3A 4HNVA 1G86A 2VASA 1W3VA 1OA3A 4OIPF 2HKOA 2WWJA 1ETYA 5F1RA 1RUE1 4Q4X1 2OW4A 1A34A 4JKKA 4PIZA 3B5LB 3FFZA 2X09A 4Z07A 1F43A 1V6IA 3ATGA 2XAHA 1VR3A 4CCLA 3J81Z 1RUF2 4GJZA 3C7HA 3PQJA 1W2NA 4UT5A 3PIGA 1Y1VJ 2W1SA 1YIOA 4CEWC 3GYDA 3H7JA 3HOTA 1OVPA 1AOYA 4YVSB 2ORZA 3WHUA 1TTYA 2DFBA 1BW6A 2XL7A 2ISZA 2VVFA 2R5YB 4YW1A 1MEC2 1NY71 4XPVA 2GNTA 4R9AA 5BPXA 1OT5A 1XB9A 4AD9A 5A6ZA 4Q1RA 3IKWA 4YZ5A 2WTEA 5EZHA 1A6IA 2WRAA 3AL6A 3ZXJA 4K6BA 1T6SA 1H30A 1UZCA 3ACFA 3HJRA 5D4RA 3JBG2 2Q30A 2ZMLA 4X6AJ 1XNBA 1H89C 4NUBA 1ZBA1 4CCOA 5CYVA 2QVSB 4CXYA 1KQ0A 2VAUA 2N8GA 3GX4X 1LJ7A 1IPJA 1XGMA 1JKQC 1CAWB 1V6KA 1S7EA 3CZUA 4QX5A 4S05A 1DLLA 1HRV2 5D8AC 2FCTA 3WTUC 2AQEA 4A3CJ 4N4NB 2HWB2 1JKOC 5ANNA 2A05A 3NARA 1QPIA 2RMU1 4MZUA 3VD3A 1MJAA 3H42B 2Y0SN 4E7LA 4ZTFA 3KWVA 1E3HA 3KYLA 1YQ5A 2BJSA 4QSHA 2FMLA 1JHHA 4WVZA 1VQ8I 3O0WA 3ZFGB 4ZZDA 2Z16A 3WF1A 4NIAA 3V0AA 3HPGA 1B9NA 2E71A 3WNLA 3T5XA 4WVVA 1IN6A 4RGRA 3O12A 1MZ5A 1MQTA 3ACGA 1SMTA 1RUE3 1I50J 3ZMVA 2K9NA 3FHIB 1IN7A 2JTVA 1OXCA 3T0YA 4M0NA 3HSFA 4CGZA 2ZGSA 3KMHA 3ZFFC 3I58A 4EATA 3WTWC 3GLLA 5DUWA 2GN7A 4YW5A 2WJSA 2ZFUA 5HXVA 1C8M2 3CJIA 1UX7A 3OL3A 4FOWA 2NVTJ 2IGKA 4FPHA 5BQTA 5JPNB 1KEXA 2BDRA 1WA6X 5IOYA 5C5TA 4AEDC 1CIYA 5FXWA 3SKJE 2Y48A 2NS8A 3J4UH 3VYTB 2ZJQF 3WU1B 1UZWA 3H9AA 2GP3A 4PIXA 2E6VA 3KVAA 4GKXA 1F4KA 4DNCA 2KA3A 2YSRA 5E6HA 4YGCA 3N9LA 3H35A 5FZIA 2LRPA 1Z7LA 1QXRA 4GFBA 2JEMA 3J8F3 1VNDA 3DPLC 3CC2I 2CS3A 1N47A 4XBQA 1BYHA 2FJ1A 3WSOA 1SQ4A 1OKQA 3HHHA 3MIBA 4I76A 2W52A 5HVQC 2ARXA 4A3GJ 2R5ZA 1ND3A 5HODA 1W2OA 5E1XA 2QBYB 1NOVA 3CJQB 3ERED 4M01A 4FXKB 1SDWA 1US3A 4OMZA 1BI1A 4XDQA 3T0BA 5GLWA 1QPMA 3CMEI 4RAFA 2LF8A 5HOOA 3JUUA 1IDYA 3AVRA 1WCQA 1IN5A 4KICA 4HMZA 2G1MA 2JVHA 4ZKTB 1D0XA 2LF7A 2XAJA 1HRV1 3WX5A 2LY9A 3FMSA 5HNHA 2F5CA 1UMHA 3T2TA 2B42B 4BISA 5CKQA 1RMU3 3GZ6A 4WK8F 1ZQ3P 4D5CA 1ZR2A 4M3EA 3K69A 2CWMA 4NIDA 1MNEA 1WI9A 1Y8QB 4IL6C 2OPWA 1YC61 1OKOA 1P2FA 5FYCA 1YFXA 5E3MA 3OYKA 1UELB 1ST8A 4AFDA 2VUJA 5AIPA 2EA7A 5L73A 2VJJA 1FPN2 2JUGA 1EP0A 5IYCJ 1K61A 2LKPA 1F5FA 1WGXA 2X6XA 2J1UA 4IHTA 2R071 1K12A 4KIGA 4IZZA 1XU1A 3E97A 4JQFA 3C2BA 4U88A 4FPYA 4CUGA 4IE0A 2QENA 2E7AA 2XUMA 4O7XA 4XDOA 2QFEA 2BXZA 4C3IJ 4ZYAA 1FBUA 1NLSA 5FY7A 4A44A 2WV0A 1E2XA 3OB8A 3FC0A 3EXUA 3RKQA 1D2SA 4GQ7A 4KGGA 5FDBA 4BE1A 4XQ4A 2OXBA 1BBT1 1ZX5A 3J7AY 1BC8C 2GH2A 5A2QK 5DPNA 3LSIA 3M7AA 3H1MA 4Y7NJ 2JKXA 5KHJA 3I2IA 2WNVB 5JR2A 2FNPA 3S3OA 1ODMA 3VHPA 1GZTA 1LGBA 1UOBA 1DGWX 1D1CA 5FPAA 1RYYA 2Y6FA 5F3CA 5CPRB 3DXTA 4BQ4A 5L36A 2VT3A 3SZPA 4CU9A 2ELKA 3TGNA 1U0AA 2X4HA 3AP7A 3RZKA 3LWCA 4JHTA 2D98A 2WB1A 2Y6HA 5C4WB 4BHBA 1IS3A 4M72A 1T95A 3M3EA 4Z8BA 5FFOC 2OS2A 4E7JA 3E5UA 1K78B 1N1SA 5FZ8A 5FV3A 2EZKA 2YFUA 3VZNA 2XBO2 2P5BA 1HA8A 3OGGA 2JECA 1XMKA 1GBGA 1GXPA 2PAMA 5BMZA 5KWRA 5CVRA 4PHZA 5B2GB 4F8AA 4MUVA 1Q8VA 1S0BA 1NCQA 1CAVA 5C8CA 2CU5A 1H2MA 2W84A 4IO9F 4XLEA 3DEEA 1O4TA 5D8LB 4DXSA 4K3UA 1UZZA 4LBQB 1DQ5A 4MOAA 3ZDSA 2WY7Q 4XETA 3H50A 3LNQA 2NVXJ 3USSA 4G6QA 1UIJA 5IT9Z 2NQYA 1F4AA 5JZGC 2OUMA 4GXLA 5HV4A 5DM6F 1RUD1 5F0FA 3C2UA 5JCTA 1W3XA 4Q4ZF 4MYEA 3MFCA 1ZRRA 1I5ZA 2Z33A 1RKWA 3BYWA 3PTYA 2B45X 5HCAA 4HV6A 1L7RA 2VD7A 5BNPB 2V5YA 3DYOA 5DUVA 5K5RA 3QYFA 4RQPB 3ZFFB 2CWSA 3V0BA 5EJCA 3SXYA 3MPPG 1WJAA 4HSLA 3WDWA 2JIJA 1ZVFA 2HH9A 2FA5A 3ZXKA 5DABA 4OI0A 1TME3 4I02A 5K7HA 3PVBB 1MPXA 2KFDA 2R041 4FFIA 4DXZA 5IK4A 4C8DA 2DJNA 2EFWA 2O03A 3ZM8A 2HWB1 3WY6A 3A1YA 5C3SA 1OCTC 1XDSA 3O8HA 5ICEA 2FMDA 4IHWA 3AC0A 4BJTA 3I3QA 5FRNA 3PFYA 2OKXA 2CFXA 5HNFA 3THPA 4BMBA 1KYZA 3H3UA 3G1MA 3AFKA 2L5QA 1MNDA 4L5IA 2VXZA 1P9QC 3FXOA 3JQWA 4ZU4A 2CY6A 5HBAA 2H1LA 4XLNF 3CC4I 3HRUA 3U78A 4R4ZA 1UYPA 4B4PA 1NX9A 2E33A 4WVMA 5C8WA 4CU6A 3JRDA 1Y4WA 5KXBA 2XLAA 5H9SA 5FUIA 4CICA 1P8JA 1RR8C 5D4SA 5ISLA 1TZLA 2RHPA 1AHSA 4BE3A 3FHAA 5BPIA 4LBQA 1XNDA 3M8LA 1I3QJ 4WM8B 4BHPA 3O8GA 3FFQA 3GWZA 3A21A 3IWZA 1OUSA 2XJTA 4IRHA 2P5VA 4BK5A 5AFEA 3G6EI 4XILA 3WQ1A 3H5AA 4Z2AA 4QPIB 1V55H 1AR62 3VBRC 3WNMA 5ABJB 1JYIA 2O8KA 3V8LA 3GJAA 4CHUA 4L18B 1XSQA 3DEMA 5FPBA 1S0CA 1VQ6I 1RUI3 2VZPA 1MZEA 2BVMA 2D6NA 2XJRA 4RB1A 5FZ9A 3RZHA 1JZ5A 2VOWA 2KPMA 1QH6A 3WU2C 2VOPA 4B3XA 5A70A 4BJ0A 5DAQA 1V4RA 2VJ5A 3PSIA 2MABA 4CP1A 2H27A 1GOFA 1LR5A 1HQLA 5FFZA 3GW2A 1UPIA 1Q43A 3THCA 3RWNA 3FM3A 3GFIA 2EIDA 1ZRDA 5GZDA 2EV6A 5HLHA 3VDAA 3E1SA 5K7FA 1TQMA 2WUHA 3POYA 4HF1A 3OOXA 3GLXA 5C9AB 3ACLA 1RUD3 5J1RA 4XQWA 3HM5A 4O9GA 4URTA 4AVTA 5IFTA 4RHV2 1OISA 4LBNA 2W24A 2W57A 4QLCU 1NK2P 1MIJA 2RMU3 5H9QA 3RS6A 2EA2A 1ODNA 3NQHA 1D8JA 3WQ7A 1Z91A 1N25A 4FVVA 2DI3A 3PUQA 4AAXA 1QA6A 4I2OA 1I1SA 3VOEA 4ASNA 1G4DA 4M9SA 2FEZA 4A6SA 3VB2A 1U6GA 5CVJA 1B8IB 2OTJI 1WCDJ 3GCXA 3L9JT 2XJPA 3I4NJ 4FCAA 3CQOA 3ZQGA 4HQEA 4A3JJ 2Q1ZB 3ZQIA 1E5HA 2EINH 1FYLA 1PP7U 1AKHB 1XBFA 3O1PA 4HBNA 2VZQA 5DUIA 2YGLA 2EJRA 4II2A 1EKEA 3ACHA 2YC4A 4XUNA 2XMLA 4D7MA 1EH7A 1W2TA 4LORA 3BR1A 1K4TA 3RPUD 3WDVA 3QACA 4A41A 4NRMA 4HLYA 1BK1A 2Z79A 3S15J 5AC93 5LY1A 3D0JA 4BACA 1G9FA 2RE9A 1SMYF 5TISC 3U1DA 2DODA 4K40A 3I64A 4N53A 4A3MJ 2D1VA 3IH3A 4XAAA 3BG3A 3ZN6B 2BY1A 4LMYA 1K5JA 3S7EA 2E36A 5CQGA 4Q5OA 1H2LA 5A6QA 3F8NA 1RC9A 4JOMA 2UV1A 1X1DA 1PMIA 1FBSA 1RVF2 3KYDB 4DPNA 3QOEA 4GAZA 5C9AA 4MXVA 4QWQA 2YGMA 4Q29A 5D2AA 1IQDC 5K5QA 1W8TA 3F6VA 2F6CA 1W8UA 2R7SA 2OPTA 3BCAA 3O1MA 1UMIA 5GALA 4AOCA 2GC1A 5K8SA 3O1UA 1VMJA 5E1RA 1X50A 3SMHA 3PDQA 1R1UA 4OQ8A 1D5YA 1UN1A 3T0DA 2G9ZA 3SISA 4Q4Y3 5FLXK 2PBIA 3ZOBA 3WR0A 4AEDB 3K4KA 1IXRC 3JBG3 5HS9A 1UAIA 2G0EA 3PU8A 5JWPA 4UNOA 3G71I 5HS7A 4CEYC 4LNVA 2Z5UA 3OBAA 4CUAA 4P9LA 3HSEA 1K6YA 3K4ZA 4QDRA 2EVXA 4L99A 4UV8A 3IH4A 1F35A 3IAM2 5LGTA 4FTEA 1HW1A 5K9YA 4MEXF 4EROA 4PGGA 4GCVA 3PHMA 2L3DA 5LRSA 1I1EA 1GICA 3IDAA 3AKZA 1FYKA 4CUBA 2DCEA 2IXCA 4PF1A 1PO11 2BUKA 5GTIC 2MEV1 2JE8A 3WDYA 4MG2A 2NN8A 3LEGA 2YUEA 3P9IA 3KCXA 1RJ8A 1ZM1A 4UVCA 4LXLA 1QJU3 2H6BA 2HQ5A 2VT2A 3U11A 3ZKYA 2OT7A 4NN0A 3GDBA 1MQTB 5C7GA 4PSXA 2JA8J 3LGRA 4ET7A 4E2QA 2OA2A 2JT1A 1VBB3 5FY5A 3GXUA 2JA6J 2M34A 4XURA 5J3UA 1P7IA 2D5FA 2CTVA 2CUEA 3MUY1 5IWFA 2OC6A 1SLTA 5IY5H 3MKZA 1NCRB 4YG3A 3W21A 5D8AA 4NC6A 1S0FA 3A01B 1LE8B 4B8EA 2WYFA 3WW3A 3S8PA 1RI7A 1PM4A 1ETOA 5FXVA 2KIMA 2LBFB 2YBKA 2A3XA 3RKYA 3HOXJ 1F15A 1VRH3 5LBBA 2L2OA 4XUTA 1AR93 1JYWA 1S3JA 2YX7A 3ZR8X 1VBD2 2JDNA 3ASOH 3VBFC 2JDUA 4LK0F 2FF4A 4K9SA 4M3CF 1FMVA 1ETWA 5DAWA 3N9MA 5GZEA 3GZ5A 1CD3G 3JAMK 2D3PA 4IQJA 1UMQA 3D5LA 4XW3A 5FMBA 1SD7A 1E0EA 2K85A 1ZA4A 3SJMA 5EFUA 2NAZA 3CUQC 3BQZA 5HXMA 3DYPA 1WJ5A 1JTZX 1WJFA 1IHMA 4O3MA 2JE7A 1NG7A 1DUXC 1ULEA 2BW3B 4Q1PA 4HA8A 3D3AA 3A0BC 2A6YA 5EG0A 4YGBA 2BPA2 4M3FA 4UXAA 4XFHA 4PQQA 4XKCA 3T30A 1G6NA 2UXNA 3O0XA 3W3CA 4ZHNA 5F5CA 5EWSA 1D5VA 1SDDB 1DIWA 3Q8FA 1JZ8A 4AQTA 2XF6A 4XKVA 3E0JB 1MMAA 1K42A 5FZ3A 3KCYA 2B39A 1IZ1A 2ZXJA 3TQNA 4O61A 3TKYA 2BZTA 4B4QA 2BXYA 3ZFEA 1RHI2 1VF9A 2GMMA 2DVFA 2J5PA 4PDWC 2OAZA 3HOWJ 2WV1A 1NCQC 4EWEA 4RN5A 3H0GJ 2PMZN 3LIGA 1YFWA 2FRHA 2X1CA 4GGGA 2WT2A 1C5HA 2DYRH 4L9BA 1YS6A 3OR2C 3AYDA 1VB2A 4CDUA 1UZYA 1BL0A 1X3UA 2M0CA 3PM1A 3KCCA 2IPQX 1FWZA 4FOYA 4YM2A 4FP3A 1OQ1A 3OY8A 3L2VA 1OYIA 3EB7A 1RETA 3HPHA 4EJUA 1JT0A 4AU7A 3QU6A 4OI4A 1DU3D 2BERA 1QVUA 3T8RA 2B63J 4OHXA 4G7OF 1ETVA 3VBOA 3RI4A 5JPMB 3RYPA 3LOCA 2ID6A 2KIQA 4Q4X3 3C1DA 4OFGA 2R93J 5A80A 2L54A 1QOTA 2R7TA 5LBEA 1OQDA 2O0OA 1TT5B 3IRQA 4AQ6A 4YNIA 2H6CA 1A3KA 1C4RA 3U14A 4AYUA 3TEWA 4MHUA 4A3KJ 3A0KA 2PJRB 5BNPC 1SVMA 1JH5A 2KL4A 1QKQA 2ZCWA 3U9GA 3OGSA 3GZUC 1JMUB 1UHMA 2EZLA 4DS0A 3J80K 1LAJA 2XPVA 4OMCA 3NJZA 4PF5A 4ZU7A 1QMJA 5IW0A 3B7MA 5FYYA 3KD4A 3RSNA 2GAUA 1UZ0A 5T52A 3JU9A 4LBKA 4I09A 4ENKA 4AI2A 3PLQA 1TMF3 3WP6A 3AZXA 4QPIC 4DUVA 5FZ1A 3L2CA 4IEQA 2CUFA 2PFBA 4DZGA 2YPJA 5EGOB 3G73A 3BOWA 1JODA 1RUH2 2ZGMA 2EIMH 1O91A 3G6JB 3M2MA 4D94A 4N4OB 5FYIA 2JZYA 2NS7A 2XB5A 5T50A 1VBB1 2MD0A 4FISA 1H4HA 1N1TA 1C8M1 2CV2A 3S1QJ 4HV5A 4NB5A 4B43A 3SC7X 3BGAA 3SH4A 3U21A 2A6EF 4BQYA 4PDKA 2RN7A 3ZXEA 5FUNA 4DOZA 4NIIA 1R4MB 3K4BA 2E19A 2FQPA 1OA2A 1IN4A 1DQ6A 3HOUJ 5BNPA 1YX3A 4IEJA 4C0BA 5FO9B 4XFFA 1VQ5I 2DO7A 2PHFA 2DVAA 1HW5A 2PQ8A 5LHHA 3VDDA 1IQAA 5FLIA 3LQRA 4TLFA 3MUZ1 3GFMA 1O59A 1GZ9A 2VLAA 5J6XA 2VJ4A 3UGFA 4C3HJ 2UY8A 3AP6A 3OBZA 4G6TB 3OUJA 1T56A 4M3GA 5FYHA 4AVZA 4YG6A 1LKXA 3M4FA 3OGVA 5FWEA 5FROA 4YGDA 1N78A 5M0TA 1CAXA 3PVNA 5J98B 3O7OA 1SBDA 1BJAA 2WY8Q 2P2KA 4GMP1 5AFBA 1S7AA 4CSWA 4BNCA 5DMYA 1AL23 3RMYA 2V26A 1WKMA 4WXHA 2JD9A 2XPWA 4G12A 1UY0A 2VZ3A 1FEXA 1DQ0A 3IBMA 3KV6A 4IV1A 3BDDA 1STMA 1C3HA 1UQXA 4LUMA 5JMOA 3HT2A 3B9IA 2ZKZA 1MS8A 4Q4V3 1OJLA 1ASJ1 2BOLA 3UKVA 4IRIA 1T38A 4G94A 4QPGA 3UKGA 5K7ZA 3BTXA 4V2FA 3QD6A 3GZTB 5DCMB 5JR3A 3TNQA 3WNPA 4I7HA 1J5YA 3TOJA 1T39A 4XF1A 3ZQQA 1PNFA 1VAVA 2JJ7A 2IEKA 2DF7A 4AI1A 3HG9A 2BNNA 2GALA 3G1LA 4WCGA 3BLYA 1FMD2 4LGWA 5EIYB 3VWBA 2YDEA 5D5UB 2B7YA 3DBHB 2VQGA 4GWJA 1ENQA 3GGLA 1RUC3 4DEVA 1RUF1 3VDDB 5A7NA 3DV8A 2HYGD 3ONQA 1RUC1 5ABJC 5FYMA 2W1QA 3MFKA 2WQZC 4CVUA 1DFQA 4YIRX 4IE7A 1WLWA 5KCMA 2BGOA 4QX3A 1K79A 4ES8A 3POEA 2BE5F 4MQ9F 1QNTA 3TO7A 1MMDA 2VQ0A 3KQ4B 3WP3A 2WNVC 4YG0A 1UD1A 4YFWA 3FLRA 4WM8C 1XB4A 3Q9SA 4NE9A 4IRGA 3HN3A 1FATA 3P5JA 1OH3A 1FOD1 4ESJA 2W91A 1Y39A 2ME6A 3MV01 3PQKA 3VKLA 5CEHA 3IN9A 5FOJB 2CJJA 1RR7A 4XUPA 3LSEA 3TP0A 1C1LA 1ZR4A 5IAVA 3H1WA 2CDOA 2L9NA 4BQ1A 2IUWA 2VJXA 3GFLA 2FMYA 2XF5A 5M3MJ 3I59A 3M8EA 2PX9A 4PGHA 1IV6A 2VECA 2RDSA 4CTEA 4PI0A 1TWGJ 2GSYA 4UWDA 2XC7A 3OYNA 3ZMZA 1TC3C 5GAEJ 3SCHA 1K5MB 1QEXA 1IG3A 1ZA7A 3NW4A 5GP9A 4NIGA 1MMSA 3T2OA 2NMNA 1QQP1 3O0VA 2LP0A 1OCCH 1K45A 3S17J 2PAEA 2F5EA 1XE7A 1ZLKA 4LHLA 2C6YA 2IT0A 4QGNA 2PHXA 3C18A 1HRV3 2ZGPA 2OV7A 2LD5A 1I3HA 5AONA 2HOEA 3GBGA 3NV4A 2CAVA 4IHVA 1OVSA 3S14J 3W2VA 3ZMSA 2VMDA 1FAYA 4MGIE 4XUOA 2YBPA 4JDOA 2OCEA 1H8TC 4NJ4A 4GWNA 4XRSA 4FX4A 2K9QA 1NHAA 5FKLA 4AFMA 4FPJA 4GH4B 5GLZA 3PMSA 4COWA 1PO23 1L0OC 3FM5A 3VSLA 1HRI1 3CLPA 4V2GA 1XNCA 2E7WA 4XJ9A 3V56A 5FO8B 2QTWB 2Y60A 2OD5A 4IEXA 5ICGA 1IV8A 2XONA 1JYXA 1HRI3 2VW0A 1OCOH 3SEEA 1JZ3A 4OAZA 3GBFA 1MS5A 4QPQA 3LMMA 3OBTA 1W0OA 5KHHA 2X05A 2ECCA 1MS9A 1R23A 4HG6B 1BCXA 2TNFA 3J8F1 2QCOA 1FOXA 2AXLA 4LO4B 1TME2 1QJEA 2QKDA 2CRGA 3LEKA 3HOVJ 1UHWA 1CJPA 2NMOA 2KRCA 5JZGB 2BYVE 4MTEA 3T1LA 2P4EA 1IN8A 3S7IA 2RM23 2MBFA 4XLHA 3ABTA 3TB0A 1GV5A 4NHMA 2EBIA 1Y8RB 4HDVA 4Q48A 3ZSJA 1O57A 2Q0AA 1IAWA 2C26A 4JAAA 2WZ8A 1LECA 1NLQA 1ETKA 4EQVA 1TBXA 3X29B 1MZBA 4IXAA 1EPWA 4KDPA 1ULGA 2IXHA 5GZCA 5FLJA 4I98B 1I6XA 1Y9MA 4RS8A 4LLFA 3AAFA 4DYCA 5IT6A 1G3WA 4L8QA 2QSFX 3ZN1A 3PUIA 3HOZJ 2V1NA 3ZPLA 2JKBA 4FPEA 2F4MB 2VKEA 1TNFA 3FJSA 2Q1MA 3R0AA 2NRAC 4UFKA 1BBT2 4NHYA 1PHMA 4TSVA 1YQ6A 4OYUA 1QJFA 5JMCA 4ZYDA 1I6HJ 5CG8A 4AIHA 4IL7A 2O7OA 5C5UA 1TG7A 2P37A 1SFPA 2XKPA 4WVMB 2Y0IA 2LM3A 2RNGA 2XPUA 1HIXA 2ZGOA 4HYEA 1AXZA 2OF7A 5GJ6A 1JXSA 1FOD3 1S0GA 1S2BA 4NDLA 2R062 1SANA 3HJEA 2VZUA 4AEJA 1XYNA 3K4DA 1PP8F 3WF4A 4ASLA 3LB9A 4I99C 5KBFA 1Q1VA 2ZC2A 5FIXA 4MVTA 4QPIA 3NV3A 3I97A 1FMWA 4YW2A 4D1QA 2EIBA 1XN7A 2E2HJ 2A6XA 3EUHC 1XYPA 2L7KA 2EXIA 5I8SA 5JSPA 4UW3A 1OQEA 3F23A 4I01A 3HD8B 1O3TA 5CZKA 5A3MA 1U2WA 1NA1A 2PHWA 4LK7A 5IVJA 4SLIA 1UNBA 2WO7A 4A3XA 3SDGA 3V42A 4YVWB 2V9PA 2DA2A 3B3QE 5EXOA 2MSYA 4R79A 1UY3A 4D6QA 1QIQA 4CPBA 1RHI3 3IL2A 2NVUB 3E5XA 5FOBB 3LSRA 3FDYA 5E1WA 2XXZA 1SLAA 4YVSC 2EIKH 2FE3A 2HR3A 3ECHA 3WG1A 2OU2A 2RKHA 3GBWA 2E7XA 5L3EA 5C3RA 9ANTA 2VC0A 3RDIA 1WA4A 1O3QA 2DMTA 4NAOA 5FJHA 2YHJA 4OUSA 1R64A 4RFRB 2BW8A 3FXMA 3ECOA 1KU3A 2VXDA 1ZG5A 2D6MA 4I0BA 4LK6A 3TBDA 4XC9A 5JFRA 1V6NA 2ZABA 2VKDA 1GZCA 1R22A 1WD4A 1QO0D 1LU2A 4OHVA 3CESA 1MNMC 3A7QA 1ZRIA 5FMCA 3B9CA 4NHKA 3WCRA 1O6UA 1PUEE 2K9MA 4RQPC 4Q47A 2L9LA 1LQ1A 4EV0A 5F0HA 3V0AB 3H92A 5FZFA 3QAHA 1G8XA 5IVYA 3WW2A 4AM3A 3ZQHA 1QJX1 3M3YJ 4PDWA 1AL21 1ZG3A 1J3PA 4M74A 5L7OB 2W9XA 2ZHMA 4HSRA 3F21A 4JTNA 5DAXA 2HDCA 2L7FP 1PO22 4A3BJ 5H2FC 2IFWA 2HS5A 1Z67A 4GB33 4IEYA 4B4RA 4UFJA 4Y24A 1RVF3 2V7FA 4LLLA 1IUFA 3ZYGA 1R5GA 4FOQA 4XXAA 5LA1A 4ARYA 1XMAA 1U5TA 4M0HA 4MO3M 3ILRA 5A32B 2ZB9A 5E17F 1V6MA 3ITQA 4F93B 1VRH2 1E5IA 1LHNA 3ZXGA 1J7KA 3M8JA 3CDZB 2ZJ2A 4YVWA 4QU1A 3KGLA 4QPYA 5CVVA 2Y0SA 4BMEA 1JBCA 1P4XA 3MN2A 1WRJA 2KKOA 5BNGA 4Y1YA 4BKXA 4Q4W3 1R58A 2OUHA 1QJU1 5JIUA 1U5YA 1XSXA 3DKYA 3THDA 1H9TA 1CZSA 1FPN3 1BN5A 1VZ0A 4ITVA 5AIQA 4IEPA 3CCJI 1PO13 1ZN2A 1PK6B 4A0XA 5I91A 5F3EA 2DYCA 3ZIXA 2BV4A 1HQWA 1X1AA 3WHCA 1TP4A 2R5ZB 2H1KA 1ND3B 1OPOA 1MVQA 2WZR2 2O8OA 3OG2A 2R7WA 5KNLA 3JQXA 3VBFA 1SLLA 1CPNA 1SFNA 2XDVA 3KVBA 1JUMA 1IKPA 4TLGA 3ZQ7A 1JOJA 1T2XA 3AM2A 4LJHA 3GTLJ 4PCQA 3IKVA 4C91A 3PUFA 1ENRA 1OBNA 3CCYA 3I0TA 2VH9A 4RA2A 2G4IA 3EPZA 4A3LJ 1D8KA 5HLIA 4LBLA 3SXWA 1W28A 1LOGA 5DN2A 4YRDA 3J7HA 1PGSA 4Q0SA 4PLOA 3BTYA 5A7SA 1S7OA 3C3WA 1QJU2 1QJX3 3Q0UA 4XLAA 2A6VA 3TP3A 1S2KA 4HKLA 2HWE1 4UOJA 2JWTA 3ES4A 5E16A 2Y9YA 4JGZB 3MZ8A 1MSFC 1T2KA 4UYBA 3QRFF 2KDOA 1JUPA 5HLGA 1KA8A 1DPUA 2QQOA 3RKWA 2KHMA 2CDPA 3LL7A 4X0GA 4LLGF 4HKWA 3ACIA 5TGTA 4IGPA 3OYBA 3R4UA 3EJKA 2X5IB 5JOYA 3RQ4A 1W9WA 2ZFWA 4BQXA 2VQCA 4MSVA 3ZSLA 3MF6A 3K4AA 3BTAA 3ZSEA 2KR2A 2MH2A 3BB6A 4PJLA 3S16J 2HXIA 3RFRA 5HDKA 1YIFA 1YITI 1WI3A 3FHNA 2IZWA 5LBCA 2AC1A 4LTAA 1GV9A 3NNJA 1U9OA 3K4NA 3GHMA 2ADUA 2CMPA 5JVVA 1W6QB 1UAAA 2R7EB 1C0WA 2CSGA 1UFMA 1CONA 4LULA 2J5OA 3WG4A 3BTIA 3NQOA 3FISA 3M4OJ 2GMPA 4Y1ZA 3H8OA 2PLYA 2XJQA 3S30A 2QLZA 4C30A 2YU3A 5IHRA 3MI8A 4OI2A 2FDKA 1OFCX 2QSGX 2FZ2A 4KGQA 1AYN2 2ZA9A 1P6RA 5FZMA 1WZXA 3OYEA 2Q8EA 2K02A 1FYUA 1MBJA 2PMWB 4JRLA 2W00A 4GB32 1F2NA 1W8HA 3K2OA 5F08A 5DYMA 2DLLA 5CFCC 1IRGA 4BAYA 3F0CA 2QM3A 4HPKB 2CYFA 2V1DA 4HX8A 4Z6YA 3HTSB 1WCUA 4BQ5A 3AG2H 2RC4A 4KMUX 1HXDA 1ON1A 4LKEA 1FY7A 4A2UA 2HTSA 3I3BA 1LB2A 3A22A 3EMRA 4W50A 5I0DA 4PI2A 1WH7A 2R32A 2DURA 1MBHA 3WG7H 3USUB 4RHV1 4P14A 4BQ3A 2RS31 1C57A 3KLOA 5F1JA 3GZNB 2ZEYA 4KWUA 2VCBA 1H9WA 3VD7A 3ESWB 3DPRB 3DU5A 2RJ2A 2CW8A 3WGHA 5BNOB 4H0EA 4OMYA 2L7MP 2R7OA 4B3AA 3BU7A 4QGLA 4XABA 4IOAF 3D5OA 2XJSA 1VRH1 2W68A 1HQCA 2IP2A 2FCVA 2LY1A 3LA3A 1ND3C 3FMRA 1TZOA 2PLV1 2XGDA 4P96A 4JQTA 4P08A 3ZFEB 3PNAA 4HZFA 5JVTA 3FN9A 3HQRA 2HDWA 3BZCA 1GUUA 2SBAA 2IXLA 5J4VA 1LESA 4BOWA 1TWAJ 2CUZA 2TCTA 1B6AA 1MJ9A 3THTA 3N7MA 1X1CA 1Q8QA 5E79C 1ZZ9A 4M4PA 1PGW2 1FBQA 3NVCA 4B09A 2BVBA 5EJZB 4XMYA 4L92A 2KIFA 3HOBA 3QPSA 1O8SA 2W1WA 3RCOA 3PFIA 4EJOA 2KRHA 1G7YA 1S29A 3F8MA 2ZSHB 3F6OA 3CO7C 2X85A 2DUPA 2VBBA 3DBRB 4BE2A 1RUOA 3CF5F 3GMEA 1KS4A 1QJX2 5A7QA 5D5WB 3HYIA 3Q0WA 2OVUA 3VLBB 3ZFFA 1YWKA 4M6XA 1QNYA 3M1HA 1SBFA 4JYKA 3Q5FA 4CCMA 2DTZA 2VO5A 2YB7A 4E7HA 3DPTA 2JUCA 2GXBA 4WM8A 4D6SA 3ERMA 5DCFA 2BY3A 2HPIA 4U2AA 3MDPA 1R5HA 3HBLA 2WT0A 5CISA 5J7MA 1IDZA 5JOXA 5LRRA 5IT9K 3ABMH 1MACA 5KXDA 3I5UA 3OYGA 1RUJ1 2OCCH 3BUCA 3IKTA 1YOVB 1NKGA 4RGXA 1KGYA 2JB4A 3DXJF 3SHFA 5LA9A 3ALQA 3BJAA 1YFHA 4BQAA 3NL1A 5BNNC 1K7AA 2WO1A 2LREA 2WZR3 1P4WA 2L9VA 3K10A 5F2SA 2FCUA 1WZ2A 1GMMA 3LKJA 4YFZA 4YWAA 2DW4A 5EEHA 2Y75A 4EWAA 1H1MA 4BK4A 4M4RA 5KXEA 1LFPA 2ZHLA 4KWJA 4WX9A 4XN0A 3S1MJ 1R1ZA 5FP3A 3ZDVA 2JDPA 4FP2A 3RGBA 1NXMA 5D1IA 1JYNA 3GTPJ 3HBZA 5FREA 3OTFA 1A78A 3W5NA 4IPAA 2L9RA 4QPGC 2L4MA 1RUNA 3P3NA 2R7VA 4A3DJ 4FPOB 4N7UA 3N7KA 3VV1A 4EJTA 4AG4A 2WABA 5CU1A 3ISPA 1ITYA 5CJ9A 3AMPA 1O4YA 2CL2A 1HX6A 4IKFA 3IPVA 3FLTA 1R6RA 1R5ID 3UGHA 2YR2A 3IAQA 3IIIA 3ORJA 1ZKGA 1ZNPA 1H2NA 2Y26A 2W2IA 2VOVA 4C1XA 5LD2C 2XBO1 2ZACA 4CDQC 1OOPA 2WB1N 2D43A 3J7LA 2JDKA 3CJNA 1Z3XA 2ID3A 3VKFC 2JG9A 4FE4A 1PIV2 5GM0A 4XF4A 3AYAA 4KMQA 5A1LA 2X48A 1FC3A 1HC8A 1YRZA 5DZFA 3W6KB 2IBDA 5FD6A 5LEKA 2HDDA 5FZ6A 2WNUC 2K0GA 4WXCA 2WBMA 5B4XA 2ILMA 3O1SA 3QPLA 3UL2A 3BKZA 5FLHA 2UY9A 3LSJA 2FUG2 2W92A 1POV0 1ZREA 1KQ8A 5IAXA 1IO2A 3JD73 1AX0A 3LOBA 4CEYB 4J6GA 2WFPA 4OWRB 5C8CC 3BR0A 5LEJA 2R7UA 4D5FA 4BLIA 2VOKA 2M9HA 4ZDPA 1GQHA 2R073 3RG0A 4YZ3A 2EIJH 3ZXFA 4NC7A 3EUHA 3CP2A 5KHGA 2VVDA 4GMP3 1BOBA 2JRTA 1ASJ2 2BBAA 1WD3A 2W5FA 2A70A 2DFHA 1BA5A 5FZGA 4NWWA 3PIJA 4FTBA 3VUOA 2P3YA 3D5RC 5CFDC 3TL4X 1JKPC 3EETA 2IJLA 4XK4A 4CZCA 1WJDA 3KB5A 2O8QA 4KU7A 4E9KA 4LOTA 5FY1A 2C0ZA 3UKTA 1NA1B 2XAGA 3IUOA 2EQRA 4AVAA 5C3OA 4UV9A 1AR71 5C70A 3VBUB 4FASD 1R4NB 4LO5B 3T2QA 4WM7B 2LVSA 3EUAA 2BOJA 3HVDA 3SCGA 3I56I 1V9U1 1DDLA 3OYJA 4BXUA 1OOPB 1WMFA 2QGUA 1RUE2 4BXXJ 3NAPA 2QYOA 4QIWN 2R1BA 4BZ4A 1LJ9A 3ZN6A 4Q4W2 5IUQA 2OQGA 5J8FA 2WWSA 1V3FA 5B1BH 3BPSA 2LW8A 2GMEA 2D6OX 1DQ2A 1H9GA 5FO7B 1C8M3 5FCCA 3KYCB 3SHRA 4K8FA 1BOAA 2HWC3 4NWVA 1IXCA 5LZ6A 2Y64A 4QXKA 5KAIC 1JYCA 2XAFA 2WINB 4H55A 5GAGJ 3VBOC 4W8JA 3NNFA 3MEXA 3MFAA 3DECA 2ZGRA 1W36D 2NM1A 4XHBA 2YC0A 5E3OA 1Q3EA 4CU8A 1FSEA 4MFEA 1V54H 1HKDA 2ZMNA 2PA7A 3QLQA 1NCRC 5BV6A 4F92B 5FO5A 5DS9A 4XLCA 3CCUI 3ILFA 2K3FA 2DOFA 4RGUA 1LOFC 4K1YA 2VW1A 3RPUA 3TDZC 2JG8C 1MVEA 1B35A 4GYIA 4UFMA 4Y4RA 3OSFA 5LA2A 4LKDA 2WZEA 3OBRA 1FLIA 1YIPA 1HDDC 4YFNF 2HWB3 2ZJCA 2C24A 5D8AB 2D3SA 5I0TA 5E88A 3MIEA 1PMHX 2M4KA 4AEMA 1NLRA 2XAQA 4OCTA 5FJ8J 3EQLF 5FZ7A 3EO6A 2A6WA 3G2BA 1IRXA 1UJ8A 5FYVA 1R1VA 3E5QA 5F6KA 1ZZ7A 4JRAA 5FRAA 3ZCOA 4MNUA 1EA3A 3CMYA 3KM5A 3S5QA 5F04A 1EV12 3IC7A 1W9FA 2Y38A 2DMNA 4DIQA 2AS5F 5F8PA 2K40A 3LZZA 2R061 2HVRA 2RR11 4AIKA 3LSGA 2QUFA 3IMMA 4S04A 3CUQA 4JHZA 3GYHX 4BIFA 1LDKB 4WZFA 3NNLA 3PUHA 2W85A 4YZ1A 1QVTA 2EAAA 2X29A 3WODF 3CDHA 4NHLA 3PUSA 3HUGA 1W0NA 1FIAA 4HF0A 5IOZA 5A3WA 2E1NA 3E3VA 4CYDA 4HNUA 5IYDJ 3I4IA 5LK5A 4I3PA 3ZYFA 4XIKA 2M4GA 2X9DA 3VBRB 3MGUA 1UYXA 5EPAA 2A6ZA 4GALA 5ILSA 3SYTA 2V4AA 2LTNA 4C3JJ 2K5CA 2HTJA 4XQFA 4OULA 3VPRA 4E4HA 3FMQA 2AGSA 2ZPXA 1A8DA 4ZONA 4KT5C 5EP9A 1YS7A 5FKCA 1OSGA 1N75A 3HRSA 5EV7A 1ENSA 1WBFA 1GSLA 4S2HA 2PLV2 1TLHB 4P1WA 3UKNA 2W25A 5CFCB 3J7ZI 3C7JA 1MS1A 2P1BA 1LNWA 4IHXA 4XCAA 3A0HC 3VD4A 3W9AA 1MDMA 2HWF1 5I0UA 3AJYA 3POIA 4H14A 3DQVC 3RSJA 2DCTA 4IOCF 4LD5A 2DCYA 5BNNB 5J36A 4A7YA 3DF0A 2PG4A 4BBRJ 4IE5A 5FMOL 1HB1A 3CCQI 1NZIA 2ZXQA 4K20A 2WIIB 5EG0B 2V72A 1XSRA 3FK6A 4MQVA 4YLZA 4DY5A 5JLVA 2ORXA 1Z7S1 5LGNA 1H8TB 5F3GA 1FXZA 2L02A 3PL8A 4RR3C 3DTKA 1FJLA 2HQRA 1BI2A 2HWD1 3MPBA 3BIWE 3KETA 1LDDA 5DM7F 4LHSA 1Z0XA 5IK7A 4NRPA 3ZLIA 1Q8OA 4XFIA 2ELHA 4CE8A 3A02A 1D7PM 1GWLA 1HQNA 1GDTA 1N3PA 2ZO4A 4PSWA 1GNHA 3F8FA 2RS11 1V00A 5LBFA 1VQMI 4LE4A 4BIOA 2XLFA 4QKNA 2W48A 4CEWA 4EN7B 4RB0A 2XQXA 4ONUA 4ES9A 4F3QA 1EYBA 4IV1C 4NPMA 2M1BA 4KITB 1I27A 1D4M1 1ENXA 1P4AA 1Q8PA 4EWDA 4RBOA 1VBE1 4DY3A 1WCKA 2VCCA 1KDKA 1WMXA 2MEV3 1OF4A 2AO9A 3BR5A 1S0DA 3LIHA 1KITA 4AAPA 1W5CC 2ELJA 3BY6A 2CSOA 4EYUA 3NJVA 2EFOA 3O1VA 3DPRA 1C1FA 3KV4A 1UW8A 3WD5A 2HOSA 3DPUA 3VKMA 3VDDC 4BL0B 2ZX2A 4PJ0C 5L19A 3NKTA 3VDXA 1UU6A 5DTDA 3HZJA 1S72I 1LEDA 3DEWA 4HF2A 4KBBA 2HZTA 2KP6A 3HGYA 3JBG1 4WZCA 4BQOA 2ECBA 3BR2A 4PDWB 4LOSA 1MH4A 4IEVA 1ZELA 3I53A 5FZBA 5L7OA 4Q4Y1 5IP6A 1YJKA 3MLLA 5J96B 5DAPA 3LDBA 3L09A 2P6SA 3DTIA 2E1CA 1F5TA 3DKWA 2XG3A 5EF6A 2W0XA 3IT8A 1Z3YA 2A3YA 2EK5A 2XHNA 4N90A 2XGCA 2JSPA 1QJY3 1IXSB 2E34A 3Q8EA 3N7LA 2VMHA 1XC5A 5GKAC 3WEZA 1W7PD 4OLLA 1XNAA 2R16A 2A5WA 4HLTA 4MGKE 4NO4A 3SZGA 4PCRA 5FBZA 4FTSA 1GZWB 5FKOA 4ASMB 2ZGTA 2NNNA 2AQFA 3JXSA 4OUEA 1AR92 4M3CA 2BQPA 1QJY2 2JG8B 3ABKH 5GLVA 3KT1A 2GDFA 1BR2A 2BU9A 5BXXA 1TWFJ 2LRDA 2VE1A 2XRLA 4XNFA 1UU5A 1YEWA 2VE9A 1YJNI 2YBSA 4RM3A 1NH3A 3LEIA 1XDUA 4QPGB 4IXLA 2XL9A 2VU9A 2X1EA 1YLLA 2I74A 4DO0A 3WNNA 3GTOJ 2B9SA 2RV8A 3GTGJ 3JRGA 3G7DA 3DF8A 2KD7A 1ZAOA 2QQMA 1B09A 4AIDA 1SAUA 3JTHA 3AXEA 3ZFGC 5E89A 2COMA 4FX0A 3HEFA 2GOXB 4H2AA 4SBVA 4M3BA 3AMHA 2EV0A 4GRIA 2DA5A 2DUOA 3RWKX 1JZ2A 1RUD2 1ZARA 2N7GA 3ZMUA 1JTXA 3ULQB 3ZQCA 2DQRA 1A36A 4XICA 3FBYA 4Y1VA 2QQWA 3B93A 3ZO0B 2BV6A 1SD6A 2ARCA 2VCAA 4IV1B 1UY1A 5JSRA 4AHWA 2VQUA 3JRCA 2TUNA 2M8GX 1XCBA 3E7LA 4F3JA 4G9YA 4PQ9A 2WR9A 1A6CA 1MZFA 2X6WA 4L0YB 3HT1A 2I07B 4JX0A 1COV3 3H7YA 1TQIA 2QF7A 4FE7A 4ENJA 1PIV3 4HN1A 3RPQA 2WAEA 3ZMDA 3VL9A 4UVBA 1WGPA 2WS93 2E5NA 2D6KA 4Q5SF 2DCZA 2Y34A 2LC2A 3A2KA 1FTZA 2QQNA 1QWRA 1X9TA 1VAKA 1LEBA 2IS2A 3H1YA 4IEOA 3ZFEC 4O9EA 3OS2A 3B73A 1NZCA 2IVJA 1LULA 2HVQA 4HSJA 1WPKA 2IW5A 2IWGB 4E4SA 3DGTA 2STWA 3HQXA 3ABZA 1QU3A 2JE9A 5D5XB 5H6QA 2PHTA 3A23A 1W5TA 4PFOA 4MGTA 3DCFA 3VHRA 5JAXA 2ZSIB 2OZUA 2RS51 2IXKA 4U7DA 4YGEA 2ENRA 3AYCA 4XLPF 4CA0A 3TO6A 1UHSA 3I59B 3ZPOA 4RGKA 1YRNB 5FKMA 2ZJPF 3CCSI 3IDCB 3OPZA 2K27A 3FXQA 3I3LA 1MSEC 4Z92B 3AVSA 4C2TA 3DL3A 2Q1FA 2HJIA 4QDSA 2GOMA 3U1XA 5DEQA 2MLKA 5A33A 1PZ8A 2K4JA 5HV0A 4BLJA 2XASA 4M73A 3P7NA 1JJ8C 4W1UA 1XCVA 1BW5A 4PK4A 3E6CC 4AF9A 1LOEA 4MO7A 1J3QA 2ES3A 4DXTA 3HAGA 2EFNA 4P5OA 5F9TA 3S3NA 3MICA 5C3PA 1VBD3 1ND2A 3SITA 2GNMA 4TYSA 4XMAA 1W04A 1IZ3A 1XPXA 3MVPA 2X8KA 1R091 5J37A 5F6LB 1AYM2 2XPJA 1G3SA 2NNYA 2FDHA 2VTXA 1KONA 2Y6KA 1AR61 4W4ZA 4CXWA 2HQNA 2ZAAA 4IGOA 3OIPA 3LF7A 1ZYRF 1IC8A 1RINA 2QDRA 4MH0E 4RB2C 4RS5B 2V9KA 2A07F 1S0IA 1Z9CA 3H0DA 4V1PA 2AREA 5LBQA 2BGCA 2Q2EA 2R043 2UUZA 3ZN0A 1TME1 3KP4A 3F22A 1LE8A 1J1LA 1PGL1 2O1QA 5EYXA 2NYYA 3VHNA 3ZYPA 4LO8A 2BFUS 1IKQA 4DB5A 5FD5A 1ZLJA 5CNAA 3LAPA 3JZVA 2CW7A 4UB8C 1EV11 3ASNH 1Z78A 1RC6A 3QYEA 5IVBA 4MGRA 1JXNA 1W0PA 1W9TA 1UYZA 4FQ4A 3PJRA 1I39A 1HCRA 2D5VA 3GTJJ 3OS1A 2EAKA 2F4IA 1JUIA 1USTA 3C2GA 1QZZA 3WTSC 2XLGA 3D82A 3H3LA 1R7JA 3M1CA 1JOPA 3KS7A 2D5HA 4AYBN 1YI9A 2PQQA 2JQ7A 2AENA 1PVC1 2LOOA 4TZDA 4COUA 3W6VA 5M5XJ 3QU3A 4QXBA 2BVLA 1OHFA 1G8WA 2ZMEC 5HCHA 5F6FA 2D97A 2HEWF 5DAVA 5A3TA 3AMQA 5G04L 3WNKA 5FP9A 2XAUA 4RGSA 4LK1F 4I30A 3WTVC 1MBKA 3NJXA 2ME0A 2VMFA 4Y13A 1OYYA 3N9PA 5K0UA 2KISA 3NAUA 1SFEA 2L7ZA 1POV3 2DJIA 1GOHA 1V9U2 4O6JA 2QZ2A 1AXKA 2RS52 4WV8A 1OLME 1KU7A 1DP3A 4LJZF 1NAEA 2VPLA 3PUAA 5FLMJ 1ULCA 4FPKA 2ZOEB 1R00A 1UCRA 5FKNA 5LHGA 4JGYA 5FY4A 1FZPB 3FK7A 3NWTA 3M07A 2ZX0A 3JAMZ 1E57A 1LUJB 1FOWA 3RKXA 1WLDA 2DXIA 2HOAA 4BQNA 1LEMA 4G7HF 5K4LA 2RGVA 2BRTA 2P3JA 2ICWG 2A71A 5FB2A 4QQ2A 1CAWA 3WG3A 2C5DA 5FZOA 2JDHA 5A7WA 4EE2A 2NS0A 5FAXA 4BGDA 4FSJA 1FOD2 2WBKA 2XOMA 1OFSA 3DWLE 3ZP5A 2UZKA 3M70A 4N53C 1AF9A 2FD5A 4IHSA 1S5LC 2KJCA 5ERLA 3HRMA 1ZBE1 2AHQA 2I10A 4NC8A 2YU9J 3BJOA 4U0WA 1WMEA 4QGMA 4PZJA 3JSOA 1F5JA 2Z1DA 3E6BA 2OX0A 4EM0B 2P3KA 4EN8B 2VUDA 2Z2SB 3OD0A 4KWLA 1D1AA 2UYBA 1Z7UA 5HLTA 1N1VA 4NPLA 3HC7A 2RMU2 3B00A 1RUG2 3P6BA 2GN3A 3FUOA 4ZH4F 2YROA 3K4MA 3AMMA 3C7FA 3HDDA 3AL0C 1VQKI 1R1A2 3UGGA 1HSJA 3KP6A 4R9DA 5L3FA 1SG3A 1RMU2 2W1UA 1POQA 1FTTA 2BNMA 3AP5A 1F1ZA 2L0KA 3J80Z 4Y20B 1IPSA 1RMU1 2D2WA 2KLOA 4IESA 4RAGA 4QAWA 3IIAA 2M7BA 1RUI2 1KGSA 1C28A 3LWFA 4MGQA 2RJKA 5IVCA 4PJJA 4PLMA 2ZHKA 1FSHA 1B72B 2KZVA 1W6MA 2YC2A 2ZXIA 4LT5A 3B6CA 4HETA 1OLTA 2WKKA 1F31A 1VBA1 5A3LA 4WXDA 3RTRA 3QWLA 4FTHA 1W03A 4AEDA 3RJPA 2WA3A 4U36A 1MBFA 3A03A 3AJZA 5A6YA 4DBRA 1WWXA 2E2IJ 4KI5M 3CJIC 2J42A 3I2GA 1YJWI 4XDPA 3IP4B 4NRQA 3KHCA 2ZZQA 3KV9A 4GH4C 2EFPA 2WADA 2MC3A 4NHXA 4B44A 3HKZA 4XACA 4LFUA 5I93A 3OYIA 3BIEA 1QJZA 2MPFA 4KQ7A 1MQTC 1LRHA 2DPDA 2WFF1 4S2FA 4AYBA 2F4PA 4QQOA 3SCFA 3CUOA 4HEA2 1Q5OA 3S2WA 3NWKA 1DYOA 4II3A 2WNEA 3PL0A 4YW3A 5DD8A 1D4VB 5FK8A 4WF2A 4XXPA 4B1RA 3CJRB 3P1IA 3OOPA 2BEOA 1F8VA 1XS9A 3WE3A 3A4CA 2BBVA 1ZGAA 4ZDOA 3ST7A 2Z99A 3AP4A 3LQQA 5JHFA 2YV8A 3WW1A 2WC2A 2W08A 1WJEA 4XZUG 4HL0A 4GIQA 4AFCA 3COAC 3RZZA 3HRTA 3WHTA 1T98A 4OIRF 2DDUA 1IF1A 2GQQA 4XVHA 2R5YA 3WF0A 4NQWA 3BALA 5AVAA 1KU2A 3I4MJ 1AZDA 1RUJ2 3K7AJ 3X2QH 5KXCA 5FTTC 4IV3C 3JRFA 2IXJA 3OCPA 1L3JA 1NE4A 3LQCA 1ULOA 3VHOA 2WWYA 2YPRA 1REEA 3C7EA 1LVKA 3FXJA 2R7XA 1YQCA 2OA4A 5C3QA 4YG2F 1P92A 2HWVA 4KNYA 2D6LX 4Q2FA 2Y30A 5DDGA 4W6XA 1RL3A 2DYSH 3ME2A 5AC92 4XORA 3N35A 2WLPA 4CP2A 3W58A 3DKXA 2DVGA 5EYRA 2QSHX 3R05A 2X5IA 1POV1 3AG4H 2XSJC 3L2QA 3I8TA 3H8XA 1FV2A 2Y31A 3NMBA 1JI8A 4P02B 3SEPA 2R30A 3TMOA 2TDXA 3KPHA 5L7OC 4DXRA 3V7CA 3OYAA 1W6OB 4YIIA 1X36A 2AEZA 1YYNA 2ZGKA 5B4NA 2C9KA 4Y5TA 2STTA 1JGSA 4CH7A 5FMDA 3N05A 1ZBA3 3W59A 2FD8A 2DMQA 4QKFA 4D8MA 1Z7S2 2EB7A 1VQLI 2LKSA 1YO8A 3VBSA 2VB6A 3IB3A 1Q56A 5IVFA 5M3FJ 1APNA 2HYXA 4Q0PA 5I8TA 1GP4A 3VBHC 5FYUA 2DBIA 4L2NA 4XONA 1QBJA 2PMHA 3LFMA 5JVGF 2DOEA 5F39A 4XRFA 1YX5A 4G4FA 2WO3A 3Q8CA 3MHZA 1G9AA 1VBA2 4UF0B 2E5ZA 3W2WA 5D6EA 3BP8A 1T0FA 3WP5A 5CKTA 3CKHA 4YM1A 4CDWA 3TEDA 4S2DA 2DFCA 4Y5Z0 4LUKA 2V5DA 1KD7A 1ENHA 4BB3A 5K0UC 3OIQA 5C44J 1AYM1 2ESHA 4YW4A 4AHYA 5C4WC 5F3IA 3TW6A 4CDUB 2XVCA 4OIOF 1W8NA 1XXNA 3T1BA 1R1A1 1GLNA 2WA4A 2JDYA 3J7NA 1B59A 2PI0A 3ZYRA 3VZKA 3RZMA 1MS0A 4MTDA 4XTPA 4AQSA 4JDNA 5EEAA 3RRDA 3MKWB 1AR63 4CO8A 4TWTA 4B47A 1RUG1 3UNPA 3POSA 3KLNA 4QB6A 4BQ2A 1FIPA 1T8IA 3TWIA 4P9FA 1RB8G 5KAFC 3WVJA 3CZ6A 1BIAA 5HDGA 3VZMA 1H88C 2BZDA 3SEQA 4GZ9A 2H0VA 4A4AA 2B4KA 4FPLA 4BYYA 3M8FA 2WAFA 1GKBA 2DFEA 1H0BA 4GO1A 4BDYA 1R081 2ESNA 5FYBA 1DZTA 1LOBA 1GQGA 1HB4A 2D45A 4KIBA 5F27A 1ON2A 2V4VA 1PDNC 4EVIA 1QXPA 3LSPA 3GO5A 3NKGA 1YG2A 1QHDA 1CWPA 3K1PA 2QQUA 3LA2A 2YU1A 1ZBE2 4BXSV 4RS5C 5DDJ3 1JJ6C 3VKOA 2HU9A 3D4KA 4XBLA 1HXS3 2HYKA 4UUSA 3O3KA 4PLNA 2A7AA 4HX7A 4Y1UA 5H9RA 4QKDA 1IG0A 1A31A 4QKBA 3FBMA 2AACA 3GEZA 3BODA 3R60A