4NAHA

Inhibitors of 4-phosphopanthetheine adenylyltransferase (ppat)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
159
structure length
159
Chain Sequence
EHTIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLKNSKKEGTFSLEERMDLIEQSVKHLPNVKVHQFSGLLVDYCEQVGAKTIIRGLRAVSDFEYELRLTSMNKKLNNEIETLYMMSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of inhibitors of 4'-phosphopantetheine adenylyltransferase (PPAT) to validate PPAT as a target for antibacterial therapy.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase/transferase inhibitor
molecule keywords Phosphopantetheine adenylyltransferase
total genus 57
structure length 159
sequence length 159
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2013-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4nahA00
3INNA 4G5YA 1J70A 4G6ZA 4XFDA 3FIUA 3DO8A 2B7LA 1IQ0A 1OWPA 3L93A 3QTTA 4EG7A 4MWDA 1QRSA 3HGMA 3LE8A 4KKVA 1O5TA 3HZRA 3TZEA 3A2KA 2EJCA 1JZQA 1K92A 2R5WA 3A04A 2IP1A 1T9GR 1X6VA 5EKDA 3UC5A 1JIIA 1WKBA 3KT0A 1O0CA 1IRXA 3UMVA 5HUJA 3TNJA 3QE4A 4EG4A 4YBRA 3ZJUA 4NZPA 1M83A 2H2AA 2V0CA 2E18A 1F7VA 2J5BA 3RK0A 3OTWA 1R6TA 3DLAA 2WSIA 1MB2A 2TS1A 4J75A 1JZSA 1NYLA 1ZUNA 4MWCA 2Z08A 3ZJTA 4CDMA 1Q15A 1O97D 4MVXA 3FY4A 2CT8A 5IJXA 1VBKA 2QUHA 3COYA 1O6BA 3TQIA 3P0HA 1KORA 1ZH0A 3H9CA 4QBTA 1I2DA 2CYBA 4MVCA 4MUFA 1OWNA 1V47A 3TS1A 3AKZA 2AG6A 2OV4A 4MW1A 3RJZA 3Q12A 4UZFA 1Q11A 4S1OA 5FO1A 4ZCPA 5JBNA 4R0NA 3AIIA 1WXGA 3ZJVA 3VRHA 5J5AA 4L2IA 4JZYA 4P2BA 2PZAA 1LW7A 2CUZA 4I6EA 3JXEA 2ZP1A 1DNPA 4MAFA 2X3FA 1WJGA 1VBNA 1EUYA 4MW2A 1X8XA 3LOQA 4YP5A 4EFKA 4PBRA 1M8PA 3FNRA 1FYDA 3K9WA 3ZXIA 5FNZA 4ZCQA 1UFVA 2J07A 3COZA 1V8FA 3MMXA 1N3LA 3QTBA 4ARIA 1O96B 1WXFA 3IOCA 3IVCA 3OP1A 4Q93A 4DJAA 2YWBA 2WQ6A 4YMIA 1EJ2A 1PG0A 3FH0A 5LFAA 4QREA 2ZUEA 2X1MA 1JILA 1GN8A 3CLTD 2DPLA 1SURA 1F4LA 1TQ8A 3PNVA 3SYTA 1J1UA 1IQRA 2DXIA 3X1MA 3RK1A 3CLSD 1YIDA 3CVXA 5J58A 1K97A 3AG5A 3ND7A 1G8FA 4MUNA 3A4IA 2J08A 1WQ3A 4ZT6A 1M8KA 3HL4A 3N2YA 3ELBA 4YP7A 4AQ7A 4HJRA 1J1ZA 3PRHA 1J20A 1U3CA 2PIDA 3A05A 4NX2A 4NATA 4MVYA 4BWVA 1IFXA 4MUGA 3VGJA 5HUHA 4EG6A 1TEZA 1F7UA 2PZ8A 1H3FA 1NSYA 2ZUFA 2WB2A 2A86A 1EFPB 1OWOA 3ISJA 4ZT5A 4DLPA 2E21A 1WQ4A 1QTQA 1VL2A 1MAWA 4MULA 2A1TR 2YWCA 2A4MA 2GOYA 2YXNA 1WZ2A 2I1LA 1R6UA 1N2GA 1KH3A 1NUPA 1TYBE 3GMIA 3FETA 3RFFA 1EFVB 3IOEA 4I6GA 4DDHA 4JXZA 4KR7A 1OD6A 2DR2A 4AS1A 2AZXA 1ZH6A 1JEDA 3ILVA 3CVWA 4XFJA 4GRIA 1WY5A 1YUMA 3CLUC 3I05A 2A7XA 1COZA 3Q10A 5K0TA 4WNYA 1O0BA 1MRZA 2E89A 4ZCRA 2YY5A 3NV7A 1YI8A 4NAUA 1F9AA 1T9GS 1U3DA 1OBCA 3P52A 2CFOA 2DUMA 1NUUA 1N2BA 3ND5A 1T6XA 3G5AA 1OWLA 1M1ZA 1JGTA 3D6VA 1O96A 3VU8A 1HYBA 2DETA 2DERA 1MBZA 1PFVA 3HFJA 1I6LA 1GZUA 5J59A 3X1KA 2A1TS 5DK4A 1N1DA 1G8HA 3C8ZA 1XNGA 1H3EA 2C5SA 2VTBB 1WXHA 2QTNA 1M8GA 1H1TA 2XRZA 1NURA 1T6YA 3CLTC 4ND6A 4MUJA 3TZLA 1EFVA 1JEEA 4HK4A 4F3RA 4JYZA 1NI5A 1VLHA 3N8HA 1G59A 4GU5A 1KAQA 3G6KA 4EG5A 1GPMA 1GTRA 1FFYA 1MC1A 1U7DA 4H3SA 4R2LA 3SEQA 4G5FA 5KCMA 3Q4GA 1O97C 3N9IA 1O95C 3H97A 3CLRC 1JIJA 1KAMA 4KPUA 4RUKA 1QU3A 1ZJWA 4DDMA 1JIKA 4MW4A 3N05A 2GKSA 4KR6A 3CLUD 1K4KA 4DDKA 2IELA 3IH5A 3IMGA 1Q19A 4HJXA 4PBTA 4ZCSA 1PFUA 2A1UA 1I6MA 3HV0A 1QJCA 1KQNA 1WOYA 1Q77A 3ZXSA 3UOWA 1TFUA 1ULHA 4R2MA 3DV2A 1JMVA 2QJFA 2AKEA 2IJGX 1XNJA 3SZGA 4A91A 4E1AA 2QJOA 5FO0A 2A1UB 3HMQA 2VTBA 2CV1A 1QRTA 2PG3A 4MQ6A 2CV0A 3CR8A 2XRYA 3DPIA 4U8HA 3CLSC 3ZGZA 1NUTA 1I6KA 2QUIA 2A84A 1J09A 4I6JA 4RPIA 4ZT2A 4K0RA 5BNZA 1LI7A 3MLBA 1TYAE 3CLRD 3IUEA 4Q16A 3MLAA 1D2RA 4ARCA 1YIAA 3KT8A 1M8FA 1NP7A 3FOCA 3P0JA 3CVUA 4ZT7A 3GUZA 4U7JA 1MJHA 2D5BA 3D6UA 3G59A 4EG8A 3IVGA 3RBAA 3LCJA 4PBSA 5H16A 1KQPA 3FI0A 4MUIA 4WSOA 4PY2A 2HGZA 4HPWA 1N2JA 4OUDA 3IVXA 2GM3A 3UY4A 3AL0C 5KWVA 1OWMA 2CYCA 2JANA 2Z3VA 5TEVA 2O5RA 4MWEA 2X0KA 2G36A 3SZ3A 1G8GA 5TEWA 3CVVA 2EL7A 4MW0A 4TS1A 1XNHA 5LM3A 1QU2A 2NSYA 2J4DA 2RD2A 3K32A 2JAXA 1MOPA 1H3NA 2BYTA 4MW6A 1KH1A 1M8JA 1YUNA 5AHWA 1PFWA 1GAXA 2VXOA 1GTSA 4ZT4A 4KPUB 3FHJA 4ZT3A 3IOBA 4CT0A 1EUQA 1NUSA 3ZUGA 1U7XA 3PNYA 3L92A 1IVSA 4FZJA 3CA8A 2X1LA 4X0EA 1U0BB 2DLCX 1P7PA 4ZCTA 3COWA 1CT9A 3FDXA 3CVYA 4CDNA 3H99A 1PG2A 4MUEA 5DB4A 3IDFA 4JXXA 3X1JA 3PXUA 4MUHA 1R6XA 5DASA 3NBKA 4EG3A 2HMAA 1KKUA 1TYDE 3KFLA 3F3MA 5HG0A 1QRUA 1QQTA 4EG1A 4MWBA 4EF6A 3PNBA 2J09A 4MW5A 1NUQA 4UZEA 1N2IA 4F4HA 2CSXA 5LLTA 1N2EA 3KT3A 3MXTA 5KHAA 1NZJA 3NBAA 3AFHA 2WQ7A 1N77A 5TS2A 3ZIUA 1N78A 2QUKA 2QUJA 2A88A 1N2OA 3MUEA 1B6TA 3H05A 2E0IA 4MVWA 2CV2A 4ND7A 1WXEA 3IMEA 4OUDB 4CQNA 2RE8A 1KR2A 2OQ2A 1RQGA 1MAUA 3H9BA 4NAHA 1TYCA 3FWKA 3IMCA 2JA2A 4DNXA 4L2IB 5K0SA 4NDAA 4DE5A 4MW7A 5IHXA 2NZ2A 3IODA 2QJTA 3SDBA 3E27A 1N75A 5F23A 1PFYA 2O8VA 1QNFA 4EGAA 3RHSA 2QTMA 3SEZA 1KQOA 3IUBA 1OBHA 1S4MA 1KP2A 2V0GA 4K03A 4QRDA 1Y42X 4U63A 3COVA 2QTRA 1YULA 3TQOA 3BL5A 4JFAA 1IQUA 1GLNA 1O94C 1KH2A 2D13A 4J76A 3AG6A 4MW9A 1EXDA 3P0IA 2BTEA 5DEOA 3UK2A 3GLVA 1O95D 2PZBA 1EFPA 3KT6A 3SP1A 1VBMA 5H7XA 1J21A 1JECA 1IH8A 2Z09A 3U1VA 1A8HA 1LI5A 2PFSA 5TGTA 1JHDA 1O94D 3FG9A 1EE1A 2DEUA 1BS2A 2D54A 2HZ7A 1N2HA 4MUKA 1ILEA 2PXHA 4OJMX 1K4MA 4XSVA 4KR9A 1IHOA 2CYAA 1T6ZA 3M5WA 4YP6A 4MLPA 1XJQA 1MB9A 1WXIA 3S3TA 2H29A 3ND6A 1KP3A
chains in the Genus database with same CATH superfamily
2AR0A 3TQHA 1W29A 2ACKA 4R69A 3SKXA 2AFVA 4ZYYA 2IEDA 2QQFA 2DU8A 3CJTA 4D4HA 1L6IA 2G4VA 4WERA 5KNBH 3QIVA 1MXHA 4KXVA 4H59A 4DPKA 2CF5A 1GPAA 3S1SA 4BLPA 1VPVA 1QFYA 1GWNA 3MUOA 4OM8A 2NTJA 1U0OC 2UZ0A 2M6SA 3G5UA 1U99A 5DW0A 4Y6PA 4EYSA 4FMDB 5AKLA 1TUBB 3WLKX 3MERA 2PWZA 1R0YA 2YQ5A 1K92A 4K81B 5DCUA 4UARA 3UC5A 5IKOA 4RTLA 2EZ8A 2WF8A 3EB9A 1SXJC 2HMTA 3T99A 3VR2D 4NONA 4QBFA 4R2JA 1IN5A 1XZDA 4OJNA 2EX0A 2Q0XA 4BJ6A 4EG4A 3ZJUA 2QN2A 2I2AA 4U1RA 3IILA 3PUYA 2E18A 4BQRA 3KEQA 3OTWA 1XZ8A 3DZ8A 3ABIA 1KVTA 5JROA 3T7IA 2NUBA 3AP2A 3VJRA 4D26A 2GRUA 4LBWA 2H1SA 1B00A 1UKCA 2RH5A 3O75A 3EUWA 3D0OA 1S8AA 3ONVA 3FVRA 3UKJA 5CG2A 2LTAA 4YRCA 4FHFA 5IAGA 5LIPA 2OP1A 1JR6A 4MYTA 1JDTA 3BF8A 4QBTA 3F97A 5A4MS 3D8TA 4BLRA 3HEBA 3UFXB 5AIAA 1NRJB 3CNBA 4JP1A 3O2NA 1JLLB 3DAGA 3H5NA 1J8YF 1OOEA 2FPUA 2NLOA 3IB6A 3QGMA 1YQGA 4FX2A 4QQFA 4X63A 4YWHA 4DM3A 4JP2A 4ZZ2A 3RJZA 1SRQA 1Y33E 1JEYB 1PJAA 3UPDA 2AYXA 3L0SA 2ZSUA 3WWEA 1TT5A 1PS8A 3QH4A 3QKSA 1UAGA 3VU9B 4GPAA 4PSDA 1K2WA 3RW9A 1N8SA 3GVIA 4CIDA 3KSMA 3AZOA 1WXGA 4P93A 4W1RA 4C7XA 5ETJA 3BX1A 4LDRA 1QH8A 3MTDA 3OCVA 1N36B 1D4FA 2YY6A 5A3JA 3FKSD 4FEGA 2LKDA 1GU0A 2CLEB 4A82A 3BBLA 1L7NA 3OM0A 1SQ6A 2A92A 1JAZA 4G81A 1DV2A 2Q3MA 1THGA 3HJNA 3LY8A 3B3QA 3HJBA 4PWYA 4US2R 3ZXIA 5A7FA 3KKLA 3A0RB 1H2EA 4FSDA 3IE1A 1QLHA 4BP1A 2EP7A 3HXKA 3I8SA 3QE0A 4WFQA 1ICIA 1UM9B 3LFHA 3WOVA 3JD1A 2WE7A 4NMLA 2VT6A 3T1HB 1CTQA 2F3QA 2GX6A 3G79A 1YR9A 4EPTA 4LVCA 3V2UA 4ESVA 3OPQA 5IK2A 3L8FA 5K51A 2QT9A 4NU5A 3ORYA 4TM7A 3OHSX 4R6XA 3VTZA 3A4TA 5KYUB 2C04A 3I73A 3AUUA 3HABA 3AF1A 4B76A 3L43A 2PFKA 2W42A 4RHYA 3WWPA 3K53A 3MC1A 1XKXA 3QJYA 4ZALA 5KDDA 3W6NA 4GMKA 4LX0A 1PNOA 4WRRA 2CKMA 4LNHA 1E1CA 2GEDA 1ILWA 4ZT6A 3OIWA 5EHGA 1NKSA 4ITUA 3ELBA 4NQRA 5D6NA 3WBBA 1M75A 4RTQA 4FHGA 1J20A 3T1YB 1NM5A 1ZD4A 2KWIA 2O05A 2OC9A 2VDVE 1TU4A 3M89A 4H7FA 2OG2A 4HFNA 4ZAYA 5G02A 4M0MA 2ZUCA 1U1GA 3C3EA 4GBJA 4KO4S 3VPCA 4O4HF 5JWRA 2H2HA 4F38A 4TN5A 3VPDA 4BJHB 1ONOA 2Y1DA 4PGHA 5CEEA 1T8TA 3VHLB 1TEZA 2FEMA 1F7UA 4ZQBA 1J5XA 2VP5A 4ECAA 4PS1A 1FSZA 3P9YA 3OLYA 2BAGA 3U81A 4HBGA 1U04A 3EPKA 2P9TA 3PC6A 2P4QA 1I13A 5KSYA 3M6WA 4HH3C 4M0EA 5AVXA 3BIWA 5LZ5A 2V59A 3DDNA 3W8EA 4WKBA 3PB3A 4ZU1X 2O19A 1UBJS 3E9DA 1TDJA 4FB4A 2DY0A 2ZYIA 2XGMA 4KV9A 3GJ0A 1Q1ZA 2WA2A 2GCEA 2Q99A 2ZR0A 3ZHCA 2AI1A 1XVLA 2E48A 3VPGA 4K5QA 2DLNA 3BG5A 2G0AA 3H4MA 4YRMA 1T2FA 4GUDA 5EAIA 2ASVA 2XECA 3DNFA 3C1AA 4KJZA 1QIDA 2NW6A 4X64B 2CLKB 2BFDA 3MYRA 1P17A 4NCBA 1EBFA 1KMIY 3MJEA 5CDTA 3RFFA 3Q9UA 3Q85A 4OXNA 2IQIA 3BRWA 2OV6A 3DDZX 4GT1A 3U4GA 2DC1A 5J3JA 1VXOA 4LYEA 4RC9A 4MIYA 4ERNA 1PR5A 4A8HA 4GKJB 1OD6A 1P31A 5AJHA 1O0SA 5JZ9A 3CVWA 1S96A 4K7JA 5L3ZA 4BOYA 2IPMA 5IXJA 1E7WA 3HHPA 2QRQA 4HTAA 3EDOA 3SN6A 3UT0A 3VOTA 1I51A 3W9UA 4W7SA 2P40A 1AGYA 3K09C 3LA6A 3QJ5A 3QELB 1KAOA 2H1VA 3RBZA 2O8NA 3TW4A 3ZDXB 1P2BA 1FCJA 3WIEA 1IEVA 4EM6A 4Z51A 1L4LA 1RCTE 1EKXA 2WYVA 4LHSA 5JEDA 4M0CA 4RMIA 4Z9BA 4EFMA 4CFYA 1ORWA 3BD8A 2WTEA 1PS0A 2I54A 2BEVB 3A1UA 3D0QA 4LI0A 3UJBA 4B0OA 3P4YA 5SY6A 4DUZB 1JAIA 3NANA 3LCMA 4NRDA 5DHSA 1D1QA 2AJDA 2ZU0C 1QFMA 2QD5A 3D6VA 2ZKLA 3JVEA 1G6Q1 2CZQA 3HH8A 1T4GA 3TECE 3DDWA 1E0AA 3FCYA 3PUVA 2O0KA 1PFVA 4ECEA 3UAZA 4CT4B 1J0EA 2HHAA 2XMGA 1JF8A 4PG4A 1DDGA 4LJ6A 1VSQA 2VEOA 4CM4B 1NKTA 2YMLA 4DPLA 5K8LA 5K09A 1HE2A 4LJ4A 3WGZA 4D9GA 4POOA 5IVHA 4QYTA 1G0NA 1Y5NA 1B7GO 4BO8A 2IDKA 3B85A 3S8EA 1KDZA 3M6FA 1JEEA 1KPGA 3DQPA 3UT5A 3H5LA 4L0MA 5FRDA 4RPCA 2RKWA 4AY6A 3B7GA 3UK0A 4EG5A 4GO1A 4JQYA 4X3OA 4ZVNA 2LXNA 2AN5A 3ZU3A 2P4EA 2Z30A 2KE5A 3F2VA 3AIOA 1PL7A 1A2QA 1ZG3A 2EU8A 3SF8B 3AYZB 4GLOA 1A5SB 2NZUG 2QRPA 4RKEA 5EINA 5GJCA 3ZIAA 4H3VA 3JQ7A 5JARA 5DJ5A 1I3OA 1JT9A 2P8JA 2WTMA 4DDMA 1E7MA 1WVGA 2ETVA 1SG6A 4UTZA 4JBWA 4DDKA 1A4RA 5DTIA 2QTCA 5EXTA 4YMGA 1ZAYA 1VJRA 3D3WB 3MMNA 1DG3A 1PFUA 5EXDA 3TFQA 3M2PA 4Q82A 4JJFA 1BWPA 2IPOA 2XR1A 2SCUB 3IAS1 4XWOA 4BNDB 2AQKA 3ZE6A 4X1IB 3OQBA 3TOCA 4YAUA 1GDTA 4U00A 2D1FA 4X6XA 2FN9A 4C20A 3OF3A 4N8SA 5FO0A 2OQRA 4IO0A 1OXXK 1RZVA 4ZVKA 4ASUD 2ISQA 4IDNA 1UMCB 3ORRA 4EA6A 4QPJC 3Q8KA 1QHNA 4BC0A 2EWWA 4U8HA 4EF4A 3KK0A 3RG8A 1NUTA 1MR3F 2IUEA 2XNDA 3DJYA 3Q1LA 1JLRA 1QIHA 4MIEA 5HF6A 4QYWA 5BN4A 1PWZA 4DV6B 2CBZA 1GSHA 3HJHA 2GJSA 3OT1A 1FRQA 4ZT2A 3W2FA 4EJSA 3H5VA 1B1AA 2A67A 3DOFA 1L7OA 2AZMA 1AX9A 3HDGA 4RV5A 2UZ3A 4RLQA 2LP4Y 3BQNB 2B1RA 3SYLA 3DT9A 3M4YA 3V1UA 4C4YA 3KPWA 3K70C 3N2KB 5ICGA 4L6CA 2Q1TA 4QG3A 4IDCA 3NT5A 1IWOA 1QR2A 1ZC3A 3QV2A 3A6FA 3V4OA 1E9VA 3A25A 4MCJA 3VZRA 3EARA 4FJ0A 1MABA 1DB3A 2HSGA 1DKOA 4XTRA 1V35A 1SU7A 1G60A 1AQJA 4HRYA 2C4WA 1UADA 4K9QA 1XCOA 3K0EA 5AM5A 4DYHA 2WAMA 3AR6A 4IY1A 2QRHA 3GUZA 4RY8A 1BQEA 1QDEA 1RTKA 2BEWB 2IU3A 1B1CA 2R84A 1NNLA 2ZDGA 1ZMOA 2ZW9A 4JJ4A 1C7JA 1KQPA 4G0VA 2IS4A 3V1NA 3VGPA 1MB3A 4DIEA 5JH7B 1KIFA 3ETHA 3DBRB 3Q87B 4KE8A 2HGZA 4HPWA 1DQSA 4D99A 2VBGA 3VTAA 2ZRQA 4ZARA 4UUBA 1LLUA 2PGJA 1HTBA 1VZ3A 4B4VA 2ZIXB 1F2DA 4W8OA 3QTLA 1X7DA 1KI7A 1FVXA 1G3IA 1X8KA 4ZDKA 1BMQA 2FSIA 4AP5A 5BSFA 3KXDA 1NPYA 1IMOA 1Z56C 4EHHA 5TJHA 3CQ9A 2HDWA 2LD4A 4W5WA 1GG2A 5KC8A 2FK8A 4MDEA 1U3VA 1E4EB 1ODSA 1EFCA 1KSJA 1KEEB 1QGED 1C1DA 4ZDWA 1QBKC 2LKCA 3PHCA 4MICA 3SC3A 1KY5A 1KZYC 2VLIA 1MGOA 1TVKB 3UJ6A 4IM7A 5J4KA 1GTSA 1BX0A 2BJVA 1TPYA 1YIOA 2M1ZA 2NVUA 3EAFA 3I0ZA 5KDLA 5E6SA 3DAPA 3R3WA 3UC9A 4RD3A 1K4YA 2IA5A 1IZ0A 1U6IA 5JDCC 1UZMA 2JCVA 1N5MA 3FZEA 4FZJA 3CA8A 3PKIA 1IU9A 3LY7A 1IOLA 4MV4A 4QTTB 1K88A 1I1QB 2QLLA 4IX1A 3R1IA 4IDAA 2P2GA 3ZXXA 4OEHA 5LP6A 3DLBA 4Y3UA 4J43A 4EY7A 5LJLA 4NICA 3RFUA 3FDJA 4IVRA 4QT4A 1JI0A 3PFHA 3NI2A 3AI7A 10MHA 1OFUA 3WRYC 5IASA 3DUFA 3QYPA 1N8TA 4C76A 1RTTA 5EIOA 2QAGB 1T8YA 4FFDA 3SR4A 1XZMA 3IBGA 1F2UA 2E2WA 4YV1A 1PVOA 1DOZA 2BFOA 3S1AA 4PAWA 1NJ1A 2XT6A 3WBKA 2AJBA 1A4UA 5IAEA 4GDFA 1E3IA 3AUJB 3NTVA 3BULA 1UFOA 1UPXA 1JDZA 5C7IO 5JYCA 2IKSA 3QFHA 5DSTA 1J9EA 5FL7D 4Y1FA 1D2MA 3ZHVA 1KDPA 2PNFA 2W2QA 1WMAA 2WTBA 2XIJA 3HKDA 3JYLA 4G3XA 1XKLA 5CFQA 3F9IA 4P4SB 3JQFA 1QPZA 3C3KA 4G5XA 2GSWA 1RC0A 3MLEA 5CNKA 5DXFA 4B2IA 2CCKA 1T0PA 1ZM7A 2EFDB 1NOJA 3S4YA 5J63A 4QYSA 2XOKA 1HFWA 1X1QA 4C4AA 3PSHA 1UMCA 4X24A 3TE7A 4C6SA 4UTNA 4L22A 1TU0A 2KI5A 1J25A 1YR2A 2NU6B 4MV3A 3NHZA 1H42A 1E5DA 2JLQA 4Z9FA 1E7YA 1RJDA 4EQ6A 4LYAA 3AR8A 1BWQA 3IHWA 5HHTA 3FI9A 3T5GA 2I4MA 5HSGA 5IAAA 4TV8A 1MAUA 3MQFA 1YQTA 2W8BA 3BIJA 4Q4JA 2JA2A 1AKRA 2NO1A 5E4YA 3RRNA 4JQSA 4B85A 3NAMA 2HQSA 4TTVA 1N1EA 4IIEA 5GONB 2CMDA 1GD1O 4PLHA 5EKUA 2VQ6A 2XTAA 2XMBA 1HV8A 4H16A 1UT6A 4FI3F 2I2DA 5ALSA 2CKDA 3ZDDA 2XQKA 1P7WA 3M1YA 3VNBA 1PVDA 3SDZA 2O3UA 5BN1A 4P35A 4YX9A 5KO2A 1S4MA 1I2ZA 1R10A 4CEJA 4J1SA 4MRMA 3UZUA 4AMBA 1N92A 3LH5A 4PYKA 4YUVA 1OJ7A 3N0WA 4KN6A 5GP1A 5LMUB 3VH4A 3QBTA 1H0RA 5JOQA 2HYDA 5HIAA 3CSDA 4BLUA 1EX6A 1EXDA 1T2VA 2Y1XA 4BB6A 3H04A 1IPFA 2BTEA 2PAAA 3LRPA 2GAJA 3AVXA 1JEQA 4BMOB 1DBPA 1XK7A 4KSCA 2AE2A 2P5SA 2YC4C 1OXKB 2VEDA 1ZIOA 3DZGA 3SBOA 2F1JA 3BMNA 3E5NA 4QICA 5EHXA 5BN3A 1I4OA 2NG1A 1VHDA 3CKKA 1X0VA 3DV9A 4L3VA 1M6HA 3CGGA 3W90A 4EGFA 1MA0A 3THXB 1JHDA 4RACA 3THRA 4HOYA 1W0JD 2IHJA 2GPWA 3W6OA 3U4IA 1KBOA 2UVPA 3ELYA 4X71A 1NSFA 3MJFA 1TTQB 2XUQA 1TEVA 4J2OA 3GH1A 4GL2A 3SVTA 1CETA 3TPFA 1WETA 4RD6A 1LK0A 3WZMA 4MLPA 3EWNA 3A1VA 1KZ7B 1VSVA 1WAMA 5K3OA 1HR0B 3A06A 4QIHA 3RBVA 3FSRA 3BN3A 4M37A 2YJNA 2I1QA 4A6PA 4BFLA 5JAOA 4CLDA 1JDSA 1XHEA 1YCFA 2IIBA 2O7QA 4PU0A 2I2BA 1WD5A 4H1WA 2ZRFA 3HVKA 3T9DA 3IUNA 2B7LA 1EX7A 4UNQA 2VNSA 1SM4A 4F3KA 4YO8A 4G4SP 3TYXA 5BT9A 3HGMA 1A9YA 1KDRA 3C3XA 3T52A 3IVRA 1LUAA 1G17A 4RV4A 2W2TA 4GPBA 4AY2A 3T1VA 5PGMA 4PCUA 4EA9A 2JFQA 1OH7A 5HIKA 2EJTA 3BL6A 4NYMQ 4FFRA 1JNXX 1FQJA 4KN5A 3T54A 2R6CA 3BWVA 2GVDC 1VOTA 2JIDA 1P5HA 1Z7YA 3IJRA 2E9SA 2YVKA 3L6OO 2HV9A 1GRQA 3EIQA 4RJ2A 5GY7A 3TN7A 1GY8A 1JQAA 2L2QA 1N5DA 2WF6A 5CXXA 5CFOA 1M2VA 1SBIA 2ZDQA 13PKA 1Z88A 2TS1A 2JLYA 1Y1RA 4BCCA 1E2NA 1XYVA 1ICEA 1Y4AE 3FN4A 3LQ4A 2JD2A 2WWFA 4FJ2A 3TL2A 5HXAA 3PC7A 1Q15A 2IYZA 4MPDA 3QFCA 4OP2A 3LFUA 1MA3A 4RBNA 4URHA 3UUWA 4IIBA 5G0VA 3U3XA 2PUFA 5KINB 5FAKA 2P62A 5FA6A 1H1DA 4IJVA 4B3MB 3ZQUA 3TKYA 1JFSA 2JJ2A 4AO8A 4KFSA 2PMBA 1QP4A 4KK4A 1G8MA 5FF9A 3BD6A 4JC8A 4O0LA 2MSWA 1EJBA 2CLHB 3ZCXA 4GVPA 4TSRA 4U9IS 4CMKA 4QKQA 1V5EA 3LA8A 1WEKA 1II8B 1CY4A 3QVGB 1TKBA 3T0IA 3H1EA 4B7UA 1VCNA 1NW3A 4C04A 4OUKX 4EFLA 3QE3A 2JGJA 2ZZMA 3ZC3A 2IH4A 2F62A 4M1TA 2EARA 4W8GA 2WYWA 2ZI3A 3VRHA 1IK6A 1RI2A 1E2HA 3GD7A 3Q3EA 4HQRA 4I3HA 3LKVA 1L5SA 4TYMA 3F6CA 4CLRB 4KCGA 2X3FA 1Z22A 4UBOA 1HNXB 1SH7A 1KKLA 1KC3A 3DYVA 2CXUA 3ZV7A 4EFKA 1RYFA 4YJ3A 3C7AA 2P0AA 3LZ6A 1USIA 3IAS6 5E6RB 3CW2A 1PK9A 1L5LA 4U3JB 5JLJA 4MVJG 3RC9A 2J4CA 1C4KA 3O5AA 4EPRA 4YV0A 4OQ4A 1YZKA 3BRSA 1O96B 1LDEA 4KTVE 4Q4CA 5SYNA 4QECA 1K2VN 1V3QE 1VJ5A 1CJKC 1E2JA 1NFFA 3QEKA 4H4DA 3AOGA 3KHKA 4M0FA 5DP1A 1E5TA 2SICE 5EVCA 3RSOA 4YRQA 1C1XA 1VYHA 1U8UA 4XKJA 2FU5C 3C8MA 4AK9A 5ARCA 1U1CA 2O8CB 5F2KA 5CDGA 3N87A 1PFKA 3U60B 4LFBB 2GLXA 2JFGA 3IPYA 3O3NB 4QXQA 3G89A 4RHUA 3N7UA 5H4GA 4O33A 1WPQA 1QHSA 2CFTA 1AKWA 1UPTA 1YIDA 1Q7RA 2G0NA 3PD0A 4XSHA 1I1OA 3U3ZA 1FUIA 3EIUA 3K94A 1YZUA 3THWA 2X2OA 1IY2A 1XEAA 3ZKAA 5DNCA 1MJGM 1E1DA 2NGRA 2UVPB 5BN5B 3UW1A 3N2YA 4KFTA 1G0OA 5CIQA 4BLWA 1E5QA 4PQEA 1THMA 2I3GA 3L1VA 2Q4TA 4IXWA 4QPZA 1XZKA 2D7CA 1U3CA 1ZGJA 1Z6PA 3UK1A 5HJ7A 1IOWA 1AU9A 2Q3HA 3FTCA 3JVDA 1T24A 4MUYA 3EC1A 4BWVA 2FPOA 1Z5UA 2JF0A 1IFXA 1RQ2A 1Q1EA 1QO9A 4JDUA 2QMZA 3OEED 4EA7A 2YXDA 1UPBA 2IUFA 4WLEA 3H86A 3OE5A 2ZQYA 4YMWA 4H6XA 1Q6YA 5LKAA 1KI6B 2H2IA 4CRWB 2ZB3A 1Y6RA 3U3MA 4YCNA 3WV5A 2QE6A 5A2GA 1DQZA 3TSOA 5CB4F 5KKNB 1WQ4A 4MLDA 4JQCA 1E7QA 3PVCA 4A9AA 1QM5A 1V4BA 4DLWA 1SKAA 5JRDS 2A1TR 2VPWA 1QZTA 1WUTA 2E85A 3BSWA 3U3KA 3I5YA 3O84A 3NWJA 1JR3A 3VFDA 1ORTA 1RI4A 2I1LA 2QQ0A 5LDHA 4Z4IA 2CNLA 3OZAA 2P78A 1OHHD 1N2GA 2IZOA 3AU9A 2IWRA 4A23A 4AXXA 3DL2A 1DCFA 3FF4A 3NRCA 5JCPA 3K8OE 3OMXA 1W36D 4J7XA 3HN7A 4XGRA 1DI0A 3QEBZ 1IHYA 2ZUDA 4OREX 1DIRA 1QORA 1D6NA 2MSLA 1EFVB 1SELA 1W46A 4GSLA 1WUYA 4Q7MB 1TD1A 2PL9A 5AWFC 3RWBA 5LPNA 4LF8B 4N6OA 4HAYA 1VPEA 4MB2A 2ZYUX 5BQ5A 3RTAA 1F4PA 3K05A 3ZLVA 5HZKA 3C5EA 5G3ZA 1CV2A 1SKQA 1SZJG 2VQ3A 2VRCA 2J6BA 3AHCA 3GRZA 3P1JA 4YQYA 1EB8A 4FIZA 1T3SA 3MSXA 3LUAA 2GJ8A 3ITEA 3ZI4A 3NHJA 2HIGA 3L7OA 4EGJA 4CEHB 3RSHA 1OI4A 5HKAA 4L0DA 1PX0A 2XB4A 4Q48A 4N7RA 2R48A 1EWVA 3NBYC 3R44A 4WNYA 3UAWA 1DEHA 1F4VA 2QRVB 5GIPE 2YY5A 5A4JA 4Z1MA 2ZYRA 3LYHA 4RZUA 4IJKA 3WXMA 4DKXA 2Y2VA 3QBJA 4KG7A 4ZOLB 3GLRA 1PS9A 3P52A 1FC0A 3RAJA 4JX8A 1JVNA 4OAPA 1T6XA 2RAFA 3UUEA 3TJRA 4CUJA 4HZGA 2DR3A 1SKMA 2X19A 4LQLA 4P3PA 3VU8A 1PVVA 1U8EA 3E15A 4MYRA 2DETA 2BMAA 1OKKD 3G13A 1EM8B 2ONYA 5ALOA 3EIOA 4U3JA 3LGAA 4PZDA 3AHFA 1GZUA 3RS2A 1AQNA 4BPRA 1ADBA 4IDDA 2OV2A 4TYQA 1GCUA 2VAVA 2PNJA 4WCFC 3JATB 3QX7A 3KOWA 3E58A 1H1TA 4KUEA 4QO7A 3FNBA 3NH6A 5CT6A 5B7NA 5CB8A 3H0KA 4H4CA 1Q95A 1YZHA 2BMDA 2EJWA 3B1FA 5DZSA 721PA 3WL4A 4MQ5A 1VLHA 1QWSA 2B30A 2P2CA 3N8HA 3P32A 3DC2A 1JA1A 4CT5A 1NW8A 4XEHA 3PDUA 1MDBA 5FH9A 2RHTA 1J2UA 4CMIB 5K01A 2X7HA 4YHHB 2ADMA 1SHUX 2UUOA 3ODPA 1E3DA 1EP1B 1W5BA 5KHLB 1O95C 3PFBA 1XDZA 4Q21A 2OQIA 3QLVA 2HZBA 4QHSA 1PZFA 1UK9A 3DM9B 3H11B 4E5PA 5FPTA 5IJ9B 5FWDA 2F3TA 3S81A 2BCEA 4DDWA 2C4VA 3KTAA 2I2XB 3HV0A 2CN1A 2FGKA 2PANA 2XSZD 2XWQA 3C6BA 4HDNA 1JH9A 1OH6A 5LXTA 2C4NA 3WGGA 3DV2A 5AW4A 1PNRA 5B1SA 1ORDA 2AKEA 3H8VA 4MR9B 1Y5MA 1RDFA 4NSNA 5PNTA 2BFFA 3ED5A 3PEYA 4Q7LA 4AVYA 2OD9A 1DDOA 3CR8A 1FZQA 2IYYA 1H6DA 2HT6A 2ERXA 1W2HA 5EGSA 1UWVA 4N5IX 2G1UA 3Q2KA 1NW9B 3ZGZA 4X8HA 2JI9A 1RYHA 1SK8A 1JX6A 2ZBDA 3PPVA 1AS2A 4RPIA 1JYEA 4OOFA 5HX7A 1JBKA 3GW8A 3HXPA 5ALVA 4OKSA 2LBPA 1C9KA 1DQNA 1BCSB 3P2YA 4QULA 1GLVA 4E5VA 4NZYA 1CQJB 2WJJA 2NVUB 1KYTA 2WAXA 1SVMA 1L7QA 1Q0RA 3PNKA 4PXYA 3RFVA 4B3FX 1T29A 4PG6A 3KKOA 4ARCA 3HNPA 3NHBA 5E2AA 1E1LA 3DXYA 4JNCA 1SOAA 2YJ4A 1B76A 1DAFA 1E69A 3NFRA 2X0NA 4MUAA 1KNXA 1KXJA 3HDQA 2VATA 4UVEA 1BRTA 2RGYA 4ETWA 4GKKB 5GJBA 2O8FA 4AICA 1Z13A 2JIZD 4HLCA 4WNCA 1RPZA 5ALWA 2GZ1A 1Y3DE 5J2TA 4OJYA 3MSCA 4HB3A 4MUIA 3EIFA 4IQ4A 4O29A 3REGA 3RHFA 2ZAIA 3DMDA 3NIGB 3CZMA 3R5TA 2WSLA 4BLOA 4MI6A 3MWDB 1H6BA 2J7PA 2D5CA 4OHCA 2C78A 1CS4C 2Q2OA 2HQOA 4XPIA 2YHIB 4ZI2A 2JANA 5JSYA 2ISSD 3J81k 2QV0A 2IYFA 3DPUA 3QKWA 4EHAA 4OQDA 2PMCA 3DBRA 1AHNA 5HZMA 3CB2A 4HC4A 5CCBA 1XNHA 2NSDA 3ZHXA 2WKPA 4AG5A 4G4IA 2VBFA 3LG2A 4EABA 2OY0A 3OZSA 4IL5A 2Y8EA 3PPYA 621PA 1ZL0A 2C59A 4C4TA 1L7RA 3I37X 1LRLA 3RLIA 3QRWA 1JQBA 1ZOPA 4QQNA 4KACA 2BL4A 1LPOA 1PL6A 2RKOA 4ROTA 3SWWA 1WPRA 1U90A 5ELMA 1KVQA 4M7WA 3ZLUA 2IC5A 4N18A 3H5AA 1KEKA 1XTQA 2YBDA 1LI4A 1UPFA 3WNZA 4AB1A 3SQWA 4YNBA 3OQJA 1MC4A 2OECA 4FFBA 1LSOA 1U7XA 4G5HA 3M4NA 4JT2A 4OHPA 1J0DA 2WUEA 3HYNA 5JS6A 2HWKA 3IJ5A 2PUHA 1WBJB 3D5EA 3EK2A 4LOLA 3L1HA 4ZVMA 2KSQA 4C0SA 1FXWA 1AQYA 3R2JA 3R7FA 1YA6A 3ET4A 4UDNA 3SPXA 1T1SA 4GVXA 3WX0A 1SN7A 4BE4A 1NQTA 1UFKA 2ZJOA 3B1KA 4EITA 3DEYX 3R3XA 4JXKA 3VO1A 4FHEA 1SCKA 4B09A 2VHEA 4P53A 4QXMA 3IVMA 2WTAA 3H99A 4M8IA 5GVSA 1WPXA 1FS4A 4G8DA 2DULA 2I78A 3H5IA 1T15A 2G1JA 2YCLA 1P3Y1 2HREA 5DHPA 2C3OA 3PXUA 3TW0A 3NBKA 5CYPA 1NQAO 5EG5A 1EVYA 2PUTA 3LCRA 1OAAA 4FR0A 3E7PA 1F5SA 3EVEA 3EGWA 3NKLA 3J80A 3RC8A 2V74B 1DKLA 5JJBA 3JWHA 2VUIB 1WLSA 3G85A 4H9GA 5ILGA 2Q7OE 3ROTA 4Q4AA 2O8EB 1DHRA 1I24A 3UPTA 1TA0A 2PGLA 4K9MA 4YA6A 3TMAA 1LTHR 1UP7A 4DMFA 2B8NA 2CSXA 3V4SA 2NMVA 2F8TA 1AXRA 2CGEA 3DL7A 2VPXA 2PZJA 4F6RB 3AHHA 2XITA 3SOPA 1W6RA 1T43A 2R6JA 1AOXA 1OC4A 1LNQA 1YFJA 3ZNOA 1ZVVA 3GRYA 1N78A 1PQWA 2ATEA 3JQ6A 4D9NA 1N2OA 5FV7A 1VKOA 3H05A 3JX9A 2ZYWX 4R8RA 5DGIA 1CQIA 1QYVA 3L84A 1NGSA 3LUGA 3DDHA 3R6LA 2GBGA 5ITWA 3R0QA 4LGMA 1IBMB 4X20A 1D9XA 2WG2A 4MP8A 5K5EA 1WNTA 1W6UA 1ST3A 3F3YA 5SV2A 2DMRA 3HA3A 3OQ6A 2Z2YA 3NTXA 3QLJA 3MIIA 1HX7A 4PPNA 3LHIA 5HEKA 2WR8A 3FZQA 2NT3A 3K0AA 1F8FA 3U31A 2P2DA 3U09A 2IY7A 5TQJA 1WMSA 3WBJA 4WXRA 8ATCA 2WVGA 2PLAA 1ECJA 4EK9A 4XRGA 1OI7A 4O5OA 3REFA 1AQUA 1P29A 5K3SA 4OBXA 2H9AA 3LPLA 4C7OB 2IPLA 5C1PA 5K8CA 3R5FA 2BEVA 3OWHA 1HEUA 8ADHA 4EVSA 1RP7A 3COVA 3E70C 5LZ4A 4N3CA 1SUSA 2DQ4A 2GCOB 3WRVA 2CMGA 2HSZA 4XQGA 4ZAWA 5H81A 5BXQC 5J2TF 1NF9A 4Q7EA 2OBNA 4BX2A 1DBQA 2QMYA 3CV3A 3HLKA 3IHKA 3NZEA 1KFBB 4KE6A 3A11A 4F7WA 1EG7A 2FXIA 4NPHA 2PFSA 3NNDA 1QH1B 4FKZA 2BHSA 1PGOA 3AV3A 4HDMA 1R8YA 1ORRA 1X2BA 2F1KA 2GEBA 1MPTA 1WCWA 3C70A 2PGXA 4KK3A 4EVIA 1T0IA 1TCCA 2PXHA 4G5OA 2PBLA 2QP3A 4PC7A 2ZYVX 1ILEA 3RSSA 3DE0X 2Z95A 4MI1A 4O2LA 3UMRA 2QY9A 3HRKA 1A72A 3CO0S 4IUBS 4MKFA 3B6EA 3IPXA 4NG4A 4ZIRB 1QCDA 5DI3B 3PGLA 1CEXA 3ZJYA 2ZANA 4EBBA 4EH1A 1P74A 4B3RB 3DO8A 4DIDA 5U1PA 3HSKA 1AB5A 4B47A 2CLMB 1Q16A 4YO7A 1PJCA 2XHZA 3KPUA 1XQ9A 3LRXA 1WOMA 3MGCA 4GFDA 4N0PA 4YDRA 1D3AA 2FWPA 1MHPA 1BEZA 3IALA 3F5QA 3HHEA 5C35A 4I2VA 3LUDA 2FFHA 4LBZA 4AS3A 4B4OA 1N1MA 3NTQA 1Z2CA 3FM9A 1HOXA 4KJXA 4OVKA 4LHZA 5LXTF 2RHDA 1D8TA 3CRMA 4Q1AA 4DA7A 3A04A 1NVTA 2EIXA 3D1JA 4E14A 1RADA 1TADA 1O08A 2I4LA 3FAKA 3GROA 3KB2A 4FDTA 4S2EA 3U26A 2GZDA 3ZZMA 3ZS8A 1NVXQ 4Z4HA 3WYAA 7ABPA 1M83A 4WZBB 3RQIA 5FWNA 3SXUA 4ZGWA 3KWMA 1LPSA 4J0CA 3FWYA 4L85A 1ZSVA 1SXQA 3LP8A 2FZ4A 1ZJJA 3TDKA 4AMVA 3I32A 1Z8HA 2WAYA 2JGRA 5B12A 2WA1A 1DPGA 3ZJTA 4GQIA 3PHJA 2Q27A 1RSZA 4QFBA 4J3JA 2E4UA 1R0CA 4LECA 4Q4AB 1QJ4A 4N41A 2F8MA 2DWUA 3RSQA 4B7XA 2FPLA 1HMPA 2A7QA 2YVAA 4JLSA 4AQDA 3IQXA 4DPMA 3S0JA 3RVQA 2EFYA 5T6BA 3AU8A 3VKFA 4BKQA 2ZCUA 4M1QA 1S2GA 3V1KA 3AP3A 4WX2B 1KZHA 4HEQA 1UUFA 3PI7A 1UFQA 3BDIA 4MW1A 4XCVA 1O3YA 3WRYA 5BV8A 3UG6A 4J16C 4LEIA 3G0OA 4II7A 3A58B 3I4FA 4RNCA 4A3SA 4DM7A 2PJDA 7AT1A 1IVNA 2O0LA 4PGGA 3M9LA 2OPHA 2C2GA 1R7RA 3KCQA 2IU6A 2ZJ6A 4ENRA 1HNWB 4MKGA 1TI7A 3K9NA 5T3UA 4DCNA 3F5FA 4LUCA 4NV3A 2OM6A 3MJRA 4NBSA 1E9EA 3M5CA 4L8GA 3QPVA 2G82A 4MV1A 1VECA 4RXMA 4HN2A 2EOAA 5EJFA 4L74A 4PHFA 3UMYA 2DHCA 1K3TA 2NZWA 4JI6B 1DTSA 1QZXA 4G0YA 2HL6A 4J0HA 2C5AA 4JP8A 3PDJA 1W96A 4ZN6A 5KNDA 4MQFA 4QVGA 1UFVA 2RI1A 1GTJ1 3ZGXA 1Z47A 4JT9A 4ARIA 3H4IA 3IVCA 3JVVA 3JQQA 4U6QA 3UV3A 3Q7PA 2IBTA 1Z34A 3Q8LA 1NNI1 2GA8A 3LCUA 4L27A 1XDWA 3JQRA 5A62A 2VPYA 4YMIA 3SS8A 2ID4A 1MIHA 3R3HA 2QRJA 4YJ2A 2VN8A 4RPLA 2X1MA 1U0EA 2WHYA 1JSXA 3RTCA 2ZWOA 3R3SA 4M60A 4B9EA 4DSTA 1T5DX 2P2ZA 2D4AA 4AZTA 3HB4X 4HPJB 1EJ6A 2EIHA 3AT1A 4YMSA 5ALMA 3PUKA 4N9WA 3O26A 3EWSA 5TNXA 2NQ8A 2ZPAA 1R9JA 1YV9A 1J8FA 2RJNA 4MOWA 4WLFA 5IFKA 3CLSD 3PGA1 4B3CA 4GPIB 1HT0A 3QBDA 5J58A 2GBIA 2NO9A 1TTPB 5AKJA 5A06A 2D62A 1CK4A 1EDDA 4BMCA 4BQFA 3GLHB 3PYMA 5JAUA 3FF1A 4KUHA 4OI4A 5KNBA 4F3CA 5EGNA 4CPDA 3UHJA 1UBOS 1JXAA 5CB6A 2QV7A 1KVSA 3BXHA 2PZLA 1E6UA 3EGDA 3U7JA 5KTTA 5LJIA 5CPBA 4WUTA 4HMPA 3SFVA 1NPTO 1IG0A 2B7BA 1A7JA 1QV6A 4NATA 4DMHA 4EEZA 5C7LO 2YC2C 3T5MA 3JCZA 1WM1A 3AUSA 1XEXB 4Y18A 2W2XA 2VYND 2EFCB 1E1CB 3EMKA 3BORA 3G9UA 2WJGA 1EHCA 1PZMA 4Y2QA 4W5QA 3EPLA 1F20A 1U1FA 2N1MA 1JQ5A 4HMOA 2VCHA 4X6LA 4D8TA 2BBOA 1ADCA 4L8WB 3JR3A 4UQOA 3DAHA 3GJ8A 5TPZA 3ZCSA 2JARA 3FPBA 2I6UA 3E9MA 4R5MA 3UBMA 1PNTA 5H3CA 5E1MA 1YBHA 1DLIA 4KQ9A 5AXDA 3RK4A 1ZEJA 1FJ2A 2QL5A 3KQPA 4MQEA 2YXNA 2FRVA 5EWLB 1E6WA 3MELA 1WZ2A 1PJRA 2R97A 3GLIE 2EBWA 3FZGA 3DE4X 4NI5A 3EEQA 4NY1A 4BO5A 1OSNA 4V0LA 4DZRA 5KYKA 5H8WA 2PX0A 4JU9A 4LRYA 4HQKA 1HZZC 4KIJA 4C22A 3KOZA 1XCLA 4NK4A 1JTEA 3MBKA 4JLJA 1VLQA 3KS9A 1JQEA 4FMCF 1M7BA 5F3RA 1HA3A 2R7NA 3STHA 1V8PA 4UATA 1WW3A 3EULA 3F3KA 4I14A 5B37A 4AZVA 4QQRA 4G67A 3KPVA 2VJMB 5CD9A 5HF5A 4U7WA 1P60A 1YS9A 4JLPA 2YY7A 1YZLA 1TT5B 1J2YA 3V34A 1NVAA 4UHEA 2AFRA 1SUDA 2RHHA 4QEKA 4D43A 4D56A 5DOVA 3U19A 1GGVA 3WWOA 1PAUA 4FP9A 3OFVA 3GEGA 1ZNZA 5HMLA 2ZTUA 3VMMA 2L82A 1NVKA 1T9GS 1V3UA 4F1JA 3Q7QA 3JW8A 3EVAA 2IH5A 3VC3A 3AZQA 5BSKA 4FE3A 4B82A 2ODPA 2NNWB 4X41A 4FBMA 2OAGA 5MFPA 1R18A 2Q6VA 4F84A 5CEFA 2A5JA 5F35A 2B1IA 2Z5VA 3BFKA 4B7CA 2Z8XA 4QHYA 2DERA 2W2KB 1P2UA 3OQIA 3G3EA 3HFJA 2R11A 4JOSA 1DAEA 4TMWA 4RX1A 5MFZA 3S5JA 3CF4G 2HPHA 1ULTA 3OOYA 4FCWA 1VBFA 4LDPA 1G41A 3C8ZA 3RB8A 5DGHA 3RIXA 1A7UA 1H69A 1YI1A 4ZRDA 2GN4A 1QIEA 1NDUA 4A2PA 3JAMA 1VG0B 1PR2A 1RI3A 3KJNA 1M74A 3QNWA 1NURA 4H7JA 2QN1A 2BGUA 4Z5XA 3KHSA 4UU7A 3PFFA 2AZTA 1SKUA 4I9UA 5LMNB 1YAHA 3CINA 2I6XA 2C4UA 4MUJA 4RIFA 1BE0A 5LUBA 5HGXA 5IFLA 2AN4A 4L0QA 4DTCA 5AVUA 3HXQA 3KFVA 1KZ4A 4QYIB 4CLOB 3BE6A 3WQBA 1JHAA 3FUXA 2WVJA 2PM8A 2ZCJA 4BNKA 1FFYA 3ILHA 1QQ6A 4Y2VA 2P41A 3M6XA 3E9NA 2PZFA 4WHMA 4D3XA 3KVYA 1TC2A 4RVOA 1MJFA 2JCYA 4LY6A 2C8JA 3BIXA 1P77A 3DWIA 4FFWA 2EX4A 3BHJA 2FX2A 2W6ID 1C3EA 2IYWA 4JWTA 5AKEA 5IANA 3ZDRA 4N7JA 2B1JA 2OZLA 5G4KA 1XEWY 4DMMA 2C4HA 4ZAZA 3P2OA 5JNRA 3KE8A 3EZ2A 4C43A 1RWWA 2RGWA 1C3XA 1H4VB 3CLUD 1CF9A 2IP2A 3N5KA 4LHEA 4CL0A 4FW8A 2XQVA 1ISGA 4BE9A 1KSHA 4HJXA 5IUNC 2UYGA 3OEYA 2NM0A 2A1UA 2VUTA 1YFZA 5CIWA 5LIRA 4FM9A 1FF9A 4OAOA 4UASA 1I7DA 1N5IA 2J9FA 1BZYA 3HZOA 4ENPA 2GD1O 3BZWA 3D6NB 4XDYA 4D8VA 3CZPA 2OVFA 1L8OA 3CUEF 3H6GA 4TXHA 3SMVA 3THYB 3F46A 1TUGA 3WSTA 3CYFA 4HB4A 1UMBB 4F92B 1YGYA 2PG3A 4MGEA 1T91A 2D59A 4MVJP 4WE3A 2CHGA 2QW1A 1IUPA 2NUPA 3DPIA 3LPDA 1N7GA 2F6RA 1Z4KA 5AVRA 2WSBA 1FSPA 4DANA 5TRTA 1U2DC 1CY7A 3F7MA 3FYCA 1EPUA 1PJBA 1VSTA 1J09A 5FBVB 2ZVQX 4L7QA 4BNYA 1ULUA 2PK3A 2PEYA 4FDAA 4GD3Q 5G1PA 5M7EA 3ESZA 1IATA 1Z2DA 4AULA 5B1IA 2H63A 2RK3A 3NHYA 1ECGA 3P8ZA 4X92A 3SSMA 1TVMA 4CQJA 1Z17A 3DMHA 1A8PA 2VWPA 3PGXA 4U4AA 3WE7A 3D81A 2L18A 2X5KO 4WZBE 4P33A 1UAAA 3PYLA 2A9QA 3EZLA 4JKYA 4RM2A 4Z7QB 3QVJA 5SZJA 4DEYA 4M4SA 4KQWA 1IZ8A 3P0JA 4EO7A 3HS3A 4AECA 4P4NA 2NVBA 2AXEA 2ZT6A 2JAUA 3D6UA 4JOBA 5DYTA 3LLCA 4DT1B 3P9PA 3MWFA 4IJ6A 4FDMA 4KQMA 3TEJA 4XM1A 2H2FA 2AHRA 2V6IA 2XDWA 4E33A 4PY2A 3NYQA 1GL3A 5NULA 2VYCA 3WRWA 3ENQA 4R81A 2EFHB 5KUTA 3IVXA 3LDHA 4MA5A 2VTEA 4M0DA 3SFTA 1X94A 3ETGA 5EJ9A 2CWWA 3VNAA 2JVJA 2Y1GA 3ZD9A 5JALA 1CIVA 3G68A 4UHFA 3PX2A 2NYRA 1VHLA 2OCBA 4JB0A 4C7KA 1G55A 1NY6A 1QCCA 4C03A 2IHTA 1O7JA 4ZKDA 4KWEA 1W8IA 3L9XA 4R54A 3AKYA 2V1XA 2QI9F 3QUQA 5JO0A 4UE2A 1X7GA 2Q4EA 2HXSA 2QVXX 1Z12A 3K32A 3ZLTA 2W6CX 1ZD2P 2ORWA 3F8TA 2P68A 3HI6A 5AHWA 5HBRA 2W5UA 2WHEA 5DRTA 1RAAA 4AKTA 2FPPA 1EINA 4U5XA 3Q15C 3SQLA 4LQ4A 1BH2A 4AYXA 1E6MA 4JEMA 3IHTA 3VYUB 4C7JA 5HFJA 4JIGA 3Q9NA 5TSDA 4TKZA 4UAUA 1X8JA 4Y2RA 5IAKA 3AB8A 4V02A 1LVGA 2LGJA 3AJEA 1FNDA 2VP0A 3P5BA 5DDIP 4PAGA 1N3BA 2QPTA 5CGQB 2QTHA 1WSAA 1FJHA 4KVGA 3K70D 1CR2A 2ZBGA 1XCGB 5F76A 2QL6A 3COWA 3L8GA 4H18A 5JMWA 2C07A 5LCXA 3ORHA 4G4JA 1NDQA 1A0OA 1Z39A 2I76A 4CL2A 2I2CA 4RGQA 1XTRA 3IBYA 4M0KA 2QRGA 1JMKC 1II8A 3S29A 2FN7A 4YDQA 4IDPA 4II3A 2H57A 2UUAB 1SXJD 2QROA 3LY5A 3VUFA 3H1TA 4FDLA 5DB4A 2A0KA 1XMQB 1DIBA 2HCRA 3C5HA 1YE3A 4FE4A 5BRNA 1NXWA 1OKKA 3OU6A 4R2XA 5JQGF 1AN9A 1OU0A 1TK9A 3U0VA 2CVZA 1RZRA 3NM6B 1NAIA 1GPYA 2FKNA 3GUYA 4AL4A 3U9LA 1A9SA 4WJLA 5EZYA 1L5RA 1L4KA 2WU1A 1G63A 2XUGA 4LXHA 3BYZA 1EIWA 4QXPA 5ILQA 1DARA 2HV8A 3RGWS 2FOIA 1KI8A 4KRXA 3BTUA 4IGAA 4RQAA 1WUJS 4M55A 2GVNA 1GGHA 2HK7A 3OT1B 5F1KA 1F8UA 2ZXFA 3G2HA 1M34E 5AVYA 1MH9A 3IP8A 1J97A 2ZYAA 2JAPA 1UWKA 1B8NA 2DTDA 4HQOA 1F2TA 2BD0A 4AJLA 2O2JA 4XLLA 5EIFA 5JZSA 3EG5A 1OYOA 2CLOB 5BURA 3NBXX 3FVVA 5BRAA 2DHDA 4NAHA 1FP7A 1N8KA 5CNJA 3OC6A 1UBRS 2H5IA 2O20A 4M7RA 4QDKA 5D1NA 3GHYA 4DE5A 3ZDAA 1L4HA 5CT4A 2CVPA 1IY1A 4MRNA 4JODA 4X6YA 2E5WA 4WWHA 4B3IA 5L6LB 2QJTA 3QKSB 4BNIA 1RJFA 2AVDA 4GC9A 4LF5B 1AK1A 1N75A 2I3AA 2PDAA 1AS0A 4PEVA 1X7ZA 3V9AA 5HQTA 2ZGVA 1L5MA 2ECFA 4C3VA 2II6A 4YMTA 4GDMA 3LHKA 2ZM6B 3TDNA 1ZIYA 5FI5A 2ZZNA 2RC6A 4I9HA 3ZY3A 1N7IA 3QVOA 1FU7A 1FXSA 2C2OA 3JVUA 3G0HA 1WO8A 4JLOA 2YWEA 1A5ZA 4KMSA 3WWDA 4AJ1A 4BKUA 4C2AA 1KETA 1BN7A 2XUJA 2ZPTX 3E2MA 5THKA 3U9SA 4BQPA 1CUVA 5FWYB 3Q11A 4GMGA 4A0SA 1IHPA 4W8HA 2ZSKA 3P0IA 5H9VA 2G9VA 2GEUA 1PV1A 4B7AA 1JMYA 5ES3A 2O2EA 1DQRA 2JFYA 3PS9A 4DV4B 3JRWA 4P7KA 1NLZA 4ZANA 1QBGA 3AC0A 1LTQA 1U5BA 5H7XA 1G291 4NH0A 2ZJ0A 2JHFA 3BILA 2IYAA 3N2LA 1AV7A 2C5HA 5TGTA 3IUYA 2ZBQA 5JCXA 1K6MA 3GH3A 2YL2A 4QELA 2R7AA 2CY0A 1E1RA 4HRAA 2Y67A 2O4CA 2O2DA 4HUQB 4PFKA 4UHDA 2JB9A 1TRHA 3GN1A 1XCMA 1P4SA 1SPBS 221PA 1K4MA 3I9JA 2W6NA 4AUMA 3SHQA 2VS1A 4ARZB 1KRHA 4ZYTA 3K9CA 4DT1A 3WGJA 2AEFA 5E6SB 2FVYA 3OD1A 1GL6A 4ZHQA 2EEPA 2QR3A 2P7IA 4CVNA 3TZ6A 1UDBA 1EUDB 4YCJA 4N0MA 3ND6A 1L4EA 3FPJA 3INYA 3PKZA 2ZS7A 5B1DA 5B6JA 4LZJA 1Z08A 2C2YA 1U5AA 2GT1A 4G0OA 3FIUA 3QPUA 5EVJA 1MEOA 2XWPA 3FKSA 4TV8F 2IOFA 2BGWA 1LJUA 2VXBA 4HAOA 2D4HA 4S12A 1JG2A 2IY9A 2ZUUA 5D84A 4ZIRA 1ZKDA 2JFNA 5TQ2A 4BFCA 5KOHA 2VFAA 1X0XA 5B36A 1WB4A 5DGTA 4MVJA 1LS6A 4AY4A 4KKVA 4IOJA 2Z5FA 4COOA 1RQNA 1JIXA 1LA2A 2OFXA 4JBLA 1E2LA 1G6KA 1SC4A 1T9KA 2YZNA 4ZV7A 1A8SA 4WXHA 1KEWA 1M54A 4CNBA 1EX9A 1JJ7A 1XRJA 3PPIA 4GHWA 4AKIA 2GF2A 1AGRA 2C7GA 3A1SA 3TLAA 2XZLA 3KQMA 2XH8A 1ZA1A 4KDFA 2VRWA 2W2PA 3LUHA 1JG3A 1D2EA 1ZRSA 2XE8A 2BBSA 4QG7A 1NASA 1STOA 1BGXT 2B36A 2J0EA 3M82A 3NIDB 3Q40A 4G1EB 5DCYA 2PE5A 3CEHA 1D8AA 3SZUA 3AXTA 4AFNA 4OYHA 4FDVA 3FKJA 2WQ6A 1P45A 3IQGX 2C7VA 2OESA 4DZTA 2C2XA 3ICVA 2I65A 1NMXA 1L1QA 3V2GA 3ZEAA 1VJ1A 1G5IA 3EXIB 2FWRA 4OI2A 4XQ9A 1U0BB 1TF2A 1PTJA 4W1PA 1JP7A 3Q6NA 2I29A 2E87A 2YVLA 1CQJA 3BCRA 3H9CA 4W5OA 3CT4A 1KRWA 1D0IA 1LQTA 2OBYA 2KW5A 2HA2A 3JWEA 4YRKA 2P75A 4NPCA 4I46A 3GQBA 2XODA 4QJBA 5IM4F 1CY1A 1JG4A 2ORIA 5SY9A 1LDBA 2QORA 5JFGA 2Q9UA 1YS2X 1ZM9A 2QGFA 3RODA 4UCFA 5H0IA 4OHRA 3EE6A 3TLMA 3G9XA 3TIGA 1FNCA 2CEKA 1R9GA 3L7NA 4LBVA 1EVQA 2GPSA 1E9CA 5HRAA 4TYPA 3EGIA 5CTAA 4TTSA 4MLZA 4DRXA 5JXWA 1HL7A 3NCTA 2VIIA 4J4BA 1KY3A 1WJGA 4LKOA 4CU2A 5KOIA 1EUYA 4BEBA 1G5TA 4A15A 1AS3A 3QPWA 3N6VA 2ZZKA 3EXEA 5BQOA 2IH2A 2ZRKA 4LS3A 5E9QA 4PG8A 3LI2A 4NZNA 1GOTA 3R7SA 1V8FA 4PO8A 5B3AA 2OV8A 4KNWA 5EE1A 2QG9A 5IWAB 2FUNB 3ONFA 3JQ7B 4GF5A 4L15A 1LK7A 4XLZA 1QDUA 2VUHB 2XD4A 3RUPA 4ZRNA 3OKAA 4NFHA 4ZC1A 4DUPA 1QG2A 3INGA 5AUOB 5JIBA 3U44B 1JE1A 2DUWA 2RONA 3BBPA 5T4EA 3SBXA 1UPAA 3FR7A 3WMRA 1UXJA 1OLXB 2WWRA 3DHVA 3Q6MA 1PEAA 2FCAA 3A31A 1ZCBA 4OATA 4CZ2A 1J8DA 1E2QA 1I3NA 3GFFA 3A2LA 4BL5A 4Z53A 1Z75A 2FUEA 3BMQA 4ZDIA 5HK8A 3GG9A 4BXOB 4DWWA 3OLCX 3PEVA 3TAXA 4MUNA 1FFDA 2JH9A 3HJAA 3ZDFA 1HQDA 4L76A 4C1NA 4LDAA 4OXKA 4JK3A 2R25B 3PIIA 1CUAA 1XCJA 5FQNA 2Q7DA 4GI5A 3GMSA 5A4IS 4C4RA 1QRAA 2PL1A 2OFOA 3A37A 2IHYA 1FLDA 2Y1LA 3QWHA 2H08A 5E9JA 3PVSA 1JHRA 4G37A 5EQDA 5FBWB 3TEFA 1B6RA 1IXRC 3CRQA 4HD8A 1XAIA 3EXG1 3VVMA 3GU3A 1UXOA 4UNSA 5FOWA 4QM6A 1LSUA 1BNCA 3B6KA 4BO4A 3Q9LA 2B1QA 2FQQA 4CGZA 1W0JA 2DP4E 1NOIA 5AW9A 3VKUA 5C5CA 2Z2JA 2ZITA 1GIAA 3RWMB 4OU4A 4EG6A 3ANMA 2HLNA 4F2HA 1H3FA 4QUIA 3THWB 3UCEA 3TUJC 1WXWA 2WB2A 1H94A 1BGWA 4TRRA 3UK7A 2HF9A 2XADA 3FHOA 3K3PA 4YS6A 1W49A 2GZ3A 3EA4A 3ECCA 1M2OB 4KFCA 3WLIA 3ZX5A 1L5WA 1UWLA 3A4MA 2YWCA 2GOYA 5B64A 3GMTA 4KBGA 2WPDD 2BN4A 3HXLA 1M1YE 3T7EA 5CLFA 1F48A 2IXBA 3JRXA 5ERYA 1KC1A 4LJYA 4O4HB 5BN4B 5IT4A 3ESQA 1BE8A 4ZHQB 4OSPA 4YUAA 3IDAA 2ZB4A 3MNFA 2C1ZA 1HT1E 5F98A 5EWMA 4HFMA 1JDUA 4M9UA 3PG5A 1CJSA 5K0LA 5AW2A 3RIEA 4XUEA 4ESEA 1JQ3A 2X42A 1CNMA 1REQB 2JFXA 3DMYA 4O59O 3VBCA 1MX1A 4Q00A 4UMDA 3MB5A 4V0QA 2CNDA 5A3VA 2J3IA 3FWHA 2WUVA 5CLGA 1QNLA 3ZD7A 2WINI 2O8DA 1JPNA 2VKTA 4HZIA 1LH0A 1XLTA 1FP6A 4Q9JA 4KO8A 5EPUA 1D0SA 3WO1A 2Y0BA 3DO6A 3VYTB 4HZUB 1BCRA 1PSZA 1T34A 1IMJA 1C2TA 1HLDA 1VSBA 5I5GA 1F06A 3IELA 5A1JA 5E4JA 5G4KB 1FQWA 1QHXA 2WHXA 3HZZA 4LGYA 2OSBA 1RE1A 2P5TB 4MEJA 2HXGA 4NEHB 4PFJA 4DIMA 1FNBA 3CISA 3JRNA 3OX3A 4INZA 3DEZA 1U3DA 2JIBA 4PC1A 1E3JA 2ZI6A 2P9FA 3GZ4A 5LYJB 2IOHA 4KU4A 1P61B 2BMFA 2O2CA 1SNYA 3L49A 4OXRA 5F2OA 3SJ7A 2F1IA 3G5AA 1JWLA 3MWJA 1WHTB 1XRPA 4UBNA 1FRNA 1VE5A 2B6NA 7REQB 1Y1KE 2Q6IA 3R4VA 1C8VB 1DCMA 4UHJA 2DBRA 2ZAOA 1XXLA 2OCAA 3TX6A 4PN3A 1UDCA 1W93A 5AHOA 5AW5A 4AF7A 4PLGA 3HYSA 3AF6A 2GUWA 4ZZIA 3HCBA 1W5SA 4GZMA 4LXTA 1G2IA 4BMVA 2GLUA 4FYXA 2CL5A 1B2RA 5IARA 4CN9A 1X15A 5K0NA 2R1ZA 3ZGLA 5IKEA 2ODQA 1VE6A 3PUXA 4HK4A 2H5LA 5C3UA 3AEQA 4QBGB 4FKBA 4MRAA 3SQDA 4GU5A 2PUVA 3BK2A 1ZOLA 1OXMA 2XT9A 4PQYA 4CKBA 4MGZR 2X8WA 3PGKA 1AO3A 1F0YA 1OXTA 4G5FA 2VNAA 4BFYA 2GM5A 5D5HA 3AHIA 3N9IA 3GAFA 3ZLJA 3EZFA 3BCUA 2AGVA 4KGZA 3KUUA 3OQHA 4IV0A 3JQGA 1P6QA 3O95A 5KTKA 4KEAA 4QC2A 1ODTC 1P81A 2UV8A 4N39A 1YBFA 1BD3A 4CKXA 4L95C 2EWVA 2C2MA 2G6TA 2K5UA 5JVDB 5KTYA 1MJNA 3K1YA 4TWRA 4UEOA 5C34B 1K7CA 4LGCA 4XCQA 5T4HA 1KJZA 3QA9A 1GCIA 3B6MA 4BN0A 4R2MA 1PJ4A 3LSYA 1IZZA 2COKA 2YFQA 1VRVA 1QZ3A 3AJAA 4ZEWA 3L8ZA 1JHYA 5CRIA 2C3UA 2A1UB 1KBZA 1NVBA 3D7NA 4B6QA 4NU6A 4OB7A 5AI0A 1GXSA 4LCBA 4N7MA 1FRFS 3SHTA 1LBSA 3ZCPA 3EUEA 4TWJA 1A9XB 1R74A 1BGVA 3GUHA 5JD4A 4DEXA 3TOVA 4M6WA 4KGVA 3M1LA 1QPBA 4I6JA 3ROFA 3VR5D 1W85A 3G2JA 3NDRA 4W6QA 4K0RA 5BNZA 4IRUB 4B48A 1PGQA 5EOVA 3ZGNA 5E38A 5TXGA 5JAQA 4TQUS 1DC4A 4ZA2A 4AKEA 1LEHA 1Z7BA 2W6MA 4MRPA 2E1RA 1ZO8A 5DNEA 3UFXA 1Q0HA 3SSOA 4H0FA 4BMXA 4FMBB 1NV8A 1ENOA 5E3JA 1HDRA 3PQCA 2FPSA 2B69A 1M2EA 1NP7A 1M6VA 5JC8A 4DR7B 5AQEA 4ZEOA 1FTYA 4D6XA 3I3SR 5EJIA 4EG8A 2JGKA 2C9DA 3MCAA 1UEIA 3T9FA 4WADA 1E6LA 3OPYA 3VAYA 1DO2A 3I23A 1KFJB 4LMRA 3KVRA 1I7LA 2FRXA 2OBBA 3HC7A 1ESNA 2MYPA 3AINA 3P96A 2R1UA 3E9CA 2JIQA 4PYQA 1OI3A 1DELA 2YASA 3ME5A 3S2YA 1OWMA 3N59A 2WAAA 4EB8A 3QYAA 3DTVD 1G8PA 2NYAA 5EPOA 4XCXA 4EX6A 1ZMTA 4MUXA 3KQKA 4REOA 3SZ3A 2O1EA 3CVVA 1ZD9A 2Z5LA 3AUXA 4M9XA 5IP5A 2BKEA 3ICEA 2ENWA 2ZQ5A 4I81A 5K8UA 2W83A 5KQRA 3FVWA 5LYJA 4D9CA 1ZXBA 3L6CA 5C9ZA 3A36A 1GCGA 1LX6A 1HQYE 2HWUA 3LC0A 5EJMA 2NVOA 4D82A 2WDPA 4L4SA 1GITA 3EBPA 5D3MA 2QM7A 3VZCA 5KNDD 4M8NE 4JLBA 3FHJA 3E3OA 4KIGA 4S05A 4L5JA 1E77A 4M76B 4F3NA 4RAOA 5JVDF 1T9ZA 3O4RA 1XQXA 2G9UA 2B94A 3A3YA 1J0CA 3GRKA 3PXAA 1A4IA 3QWFA 1RQXA 3PEFA 3GXBA 4HZUA 3H42B 4JYMA 1SPXA 1U11A 2IZ7A 2OOSA 2QKYA 5E1DA 1NW5A 1XVVA 5LQDA 5EHNA 3E48A 2JI7A 1EXWA 1LLDA 1NZDA 4OQYA 1P91A 5FI1B 4UBJA 3LQYA 5UKDA 3WLMA 3PDHA 2P5UA 2APJA 4HR7A 3RANA 1MNAA 2GNPA 4BNXA 1ZINA 3AEUA 3CEJA 3I1IA 1HEYA 3C4VA 4CDNA 1M6EX 3OCYA 4TRNA 1X2EA 1U4OA 3E3MA 4GWGA 1V3TA 1T9CA 3RV4A 2DF8A 5CLJA 2AKYA 2PR2A 2YMMA 2H5JA 3VR4A 3I6YA 2OP0A 1HG0A 1ZICA 3CEMA 4EEKA 1XV5A 3AEKB 1K5PA 2ILVA 2N3ZA 3WYGA 1XLVA 2P8SA 1XN1A 1ODFA 1QE0A 1S2OA 4Y67A 2B21A 2O0MA 4CL3A 1DZIA 1KU6A 3HL0A 1R66A 1FLVA 1T8UA 3QYFA 4JT8A 2JHCA 4A0HA 1RYBA 1VXRA 4EY3A 2AD5A 1P0IA 3CR3C 2A0WA 3FNIA 4EENA 3EG9A 1T1JA 2VHYA 1SXJE 4OY3A 2KM1A 1CUXA 5I9MA 3WK6A 1EK0A 1XC7A 2V4MA 3MXTA 3PFKA 4HNSA 2X8BA 2JIZA 2OBLA 3VHRA 1NZJA 4ZJYA 5E95A 5F52A 4DKJA 4AJNA 4OLAA 1ZGBA 2X8LA 1ZUHA 1RXUA 3TVTA 5BWNA 2J3HA 5BNWA 2J3MA 1M5TA 1KK0A 2GK3A 1OZAA 2V7BA 1E1MA 3NYIA 4MV6A 4PZUA 3UB4A 4AMZA 4C78A 6PFKA 1FDVA 3LW8A 2Q3DA 2YS7A 3LOUA 4RK4A 4NOKA 4KZKA 3N3BC 4UCQA 1JW9B 2JFVA 5JFOA 3M9XA 3UGTA 2H4YA 4F11A 1TYCA 3WLAA 5T57A 5CFMA 821PA 5F3WB 4IHAA 4HDSB 2XEXA 5CXQA 2GDZA 3AB7A 2PCLA 1ZQ1A 3IV9A 3P2JA 1UBLS 2DH5A 4Z7NB 5IX8A 3SDBA 1T26A 4DV0B 2IGBA 3HKCB 2AN9A 3IQFA 3M1IA 4PTYA 3ER9A 5CYFA 1RP1A 2BGNA 5FI0B 4PRKA 2HH9A 5EWLA 1ADJA 1ZVMA 1J49A 2PYZA 3IA7A 4E70A 3KEFA 4TMVA 3TIXB 4BMSA 1AXEA 4HQ6A 2YXLA 4PRYA 4WL0A 3ADDA 1RCFA 4M21A 3IKTA 1ORHA 1ZD1A 2C9ZA 4L1KA 2JBWA 4I4LA 4MEBA 1Y42X 4DDVA 2ESRA 4GQBA 3VR0A 1USUA 4A1FA 4F9EA 2IHUA 3G2KA 3CVJA 4LGVA 1N6HA 1UC5B 3IMKA 3I61A 2KBEA 2XWBF 4CQMD 3AG6A 3DDCA 2B6HA 2ORED 4A8PA 2VK8A 3CKMA 2WT8A 5F4BA 1KI9A 1I30A 5FBRB 4KI0A 1MO3A 1RLOA 3O03A 4Q3KA 2V7UA 3Q3GE 5DWDA 1TEXA 1W47A 2R9VA 3B48A 1T8PA 3PR2B 1RHJA 4K1XA 2I4IA 3BMCA 5KSWB 2V1UA 3B20A 2Z09A 3NJ4A 1CUUA 4H6VA 1EGAA 4OSOA 3UH0A 1A8HA 4BWGA 1LI5A 2PHZA 5KQPA 2HN9A 3PZRA 3SK0A 2IYSA 3INRA 1FQOA 4QVKA 1T35A 1E8MA 1WQ1R 3K1TA 4ALMA 4QUAA 3DCYA 1MN6A 1USKA 3W77A 2E4ZA 1GU1A 3S7ZA 4BNDA 1G20B 4Q3AA 5E7IA 4X1IA 3WJ7A 1PCXA 3AW8A 2R68A 4V0MA 1JJBA 3STUA 4G25A 1HOTA 3QVTA 1DKRA 3ENZA 1KS9A 2Y1WA 3DZJA 2GJ9A 4QLAA 4Y0VA 4Z7OB 1XHLA 3M6UA 3FE2A 4GX5A 4B17A 4DA8A 2RBKA 3PJEA 2ZB8A 3DA8A 1A5BB 1II0A 1NBOA 2OAQ1 4X93A 5FB3A 3UMGA 4Z9YA 4N76A 4NEGA 2C20A 1YQUA 2DB3A 3FGZA 5EFZA 3WGIA 2W70A 2HLPA 3TTTA 1ECBA 3BD9A 1JHMA 1B3RA 5AM0A 1YRHA 3H1FA 3HP1A 3IPRA 5FI3A 4DF3A 5KJFA 1ZCJA 2GFIA 5EIBD 4AJEA 2E4YA 3BOSA 4JR0A 3CF2A 4KXUA 1J06A 1ZN8A 1IZYA 1V95A 2A9RA 4JLUA 5IW8A 1AMNA 1DAOA 4MTLA 1TVEA 2RHMA 1DFIA 2PXCA 4H7EA 3TQRA 1YOVA 3BMXA 4Q6BA 2AJCA 3REOA 4LDJA 3FGOA 5KSPA 4E2WA 2Q1UA 5FPKA 5ULLA 3QHQA 4MPJA 4WKGA 2H2AA 2X6RA 2J5BA 5EP1A 1TTTA 1J23A 2VDKB 3DD1A 1YR7A 1H0HA 3ECSA 5AI9A 2GRAA 1UJ5A 3PV0A 1QFJA 4NWIA 1H2FA 4TZ0A 1YC5A 1COWD 1O97D 3PGJA 4IIGA 4DAEA 1OILA 1XZEA 1Y89A 3STWA 1MABB 4F91B 4LDQA 2Z98A 1P1FA 3NVAA 5BV2P 1SO8A 4KXFB 1FOEB 5BYAA 2CFCA 2ICAA 3QLEA 3T0FA 3VVLA 3FMIA 1ZH0A 5DHTA 3ZJ4A 3O73A 3TZBA 5D01A 4CM6A 1U1EA 4JB2A 3KOYA 4JLKA 1Z4JA 2G09A 5JQGB 1RHRA 4WOBA 5FYDA 3WR5A 5JSUA 1CFZA 3I2GA 2B83A 3E7XA 2BFCA 5GVRA 2VO1A 3JARB 2Y27A 5JZVA 2XKAA 2JLRA 3NHWA 3IPCA 4E0BA 2F67A 1KI3A 5DSXA 3DBIA 1PL8A 4KPYA 4ZCPA 1GRNA 3O8QB 3KPJA 2P6OA 4UVHA 3ZOZA 4DREA 3AR4A 3KB6A 1UH5A 3A14A 3W5JA 3GT0A 4ZO4A 3RC3A 4ENTA 2ZP1A 4OQXA 2DKOA 1XYYA 5JS1A 3AW9A 4LIPD 1V41E 1QVRA 1NUAA 3IL2A 3E9EA 2DJIA 2O59A 4EHFA 2EDAA 1MCZA 3DONA 4QODA 5ICCA 2FN4A 1I4TD 5JDIA 1UT8A 2GN8A 3CBQA 2YNMA 1YC2A 1KYWA 2WHRA 3A3NA 2VHUA 4MGIR 5H1YA 1TM3E 2CUKA 4F12A 1W76A 1HDXA 1A8QA 1OQAA 3ES9A 5AUPB 5H59A 3PQEA 1OT3A 2ZE7A 1MORA 3ZVKA 4AWXA 2WKRA 5DH9A 4KHPB 1TVKA 1E4VA 1TQ8A 2P2YA 1SUPA 3GFPA 4MR8A 4YEDA 3V1YA 4OHKA 1LPAB 3KJIA 2F4VB 2BHLA 1M0TA 2I6GA 1OLOA 4EMSA 3NHAA 3AOEC 4DR6B 4O0MA 4AP9A 2NQTA 2C61A 3O74A 3ZWNA 1K6JA 4M8KA 2QPLA 1SMKA 1IJKA 2XLCA 2NADA 1KVUA 3T15A 3F1LA 4IXTA 3VPXA 3QPCA 3NORA 3OQVA 2ODTX 4E5KA 3VI4B 3PHBE 1J1ZA 5IH7A 1IYZA 1YT5A 2V98A 4WMLA 3FHCB 4WZAE 2YWHA 1W75A 1CBUA 2QE7D 4OBBA 1JAYA 4RFLA 1S9HA 1K08A 5B5SA 4HAZA 1JPUA 1B74A 1ZXLA 4KXWA 4R05A 4ZO7A 1WU7A 5LD2B 3BQ9A 3VGJA 5F21A 1U02A 1ZAKA 2WJVA 4R8KA 4Y6GB 3J7AC 2LDBA 5BNTA 2AJLI 3K4QA 4IOLA 1MVOA 2GLTA 2VOEA 1A77A 4XDGA 1XMJA 2ZUFA 4PYMA 3B89A 3JQBC 1I10A 3X1DA 2AK2A 4HYEA 1EFPB 1DG9A 1KK3A 4LW8A 4ROSA 2MIIA 3GRVA 4ZT5A 3UWMA 1GRRA 3AM1A 1NN0A 3T8YA 2LCQA 3HR4A 4D02A 5EMMA 4NZ9A 3HBJA 3TAHA 2DRIA 4D6PA 3PUWA 1QWOA 3OOHA 4DC0A 1KJYA 1N7JA 1D04A 3UTCA 2R4QA 3TQCA 1P9WA 2LWIA 4HRVA 4KH0A 1Q2UA 3ZHZA 5AIBA 1A1SA 2YQZA 2L19A 2A8YA 1YB2A 1KYZA 4LV5B 3DYBA 3L3BA 5KIAA 1JA0A 2OFWA 3D6MA 1VG9B 4TWAA 3ZE2B 4ARZA 2HSDA 3JQBA 3NNSA 4EW6A 1K7FB 4HADA 1CCWA 4ZD6A 3ZNPA 4EKIA 2CVOA 2R6ZA 4IOKA 1E4YA 1BS9A 2ZI7A 3KUXA 5JY1A 1KMMA 2DZDA 3BWEA 4J49A 2XZOA 3GDOA 3OLWA 1YCHA 1ZUNB 1HKHA 2XEDA 1ZMRA 4H15A 5FTWA 1ZWLA 2C31A 2PV0A 1DKQA 1KK1A 4F2GA 2Z6UA 3EWIA 2HU7A 1RE0A 2QZ9A 3H87A 2AMLA 4RTJA 4AS1A 5A9SA 1MXFA 1L5OA 5FBKA 1WY5A 4Z99A 2HBRA 2X9LA 1FU8A 4Y2UA 2M1XA 1B8OA 3Q10A 3Q7EA 5H3LA 2RGRA 3ESDA 1ISSA 3EPJA 2CXRA 4R1PA 1Q1QA 5B6IA 1P6UA 2GBPA 1RM3A 1P72A 2OA0A 1YO6A 5FTLA 3JARA 2RIRA 1AKVA 3NV7A 3V7UA 2EP8A 4GSYA 3EDCA 3ZE0B 4Z2AA 4ISBA 3LYLA 3MTQA 3SF8A 1OBCA 4Q3BA 4BZQA 4GZLA 2O3QA 3RI3A 3VJMA 3X1WA 5JD6A 1N2CA 2DUMA 1JIVA 1KE2A 4ALLA 1P2VA 1SXJB 4CG3A 4M7OA 5JSZB 4P86A 2XZDA 5AKYA 3CRZA 1G7SA 2NPFA 1V9SA 1IJBA 3S8MA 5DN6A 1HYBA 1XELA 4KN8A 2ZS9A 3BK7A 4ZQIA 3HEAA 1X87A 4Z1MD 1TO1E 3TQQA 3KU4A 1TNDA 1XHFA 2PKRA 4GOJA 1V8DA 3IX7A 3BWCA 1A71A 3MTAA 3X44A 4Z8YA 3IBFA 1JKJA 1G8HA 4F6LA 4CM8B 4BTEA 2GXQA 2Q5EA 3HKBB 4B8YA 4ZTZB 3LRTA 4FKMA 4N6NA 2OGSA 4LOJA 5EKXA 4LVUA 1NC3A 1QYRA 1EXVA 4YECA 2D74A 3FMFA 4ZJUA 1NR1A 1FY2A 1IAQA 1ML4A 2P91A 1E2MA 3EUFA 2WZDA 3QU2A 4G85A 4X1YB 1A9ZA 3VHXB 4BNWA 3A9CA 1UBUS 1G59A 1KHTA 3H2HA 3QE2A 1GPMA 3QU5A 4HTFA 4H3SA 3MMSA 3L40A 1DWPA 1VIMA 2FH5B 4FZ3A 3GMDA 3AF5A 1NI3A 2B1GA 3DKKA 3IT1A 4MYHA 3ZTYA 4GLLA 1FUEA 2Y68A 2J7PD 3LX8A 5E7JA 2O23A 4BLQA 2R4UA 2VRCD 1J0XO 1QX4A 1JIJA 2R1TB 4KPUA 4RF5A 5DNVA 5KNLA 1DLJA 1U1DA 2BM8A 3AVQA 1LQ2A 3C16C 1VI2A 2YOHA 1V0JA 4JBXA 4ZCIA 4RTSA 5L3QA 1Q19A 3FUWA 4FNGA 3FOFC 1V7CA 3RJTA 2FN3A 2NTEA 3L0ZA 4KBFA 5KYWB 4HUTA 2CLLB 3D02A 5TT1A 2I6TA 2PJUA 2QUBA 2D0DA 3BFPA 3BHIA 2BLLA 3CN7A 4XVQA 5CDUA 1RYZA 2HYIC 1XU7A 1XU9A 2GZAA 4OP1A 3GOHA 3H5WA 3N75A 4BYGA 2QM0A 3NKFA 3FWNA 2XDQA 4E1AA 3HV2A 1XALA 3V97A 2RI0A 2NV2B 4RL6A 3CWQA 2ZIFA 2XVXA 2IL1A 2X5XA 3PGVA 5ITVA 1Q7CA 1MO5A 2PQ6A 1CB7A 1QGUA 1VGRA 1XL1A 4ZV9A 3KYBA 5EQFA 3LDFA 3KQHA 3HY6A 2P9QA 2R85A 1M33A 4FINA 5LQKA 4H1VA 2VJAA 2BTQB 3B78A 1JH8A 3EXG2 2BFBB 3QKRA 4V2UA 4XUGB 4RF2A 3KVOA 3VQTA 3JY6A 3WIDA 3E7FA 3K7EA 3PNLA 2NXNA 2MYTA 3E7WA 3IT3A 4LY3A 1JVBA 2XQGA 3M2TA 2UZ1A 4JD5A 4L08A 1T2CA 2RHOA 3E5MA 1NXQA 4B6FA 4F3YA 2IHVA 3PQDA 5LP6F 2Z2KA 1KFCB 3I5AA 1R5JA 5BP7A 3IDOA 3AV0B 3G88A 4KFRA 4JVMA 1RWNA 2QRLA 4UJ3A 1HUQA 4NQZA 3E18A 2OB2A 2DFVA 2W6PA 2OAP1 2JIRA 2QZZA 2ID7A 3RBAA 4LYDA 3ZZ0A 2XUOA 5EXPA 1RXIA 1Z07A 4UD2A 2WIKA 4C14A 1LDNA 1PEYA 3OY2A 4NOJA 4JL8A 3L0PA 1B23P 4KNYA 3PT9A 4OUDA 1Y3FE 1QHHB 4HWSA 1WABA 3Q7RA 1EVZA 3HR7A 2D7DA 2P35A 4G65A 3WL3A 4LV6A 3HCPA 5AHRA 2NO0A 2VH2A 2CFRA 2QOEA 3QLUC 3D2CA 1PV2A 1D9ZA 4I19A 1JVSA 1Z0SA 3A6DA 4JVLA 3WTCA 3JVIA 3ERCA 3BKWA 4MW0A 2G71A 4A2WA 4TVOA 1C7ZA 4LJAA 1QO7A 3VPBA 3PQ3A 2RD2A 3CXRA 1YJ5A 1B0PA 4GEGA 2BFNA 1FNMA 1AB6A 1KO5A 2Q6TA 4LXYA 3UVEA 1TAQA 5BR7A 1GTVA 1C1XB 5CFPA 5L4LA 3R24A 3CZ5A 4FWIB 4Q1EA 3KTDA 1ZONA 4NE7A 5DTMA 4EP1A 4F4FA 3DE5X 2VXOA 3RRYA 1CUSA 1NP3A 2ZJAA 4CKZA 2KLHA 2CL7X 1W87A 1AUVA 3OTIA 4MGYR 4MMZB 3F7NA 5DLDA 3NONA 1TJYA 5KYUA 3W79A 2UYCA 3JWGA 4LY0A 3M7IA 5KTPA 2CNWD 1J9GA 2PVSA 4IQ8A 4QTZA 5DBHX 4O2BB 4D3ZA 2CVFA 2MDTA 1E64A 1WS6A 3KC2A 3O94A 2BMWA 3DOEA 4R0MA 3ASUA 2C77A 3HBNA 4HWPA 1BHQ1 1ZBDA 3FNFA 4IV5A 1XD9A 1KO4A 1P7PA 3I1JA 4EHIA 5BUQA 4E4TA 3UWPA 1D6SA 2WMNB 5DMXA 2Y0PA 4HEHA 3GUVA 5BQPA 3GVCA 1SQSA 3ZY4A 5D3KA 4X7MA 4BC1A 3OO1A 5GPBA 2VDWA 4I7EA 4GI7A 3EIWA 3U3JA 1K6EA 1R8QA 1XSEA 2OUIA 3L2OB 3WQSB 1F38A 1E79D