4NAPA

Crystal structure of a trap periplasmic solute binding protein from desulfovibrio alaskensis g20 (dde_0634), target efi-510102, with bound d-tryptophan
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
308
structure length
308
Chain Sequence
PVTLNYANFPPASTFPCIQMEQWAHEVRTRTRGKVDVLTYPGGTLLGARNMLRGVMSGQADIGCISLAYHPGVFPVMSVFELPLGFTSAEAASSVLWELYSGLRPAELERVKVLTMFTSAPSHFMTVTPVRSLRDLQGMEIRGAGTLSAILEKLGATPVSMPMPEVPEAVQKGIIKGLFTSLDVMKDMNFAEMTGHVTRADQAVYPFAVIMNREAWERLSPDVQQVLDGLAAEHAAWTGRYLDAHVQDSMRWAEEKHGVQVHTLPEEDIAAMRRSVQPLFDAWAQRAADKGADPDAVMRTVDALKAQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Extracellular solute-binding protein, family 7
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Desulfovibrio alaskensis
molecule tags Transport protein
total genus 96
structure length 308
sequence length 308
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4napA00
4DI3D 4NX1A 4MCOA 2WYPA 4O8MA 4N6DA 4N8GA 2VPOA 4MAGA 4PE3A 2ZZXA 4PC9A 4P1LA 5IM2A 4YZZA 4DI4B 4N15A 5CM6A 4N6KA 4PETA 4MEVA 4P56A 4O94A 4PAKA 4MMPA 4X8RA 4P9KA 2XWKA 2CEYA 5I5PA 4OVPA 4NGUA 4PBHA 4MX6A 4N4UA 2ZZVA 4NN3A 4MNIA 4XFEA 4OVTA 5I7IA 2HZKA 5IZZA 4N17A 5IGAA 4XF5A 4MNPA 4P8BA 4LN5A 2HZLA 2V4CA 4NAPA 4PF8A 4PDDA 4PDHA 4NQ8A 4PF6A 2WYKA 2XXKA 4MIJA 4OA4A 2PFZA 4UABA 4PFIA 4N8YA 4NHBA 3U65A 4PGPA 4XEQA 4NG7A 4OVQA 3B50A 4PAIA 2XWVA 4PAFA 2WX9A 4MHFA 2XA5A 4P3LA 3GYYA 4PGNA 5LTCA 4PCDA 4PFBA 4MNCA 4PBQA 4X04A 2VPNA 4YICA 2ZZWA 4P1EA 4N91A 2XWIA 4OVRA 2XWOA 2HPGA 4OANA 2PFYA 3FXBA 4P47A 4PFRA 4OVSA 4O7MA 4NF0A 2CEXA
chains in the Genus database with same CATH superfamily
3C34A 2Z8EA 3K1NA 2Q74A 3C31A 4Q8RA 3T0JA 2UYFA 3TQWA 5DVFA 4PE3A 3FXUA 3O66A 3EF7A 2RC9A 1H3DA 2I48A 1H44A 1QKAA 1SI0A 3CSBA 3CFLA 3KFMA 4BDOA 2ONRA 2H98A 3HHGA 1JQFA 3MUQA 5CC2A 2CEYA 4QSDA 1LFGA 3T22A 1IXIA 1NV4A 3S2VA 5F24A 2Q2CA 4JSOA 3CG1A 4G4PA 5ICTA 2QFLA 1Y1ZA 4MLQA 3MSTA 5K2XA 2D3IA 3BFUA 3BIGA 3MC2A 1MM6A 2Z22A 2XXRA 3H03A 3IFAA 4H1XA 4H5FA 4G68C 1FBEA 1B4ZA 4GWUA 3TEPA 3PUXE 4LATA 3S9NC 4KQPA 3A09A 3TTKA 4MHFA 1NH8A 3ZKLA 3IAZA 3LSWA 5HPQA 2FYIA 1FCKA 2V3TA 3IB1A 3FVGA 3G7WA 1WDNA 4YB5A 4JSDA 1TXFA 4RNSA 4F2OA 4TLLB 5H8QA 3E9XA 4DDDA 4RPNA 2CEXA 4YB6A 2FVZA 4I62A 3S9LC 3MVXA 4F18A 2RINA 1EYJA 1S50A 2FIEA 4U1OA 2F7CA 3OO6A 4FE8A 1SDXA 2HEUA 4ZS9A 1B7ZA 4MF3A 1NKXA 3IB2A 1D9QA 3KC1A 2VP1A 1MM7A 4KI0E 3VVDA 3Q29A 3ROJA 4O94A 2DWIA 1MXXA 1LBBA 4YKIA 2XD3A 5I2KB 3E78A 2HXWA 1LAGE 1N7WA 4NN3A 3VE1B 2A5SA 2OWZA 1FPFA 5IZ1A 4ND9A 2Q2AA 1FQEA 1FBGA 1TWYA 3IORA 5H8FB 3N6TA 2I0CA 4N17A 3VVEA 4KYSA 1SW1A 5FBPA 4PFYA 3PUWE 1R1NA 1B3FA 2O68A 1JVYA 3P7IA 3QUFA 2PYYA 1I6QA 1LLSA 2XXUA 1Z7ME 4RXLA 3O6HA 4GF8A 4X9TA 3UGWA 1ANFA 3V8XB 1KWHA 3KN8A 4X1DA 5BUUA 1XS5A 1A7LA 1SD3A 3Q25A 3RN8A 3JZJA 2WKYA 1PDAA 1NNTA 2XX8A 4MNCA 2Y7WA 4H45A 4P0GA 1FBCA 3CFZA 1XT8A 4R6KA 1Y4CA 3QIMA 3C32A 4AB5A 1AWBA 1CB6A 2QRYA 3K6WA 3A29A 1Y3QA 4G68B 4DI3D 2F5XA 3KOTA 1URGA 3LUZA 4F29A 1IEJA 4FATA 4PE5B 4EQBA 2GQ1A 1MXUA 3E79A 4QBAA 1BTJA 1UTBA 2Z8FA 3RTWB 3ILUB 1US5A 4DE8A 1B0LA 3TKDA 3IOUA 4Q5TA 4PETA 2ABHA 3QXMA 4PAKA 5H8HB 5J16A 1LBWA 3U72A 4X1BA 2FIXA 1QKBA 2IEEA 5F1QA 2ZNSA 2DS9A 4KCDA 3K01A 2QVUA 3N6UA 5ET5A 2NVUB 3VVFA 1EYIA 1M5DA 1SPIA 3H7MA 2VHAA 4R74A 1JETA 4FEDA 4O7IA 2V4CA 3RNNA 4NAPA 1DK4A 4O3AA 1NV7A 1B46A 2O51A 4KD5A 1IMDA 2F8DA 4R6HA 5ISUA 4OEVA 5H8SA 3MZBA 4I1DA 1IIWA 4WXJA 1B51A 4OVQA 1PBPA 4G77A 1DSNA 4XIGQ 2F78A 3QUJA 3PMVA 2GH9A 3TPAA 4RJZA 2ZYMA 3DELB 5DEXA 1B9JA 5I3SA 1NUWA 1M5BA 3KZGA 2XHDA 4QFPA 1YZ0A 5F7VA 2XWIA 3G3GA 4LQ5A 1R9LA 1SQYA 1SW5A 1ZKBA 5FHOA 1PBQA 1N3WA 1QUKA 1RYOA 5EQ7A 5IAIA 4HE2A 1AL3A 3N94A 2Q8MA 3RPLB 1SYHA 4QSCA 2XXPA 2PX1A 3K02A 4GXSB 4F3BA 4MEVA 4X8RA 1LAHE 4H0WA 1A40A 2XWKA 1PB9A 3S9EA 2ZYOA 3TTNA 3GXAA 5ICQA 1FPDA 1II5A 4G8NA 4H6DA 3JV9A 3OEKA 4MNIA 3RQTA 2B4MA 3M8UA 1B7UA 1P1OA 3CHGA 4GFRA 3HHFA 4HE0A 4P8BA 2HZLA 2I49A 3TZAA 4GWXA 4PDHA 3MP1A 4PF6A 1K9YA 2O69A 4HXVA 3IX1A 3ZKKA 4OA4A 3KGCA 1FQDA 5DVJA 3SDFA 1NNKA 3PUZE 1A54A 1OMPA 3KJ7A 5I2NB 1GTKA 3B7DA 2ZNTA 1LFHA 2HAUA 4PAIA 2XWVA 4DXUA 2HCAA 1VFEA 1MXYA 1ZU0A 4JWXA 1IXGA 1XVYA 1MPDA 1NUYA 1MQGA 3KJTA 3H6TA 4GWOA 4AS4A 3OO7A 4PP0A 4R6YA 3KSXA 4PFRA 2A5TA 4GRKA 4NF0A 4OERA 3AXFA 3FASA 3IL1B 3VXCA 3HPIA 3KC0A 4DLDA 3T1BA 4LONB 1FJ6A 3KG2A 3MJNA 2ZYKA 1MQJA 1POTA 5AA2D 4MAGA 4KCCA 4N81A 4LVQA 3RYDA 1ZMGA 2Z23A 3IJOB 3BKIB 4PTKA 3PPNA 3H6WA 3M3KA 4XXUA 1PC3A 2H99A 4ZE8A 4EQ7A 4MMPA 3FGSA 4F2QA 4F3GA 3EHSA 2DXRA 3VV5A 3USDA 1F9BA 4NGUA 3MWBA 4ZDMA 3PMWA 4TOZA 5JTYA 4BDLA 4OMBA 3VLUA 5I84A 4XKNA 3U92A 1EU8A 3BFTA 3H6UA 3HSTA 2ALUA 2OJTA 3EN3A 1B05A 5A5XB 1MS7A 1O7TA 1OLAA 1XVXA 4ONYA 4GBVA 4RK2A 2KLFA 3IO6A 3IO4A 4GBWA 3T9XB 3CR9A 5JEIA 2M8CA 3E13X 4RPOA 4PCDA 5ELVA 1Y4TA 5AA4B 3O29A 1BP5A 5KDTB 5TP9B 2DE2A 1FRPA 1BK4A 4OANA 3K6UA 3QK6A 1A55A 3TCFA 2HAVA 2D21A 5L9SA 4NX1A 4DCXA 1JP4A 1YXIA 1I69A 2DE3A 4F1VA 2B3BA 3TTLA 3WAEA 3O9PA 1FBHA 4IO2A 2X26A 2HXRA 3TUSA 1JEVA 2CZLA 3PD9A 1GGGA 4IO4A 1NH7A 4NF4A 4N15A 4OWDA 1MY2A 4LUBA 3K4UA 4LP2B 1DMBA 1TFAA 5K2YA 2QL3A 2DDKA 4UA8A 2FHYA 4H65A 3FV1A 5AA2A 4OZ9A 3TCGA 3OELA 4OVTA 2NXOA 3QMFA 2MKZA 1MY1A 2OCUA 5EYFA 3L6HA 1RDZA 4PF8A 2VOZA 1DPPA 2F6GA 4JWOA 4LA9A 1NV5A 3SEUA 1M5CA 1FTOA 4MFIA 1IMBA 1INPA 2XXKA 3FVKA 4BDRA 4PFWA 4JXIA 1ZIUA 2I3VA 2PFZA 4H46A 1B52A 4ELPA 2I3WA 3DP4A 1BKAA 1IUDA 1LGBC 3VDFA 2QMWA 1DOTA 1KA1A 1NFTA 4H8IA 1FQBA 4C1TA 2GHBA 4NWDA 1RKMA 3O2AA 1MXVA 4DIGA 3PD8A 2CZKA 1K9ZA 4OETA 4OVRA 2XWOA 2HPGA 1URDA 1A8FA 3PPQA 4OEUA 3T96B 5M2VA 2ESNA 3K1PA 4QXDA 1AIVA 4NF5B 2NOOA 3SZPA 1CNQA 4O8MA 1NV0A 3DP6A 2QS4A 4I3YA 4U21A 3Q26A 2JJKA 4FJPA 4NTLA 3KBZA 5TPAB 1LBYA 3N5LA 4GL8A 1HSEA 2B65A 3LBSA 3FJMA 3KBRA 5EQAA 4YZZA 3A3CA 3FV2A 4EUOA 2DVCA 3LC8A 2DQVA 2CZHA 5IKBA 4P56A 1QVSA 4UACA 1RYXA 4QFOA 4ZEFA 1P1UA 5CMMA 5JK4A 1B3HA 3O6GA 4KHZE 4GWSA 3IOTA 3E3KA 3H4ZA 1XI6A 3IK6B 4DXCA 5IZZA 4JVIA 4R2FA 4JVDA 3IOVA 2QS3A 2QJEA 4G61A 4QFKA 3QYTA 2UVGA 1I6BA 2AYSA 5KCJB 3FJ7A 5DT6A 1H43A 2B4LA 1B3EA 1MY3A 3TMGA 4XEQA 4NEDA 4GQOA 1FSAA 3PGFA 3C9HA 3OEMA 4GWYA 4YAHX 1DTZA 1B3GA 4IO3A 4JB7A 4MBPA 4RY1A 2Y7PA 3S9MC 4DCYA 3MZ9A 5CMCA 2PT1A 1Y3NA 2OWTA 3MPKA 2KR0A 3U8QA 5I58B 1IITA 4HW8A 1G0HA 2XX9A 3IOWA 1MDP1 5B70A 4H67A 2DSFA 4ELRA 3T9UA 3MVYA 4IY5A 4YMAA 1R9QA 4H8JA 2WYPA 3NOHA 4R73A 2F3DA 5ET7A 2Q88A 4EXKA 3OO9A 4POXA 5HM4B 2L5VA 1R6ZA 4EXLA 4NMYA 3L6GA 2Y5KA 3G3IA 3TELA 1HSLA 2YLNA 3HFUA 1Z7NE 4G8HA 3K2DA 3FXRA 2OZZA 2LAOA 1USYH 5T3JA 3I5OA 2I4CA 5I57A 2P1SA 2XXHA 5CMBA 4QRZA 5DVIA 3MVWA 2Q9TA 3R7XA 4F3PA 5I7IA 5IZ3A 5CBSA 5IGAA 3PTYA 1UTHA 2ZNUA 1LB8A 3KOSA 1B5HA 2F36A 4Z0IA 4K3FA 1PEBA 1AOVA 1B5JA 3KN7A 1MRPA 1DTGA 4UABA 4AB6A 2P3VA 4IY6A 4XTCQ 3RT6B 1SW4A 1LBZA 4GD5A 4AS5A 1Y3PA 2D5WA 3C4MA 1GVCA 2V25A 4OFOA 4PFBA 2X7PA 4EF2A 3OSRA 4RA1A 3LR1A 4OTEA 3OXNA 4R2BA 1VSOA 3W9VA 1Q1KA 1L5TA 2R71A 3G3FA 3EQ1A 2OBGA 1FTMA 2P0SA 3LUYA 4QFNA 1MQDA 1SW2A 1J1NA 5H8QB 1EZPA 3OD7A 2VPOA 4PC9A 1DCUA 3D1RA 4I8CA 4GLIA 2DXYA 3QAXA 3T9HB 1ZJLA 3PPOA 3TTMA 3FIRA 1D9YA 1FTKA 4NF6A 5L9OA 2GRVA 4IGRA 2Y7KA 5I56A 2DE4A 4GIZA 4BDQA 1A99A 1OQGA 1JW4A 3EHUA 4M1VA 2HZKA 1POY1 2O1LA 4YMBA 1JNFA 4YKJA 2Y7RA 1PB8A 4THIA 1G0IA 1YYZA 1FPGA 1FQCA 1IXCA 2WBBA 5AE4A 1YTVA 4MIJA 3G3HA 3U65A 2AIXA 3W15C 4NG7A 2Y7IA 3SESA 2I6EA 1US4A 4PAFA 2DVZA 4G8MA 4OHNA 4PGNA 2E1SA 3SEVA 3OENA 4X04A 4YICA 2I0BA 4PQJA 2NUVA 4P1EA 4N91A 5LDZA 1LAFE 1O64A 2VGQA 4C0RA 5DW8A 3DM0A 2XX7A 4KXPA 1OIBA 4RYAA 3RUMA 3B6TA 3CFXA 1PB7A 4E0WA 3PV0E 3MPLA 1NV6A 3GZGA 3R26A 4N07A 5BWJA 3MYUA 2Q89A 4KFQA 3GBBA 2ZZXA 2OX3A 5DTBA 2GHAA 1B7HA 3BIHA 4YB7A 4JVCA 3ISPA 4GX3A 2FBPA 4QF9A 5DYHA 3Q28A 1EZOA 2O84X 2DYXA 4FECA 4G2ZA 5CI5A 2OK2A 3TYHA 2V84A 4WEPA 3A3UA 4QSEA 2F7BA 4R75A 1LAXA 2XXTA 3UORA 2ONSA 5ET8A 2HFBA 1FPBA 1AMFA 2RF1A 1P1WA 1MH3A 5CRYA 4U1ZA 5EYHA 3U94A 1URSA 3KEIA 2ANJA 5ITOA 4OENA 2YPNA 4U23A 4PFIA 4YU0A 1B58A 4PGPA 1UQWA 3HV1A 4FAJA 5TPAA 2H9BA 4FEBA 2RC8A 3H06B 2X7QA 2F97A 4ISUA 5AA1A 1B40A 4GWWA 2IA4A 5ET6A 2O1MA 2QSXA 4NE4A 2F34A 1FQAA 4I40A 3SEWA 3N26A 3B8BA 3M3FA 4NF8B 3FXQA 3C33A 3TDJA 1FPJA 3LSLA 1SI1A 4IO7A 5DEXB 1NV2A 1WODA 4I3EA 1RDXA 4ELOA 1QGXA 2I58A 5FHNA 3UN6A 3EHTA 3ODBA 1Y20A 3V89B 1OQHA 2R6GE 5ESYA 2R9JA 5IM2A 5I2KA 5KCJA 2DOJA 3TTRA 1S9TA 1TFDA 1NI9A 1P1NA 3MP8A 5H8FA 1MY0A 1SVXB 3B6WA 1FPKA 4ESXA 1M5EA 4JBZA 4R9GA 3G3JA 1FJ9A 4ESWA 3I3VA 3HCQA 2WEFA 3RLFE 1XHYA 3O97A 1B4HA 4JWYA 3FD3A 3IFCA 1IMEA 1RDYA 2G93A 2Y5LA 5I58A 3H6VA 1MXWA 1FTJA 3KN3A 4KYDA 5L8DA 1QUJA 1NUXA 5EHSA 4OYVA 2WYKA 4GOTA 3OMBA 2F3BA 5L9MA 3MAMA 4IB2A 3RPWA 4N8YA 4NHBA 3G3KA 1FQFA 1IMAA 2Y84A 1NUZA 3M3LA 2XA5A 1USYE 3PU5A 3V5AA 1ZBMA 4P11A 1B1HA 5ITPA 4G68A 3K1MA 4IO6A 4HCWA 3TCHA 2O7UA 4Q30B 1LB9A 3SEXA 4QFLA 1OVTA 2YJPA 2PFYA 3SETA 4M4GA 1MDQA 4MJOA 1IMCA 4P0IA 1LBXA 3F11A 4Z7EA 2ZYNA 4MCOA 3D4CA 3VFJA 1OVBA 4R9FA 3OOAA 3K6XA 2A5TB 2AL5A 5H8HA 3PMXA 4OESA 3LSXA 3KSJA 1MXZA 1WVJA 4ZEBA 4KPTA 3ILTB 4OVJA 2WBDA 1P99A 2H4IA 3TAJA 5I5PA 3O6IA 3FUZA 4F39A 5I59B 1KA0A 4N13A 2DWJA 4MX6A 2F6PA 2V3QA 1LFIA 4O3CA 2DP8A 5JTYB 4O3BA 4YKKA 4ZE9A 4F1YA 3K00A 2RKMA 2VD2A 2RC7A 3T66A 1YPNA 1QULA 1OLCA 1SYIA 2XXYA 2XXWA 1N76A 4N6PA 4XKPA 4ZZAA 4WKMA 3MBPA 2KQZA 3TQLA 3UK4A 4KR5A 1VDWA 4AQ4A 4HCYA 1GR2A 1YCJA 3ZSFA 1TT1A 4U4SA 3RPLA 4OXVA 3SEYA 1XOCA 3VXBA 3VLVA 2QS2A 1D4NA 1KZ8A 1B5IA 2R8TA 5HBCA 1Y9UA 2OLBA 4HS7A 2QS1A 2DWAA 3ZS6A 1HSJA 3T93B 1LSTA 2UVIA 3CSGA 3CG3A 4FIMA 4DI4B 2V3UA 1UIUA 5H8NB 4NWCA 4HTGA 3CVGA 2XD2A 4C1UA 4ZECA 1B6HA 4NF4B 4OQOA 3MQ9A 4ECFA 2FNCA 2XXVA 1MG1A 4N4UA 1NV3A 4LZ5A 4ZEIA 2QPQA 3LV0A 3DLNA 1B32A 4EF1A 4XKQA 3D4GA 1O63A 4I9DA 4MNPA 4LZ8A 2QVRA 2W7YA 4ELQA 3IR1A 1B2HA 4PDDA 1D9VA 5I2NA 5AA2B 4NQ8A 2P2AA 1FTLA 3HO7A 5EYGA 3ECRA 1Q35A 1EH3A 1FBPA 3UP9A 1D3KA 4EDPA 2HQ0A 2ONKE 2WX9A 5CMKA 1LCTA 2UVJA 4F31B 1FPEA 4P3LA 3GYYA 3Q27A 4GX4A 3PUYE 4PBQA 1FTAA 3O28A 4MH5A 3CI8A 1FBFA 4OVSA 4FORA 4PFTA 1NMUA 3RTFB 3IJXB 1T0KA 1JW5A 1N3XA 5EQ9A 2PVUA 3FVOA 1SBPA 2VT5A 2V93A 3B6QA 4Q0CA 1I6AA 4P1LA 4ZEDA 5CM6A 1Q9DA 1LBCA 2PBWA 4JDFA 3R6UA 1ZLQA 1FBDA 4P9KA 4BLAA 1P1QA 1LBVA 4IR8A 4POWA 3MW0A 4PBHA 3RT8A 3WAFA 4ZEKA 3V83A 3MP6A 2ZZVA 3TFLA 2RCBA 4U22A 1H45A 2OWSA 1NNPA 4TQUQ 5FTHA 1AH5A 2ZMBA 5A5XA 4OFJA 1IQ7A 3MVZA 3CIJA 2BJIA 3ONMA 2B3FA 3LSFB 1YAEA 4NF8A 2NWJA 4OFLA 2UXAA 3E4RA 1UIVA 4IO5A 2RCAA 3K6VA 5FTIA 1MPCA 3VLWA 1QW0A 4U2RA 1NV1A 3TODA 3PUVE 2REJA 5FHMA 1B0HA 3FVNA 3FATA 3QSLA 3SERA 2I4BA 5AA4A 4PFUA 5KDTA 1XC1A 5TP9A 3CRBA 4L17A 3BBRA 1H76A 1B3LA 1N0TA 3C36A 2ZZWA 4DXBA 4QHQA 3T9VA 2XXQA 1N7XA 2H5YA 5EQ8A 4O7MA 5B7DA 2AL4A 2P3NA 4X48A 3S4UA 4U4XA 2G29A 4WEDA 1S7YA 2DWHA 3OSQA 1FPLA 3I6VA 4EQ9A 2QMXA 1JW1A 2UVHA 2E0SA 1LCFA 3OO8A 1MQHA 2PCRA 2O7IA 4ZZEA 2CMOA 2UYEA 3UIFA 2QVVA 1VR5A 2PT2A 2THIA 1B1XA 3FZVA 4KYEA 1M5FA 4FBPA 4OVPA 2H25A 2F35A 1EYKA 4HE1A 1QUIA 2BJJX 5I57B 2O6AA 1FW0A 3H3GA 1ELJA 1UTBB 2PMSA 5IZ3B 1NNFA 1N84A 1UTHB 1N04A 2F7AA 1NL5A 1Y1MA 1ZTYA 5CBRA 1MH4A 4GVOA 4H5GA 2VD3A 1DBZA 3FJGA 2GFEA 1MPBA 1MY4A 5LTCA 4NF5A 2VPNA 2Z8DA 3EKIA 5I59A 3U93A 3FXBA 4F3SA 3RGYA 5A5LA 1JEUA 3GLBA 1EZ9A 4N6DA 4F1UA 4N8GA 5TU0A 2FA7A 4XKRA 3THIA 1DPEA 5J1DA 3JYRA 4N6KA 3EPEA 3UA8A 4R72A 1QJMA 1LEVA 4LQ2A 3W9WA 1VFDA 1IMFA 1JVXA 4XFEA 3HN0A 1IZ1A 4NF6B 4IGTA 5KZTA 5I56B 4DZ1A 4XF5A 1ATGA 3PPRA 4LN5A 3RY3A 4F22A 5EHMA 3SKPA 4GXAA 4F19A 3GBAA 1A8EA 4BDMA 1VE4A 3MZ1A 5LOMA 2ZXTA 4YKPA 4LZ7A 2REGA 4BDNA 1CE2A 2XXXA 2XXIA 4RK9A 2Q8JA 1BIYA 3FBPA 3B50A 4TLMB 1FPIA 3DP8A 4GX6A 4E0XA 1MQIA 4GWZA 1GV8A 3IB0A 5H8NA 1IXHA 2HHMA 3C35A 2CZIA 5AA3A 3U1OA 4MLVA 3K0VA 3PPPA 4P47A 4GL0A 1BLFA
chains in the Genus database with same CATH topology
3KC0A 1KZ8A 2R8TA 3T1BA 2Q74A 1FJ6A 3T0JA 2VPOA 4MAGA 4N81A 4PE3A 3RYDA 4PC9A 1DCUA 4DI4B 4PTKA 3D1RA 4MMPA 2CEYA 2DE4A 4NGUA 1NV4A 5F24A 4N4UA 1NV3A 2QPQA 3LV0A 4M1VA 2HZKA 2QFLA 4MNPA 3MSTA 2QVRA 4PDDA 3BIGA 1G0IA 4NQ8A 1YYZA 1FPGA 5EYGA 2WBBA 3IFAA 4MIJA 1FBEA 1FBPA 4GWUA 3U65A 4GBVA 4NG7A 4PAFA 2WX9A 4MHFA 4GBWA 1FPEA 2DVZA 4P3LA 3GYYA 4PGNA 4PCDA 4GX4A 4PBQA 4X04A 1FTAA 4YICA 4P1EA 4N91A 2DE2A 1FRPA 5LDZA 1BK4A 4OANA 1FBFA 4OVSA 5DW8A 4KXPA 2CEXA 2FVZA 4NX1A 4F18A 1EYJA 1JP4A 1YXIA 2DE3A 4F1VA 1NV6A 5EQ9A 3MYUA 1FBHA 2FIEA 2ZZXA 2OX3A 2HXRA 2VT5A 3BIHA 4P1LA 4N15A 4JVCA 3KC1A 1D9QA 3ISPA 4GX3A 2FBPA 5CM6A 1Q9DA 3ROJA 4O94A 1FBDA 4P9KA 2DDKA 1LBVA 4IR8A 3E78A 2FHYA 4PBHA 2ZZVA 4NN3A 2OWZA 1FPFA 5IZ1A 5ET8A 4OVTA 1FBGA 4N17A 3QMFA 1FPBA 2MKZA 2BJIA 5FBPA 1RDZA 4PF8A 5EYHA 1NV5A 1IMBA 1INPA 2XXKA 4X9TA 2PFZA 4PFIA 1NV1A 4H46A 4PGPA 1KA1A 4GWWA 5ET6A 4MNCA 4H45A 2CZKA 1FBCA 1K9ZA 2ZZWA 4I40A 4OVRA 2XWOA 2HPGA 3B8BA 5EQ8A 1AWBA 4QXDA 4O7MA 1FPJA 2P3NA 1NV2A 3A29A 4DI3D 3SZPA 1CNQA 4I3EA 1RDXA 2F5XA 4O8MA 1NV0A 3LUZA 4I3YA 1FPLA 1QGXA 2JJKA 2GQ1A 3KBZA 3E79A 1LBYA 4QBAA 5ESYA 5IM2A 5EQAA 4YZZA 2PCRA 1NI9A 2QVVA 4PETA 2CZHA 4P56A 4PAKA 5J16A 1LBWA 4FBPA 2FIXA 4OVPA 1FPKA 5JK4A 1EYKA 1FJ9A 2QVUA 4GWSA 4HE1A 5ET5A 2WEFA 1XI6A 5IZZA 1EYIA 4JVIA 1SPIA 4JVDA 3IFCA 1RDYA 1IMEA 2Y5LA 4O7IA 2V4CA 4NAPA 1DK4A 4G61A 1NV7A 1NUXA 5IZ3B 2WYKA 1IMDA 2F3BA 2B4LA 4N8YA 4NHBA 1IMAA 4XEQA 4OVQA 1NUZA 1FSAA 4GWYA 1DBZA 2XA5A 5LTCA 5I3SA 1NUWA 2VPNA 1YZ0A 4HCWA 2KR0A 2XWIA 3EKIA 1G0HA 2PFYA 3FXBA 5A5LA 4MJOA 1IMCA 1LBXA 5EQ7A 4MCOA 2WYPA 3NOHA 2F3DA 4N6DA 4F1UA 4HE2A 3RPLB 2Q8MA 5ET7A 4N8GA 2L5VA 2Y5KA 3HFUA 5J1DA 4MEVA 4N6KA 2WBDA 5T3JA 4X8RA 1LEVA 3W9WA 2XWKA 5I5PA 1KA0A 1FPDA 4MX6A 1IMFA 4MNIA 2B4MA 2Q9TA 4XFEA 5I7IA 2V3QA 5IZ3A 3CHGA 5IGAA 4HE0A 4XF5A 3PTYA 4P8BA 4LN5A 2HZLA 4GWXA 4PDHA 4PF6A 1K9YA 4F19A 4HXVA 4OA4A 4UABA 2P3VA 3FBPA 3B50A 1FPIA 1LBZA 4GX6A 4PAIA 2XWVA 2KQZA 1VDWA 4GWZA 4AS5A 4HCYA 1NUYA 4PFBA 2HHMA 2CZIA 4AS4A 3RPLA 3W9VA 4P47A 4PFRA 4NF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DI3 D;  4NX1 A;  4MCO A;  2WYP A;  4O8M A;  4N6D A;  4N8G A;  2VPO A;  4MAG A;  4PE3 A;  2ZZX A;  4PC9 A;  4P1L A;  5IM2 A;  4YZZ A;  4DI4 B;  4N15 A;  5CM6 A;  4N6K A;  4PET A;  4MEV A;  4P56 A;  4O94 A;  4PAK A;  4MMP A;  4X8R A;  4P9K A;  2XWK A;  2CEY A;  5I5P A;  4OVP A;  4NGU A;  4PBH A;  4MX6 A;  4N4U A;  2ZZV A;  4NN3 A;  4MNI A;  4XFE A;  4OVT A;  5I7I A;  2HZK A;  5IZZ A;  4N17 A;  5IGA A;  4XF5 A;  4MNP A;  4P8B A;  4LN5 A;  2HZL A;  2V4C A;  4NAP A;  4PF8 A;  4PDD A;  4PDH A;  4NQ8 A;  4PF6 A;  2WYK A;  2XXK A;  4MIJ A;  4OA4 A;  2PFZ A;  4UAB A;  4PFI A;  4N8Y A;  4NHB A;  3U65 A;  4PGP A;  4XEQ A;  4NG7 A;  4OVQ A;  3B50 A;  4PAI A;  2XWV A;  4PAF A;  2WX9 A;  4MHF A;  2XA5 A;  4P3L A;  3GYY A;  4PGN A;  5LTC A;  4PCD A;  4PFB A;  4MNC A;  4PBQ A;  4X04 A;  2VPN A;  4YIC A;  2ZZW A;  4P1E A;  4N91 A;  2XWI A;  4OVR A;  2XWO A;  2HPG A;  4OAN A;  2PFY A;  3FXB A;  4P47 A;  4PFR A;  4OVS A;  4O7M A;  4NF0 A;  2CEX A; 
#chains in the Genus database with same CATH topology
 3C34 A;  2Z8E A;  3K1N A;  2Q74 A;  3C31 A;  4Q8R A;  3T0J A;  2UYF A;  3TQW A;  5DVF A;  4PE3 A;  3FXU A;  3O66 A;  3EF7 A;  2RC9 A;  1H3D A;  2I48 A;  1H44 A;  1QKA A;  1SI0 A;  3CSB A;  3CFL A;  3KFM A;  4BDO A;  2ONR A;  2H98 A;  3HHG A;  1JQF A;  3MUQ A;  5CC2 A;  2CEY A;  4QSD A;  1LFG A;  3T22 A;  1IXI A;  1NV4 A;  3S2V A;  5F24 A;  2Q2C A;  4JSO A;  3CG1 A;  4G4P A;  5ICT A;  2QFL A;  1Y1Z A;  4MLQ A;  3MST A;  5K2X A;  2D3I A;  3BFU A;  3BIG A;  3MC2 A;  1MM6 A;  2Z22 A;  2XXR A;  3H03 A;  3IFA A;  4H1X A;  4H5F A;  4G68 C;  1FBE A;  1B4Z A;  4GWU A;  3TEP A;  3PUX E;  4LAT A;  3S9N C;  4KQP A;  3A09 A;  3TTK A;  4MHF A;  1NH8 A;  3ZKL A;  3IAZ A;  3LSW A;  5HPQ A;  2FYI A;  1FCK A;  2V3T A;  3IB1 A;  3FVG A;  3G7W A;  1WDN A;  4YB5 A;  4JSD A;  1TXF A;  4RNS A;  4F2O A;  4TLL B;  5H8Q A;  3E9X A;  4DDD A;  4RPN A;  2CEX A;  4YB6 A;  2FVZ A;  4I62 A;  3S9L C;  3MVX A;  4F18 A;  2RIN A;  1EYJ A;  1S50 A;  2FIE A;  4U1O A;  2F7C A;  3OO6 A;  4FE8 A;  1SDX A;  2HEU A;  4ZS9 A;  1B7Z A;  4MF3 A;  1NKX A;  3IB2 A;  1D9Q A;  3KC1 A;  2VP1 A;  1MM7 A;  4KI0 E;  3VVD A;  3Q29 A;  3ROJ A;  4O94 A;  2DWI A;  1MXX A;  1LBB A;  4YKI A;  2XD3 A;  5I2K B;  3E78 A;  2HXW A;  1LAG E;  1N7W A;  4NN3 A;  3VE1 B;  2A5S A;  2OWZ A;  1FPF A;  5IZ1 A;  4ND9 A;  2Q2A A;  1FQE A;  1FBG A;  1TWY A;  3IOR A;  5H8F B;  3N6T A;  2I0C A;  4N17 A;  3VVE A;  4KYS A;  1SW1 A;  5FBP A;  4PFY A;  3PUW E;  1R1N A;  1B3F A;  2O68 A;  1JVY A;  3P7I A;  3QUF A;  2PYY A;  1I6Q A;  1LLS A;  2XXU A;  1Z7M E;  4RXL A;  3O6H A;  4GF8 A;  4X9T A;  3UGW A;  1ANF A;  3V8X B;  1KWH A;  3KN8 A;  4X1D A;  5BUU A;  1XS5 A;  1A7L A;  1SD3 A;  3Q25 A;  3RN8 A;  3JZJ A;  2WKY A;  1PDA A;  1NNT A;  2XX8 A;  4MNC A;  2Y7W A;  4H45 A;  4P0G A;  1FBC A;  3CFZ A;  1XT8 A;  4R6K A;  1Y4C A;  3QIM A;  3C32 A;  4AB5 A;  1AWB A;  1CB6 A;  2QRY A;  3K6W A;  3A29 A;  1Y3Q A;  4G68 B;  4DI3 D;  2F5X A;  3KOT A;  1URG A;  3LUZ A;  4F29 A;  1IEJ A;  4FAT A;  4PE5 B;  4EQB A;  2GQ1 A;  1MXU A;  3E79 A;  4QBA A;  1BTJ A;  1UTB A;  2Z8F A;  3RTW B;  3ILU B;  1US5 A;  4DE8 A;  1B0L A;  3TKD A;  3IOU A;  4Q5T A;  4PET A;  2ABH A;  3QXM A;  4PAK A;  5H8H B;  5J16 A;  1LBW A;  3U72 A;  4X1B A;  2FIX A;  1QKB A;  2IEE A;  5F1Q A;  2ZNS A;  2DS9 A;  4KCD A;  3K01 A;  2QVU A;  3N6U A;  5ET5 A;  2NVU B;  3VVF A;  1EYI A;  1M5D A;  1SPI A;  3H7M A;  2VHA A;  4R74 A;  1JET A;  4FED A;  4O7I A;  2V4C A;  3RNN A;  4NAP A;  1DK4 A;  4O3A A;  1NV7 A;  1B46 A;  2O51 A;  4KD5 A;  1IMD A;  2F8D A;  4R6H A;  5ISU A;  4OEV A;  5H8S A;  3MZB A;  4I1D A;  1IIW A;  4WXJ A;  1B51 A;  4OVQ A;  1PBP A;  4G77 A;  1DSN A;  4XIG Q;  2F78 A;  3QUJ A;  3PMV A;  2GH9 A;  3TPA A;  4RJZ A;  2ZYM A;  3DEL B;  5DEX A;  1B9J A;  5I3S A;  1NUW A;  1M5B A;  3KZG A;  2XHD A;  4QFP A;  1YZ0 A;  5F7V A;  2XWI A;  3G3G A;  4LQ5 A;  1R9L A;  1SQY A;  1SW5 A;  1ZKB A;  5FHO A;  1PBQ A;  1N3W A;  1QUK A;  1RYO A;  5EQ7 A;  5IAI A;  4HE2 A;  1AL3 A;  3N94 A;  2Q8M A;  3RPL B;  1SYH A;  4QSC A;  2XXP A;  2PX1 A;  3K02 A;  4GXS B;  4F3B A;  4MEV A;  4X8R A;  1LAH E;  4H0W A;  1A40 A;  2XWK A;  1PB9 A;  3S9E A;  2ZYO A;  3TTN A;  3GXA A;  5ICQ A;  1FPD A;  1II5 A;  4G8N A;  4H6D A;  3JV9 A;  3OEK A;  4MNI A;  3RQT A;  2B4M A;  3M8U A;  1B7U A;  1P1O A;  3CHG A;  4GFR A;  3HHF A;  4HE0 A;  4P8B A;  2HZL A;  2I49 A;  3TZA A;  4GWX A;  4PDH A;  3MP1 A;  4PF6 A;  1K9Y A;  2O69 A;  4HXV A;  3IX1 A;  3ZKK A;  4OA4 A;  3KGC A;  1FQD A;  5DVJ A;  3SDF A;  1NNK A;  3PUZ E;  1A54 A;  1OMP A;  3KJ7 A;  5I2N B;  1GTK A;  3B7D A;  2ZNT A;  1LFH A;  2HAU A;  4PAI A;  2XWV A;  4DXU A;  2HCA A;  1VFE A;  1MXY A;  1ZU0 A;  4JWX A;  1IXG A;  1XVY A;  1MPD A;  1NUY A;  1MQG A;  3KJT A;  3H6T A;  4GWO A;  4AS4 A;  3OO7 A;  4PP0 A;  4R6Y A;  3KSX A;  4PFR A;  2A5T A;  4GRK A;  4NF0 A;  4OER A;  3AXF A;  3FAS A;  3IL1 B;  3VXC A;  3HPI A;  3KC0 A;  4DLD A;  3T1B A;  4LON B;  1FJ6 A;  3KG2 A;  3MJN A;  2ZYK A;  1MQJ A;  1POT A;  5AA2 D;  4MAG A;  4KCC A;  4N81 A;  4LVQ A;  3RYD A;  1ZMG A;  2Z23 A;  3IJO B;  3BKI B;  4PTK A;  3PPN A;  3H6W A;  3M3K A;  4XXU A;  1PC3 A;  2H99 A;  4ZE8 A;  4EQ7 A;  4MMP A;  3FGS A;  4F2Q A;  4F3G A;  3EHS A;  2DXR A;  3VV5 A;  3USD A;  1F9B A;  4NGU A;  3MWB A;  4ZDM A;  3PMW A;  4TOZ A;  5JTY A;  4BDL A;  4OMB A;  3VLU A;  5I84 A;  4XKN A;  3U92 A;  1EU8 A;  3BFT A;  3H6U A;  3HST A;  2ALU A;  2OJT A;  3EN3 A;  1B05 A;  5A5X B;  1MS7 A;  1O7T A;  1OLA A;  1XVX A;  4ONY A;  4GBV A;  4RK2 A;  2KLF A;  3IO6 A;  3IO4 A;  4GBW A;  3T9X B;  3CR9 A;  5JEI A;  2M8C A;  3E13 X;  4RPO A;  4PCD A;  5ELV A;  1Y4T A;  5AA4 B;  3O29 A;  1BP5 A;  5KDT B;  5TP9 B;  2DE2 A;  1FRP A;  1BK4 A;  4OAN A;  3K6U A;  3QK6 A;  1A55 A;  3TCF A;  2HAV A;  2D21 A;  5L9S A;  4NX1 A;  4DCX A;  1JP4 A;  1YXI A;  1I69 A;  2DE3 A;  4F1V A;  2B3B A;  3TTL A;  3WAE A;  3O9P A;  1FBH A;  4IO2 A;  2X26 A;  2HXR A;  3TUS A;  1JEV A;  2CZL A;  3PD9 A;  1GGG A;  4IO4 A;  1NH7 A;  4NF4 A;  4N15 A;  4OWD A;  1MY2 A;  4LUB A;  3K4U A;  4LP2 B;  1DMB A;  1TFA A;  5K2Y A;  2QL3 A;  2DDK A;  4UA8 A;  2FHY A;  4H65 A;  3FV1 A;  5AA2 A;  4OZ9 A;  3TCG A;  3OEL A;  4OVT A;  2NXO A;  3QMF A;  2MKZ A;  1MY1 A;  2OCU A;  5EYF A;  3L6H A;  1RDZ A;  4PF8 A;  2VOZ A;  1DPP A;  2F6G A;  4JWO A;  4LA9 A;  1NV5 A;  3SEU A;  1M5C A;  1FTO A;  4MFI A;  1IMB A;  1INP A;  2XXK A;  3FVK A;  4BDR A;  4PFW A;  4JXI A;  1ZIU A;  2I3V A;  2PFZ A;  4H46 A;  1B52 A;  4ELP A;  2I3W A;  3DP4 A;  1BKA A;  1IUD A;  1LGB C;  3VDF A;  2QMW A;  1DOT A;  1KA1 A;  1NFT A;  4H8I A;  1FQB A;  4C1T A;  2GHB A;  4NWD A;  1RKM A;  3O2A A;  1MXV A;  4DIG A;  3PD8 A;  2CZK A;  1K9Z A;  4OET A;  4OVR A;  2XWO A;  2HPG A;  1URD A;  1A8F A;  3PPQ A;  4OEU A;  3T96 B;  5M2V A;  2ESN A;  3K1P A;  4QXD A;  1AIV A;  4NF5 B;  2NOO A;  3SZP A;  1CNQ A;  4O8M A;  1NV0 A;  3DP6 A;  2QS4 A;  4I3Y A;  4U21 A;  3Q26 A;  2JJK A;  4FJP A;  4NTL A;  3KBZ A;  5TPA B;  1LBY A;  3N5L A;  4GL8 A;  1HSE A;  2B65 A;  3LBS A;  3FJM A;  3KBR A;  5EQA A;  4YZZ A;  3A3C A;  3FV2 A;  4EUO A;  2DVC A;  3LC8 A;  2DQV A;  2CZH A;  5IKB A;  4P56 A;  1QVS A;  4UAC A;  1RYX A;  4QFO A;  4ZEF A;  1P1U A;  5CMM A;  5JK4 A;  1B3H A;  3O6G A;  4KHZ E;  4GWS A;  3IOT A;  3E3K A;  3H4Z A;  1XI6 A;  3IK6 B;  4DXC A;  5IZZ A;  4JVI A;  4R2F A;  4JVD A;  3IOV A;  2QS3 A;  2QJE A;  4G61 A;  4QFK A;  3QYT A;  2UVG A;  1I6B A;  2AYS A;  5KCJ B;  3FJ7 A;  5DT6 A;  1H43 A;  2B4L A;  1B3E A;  1MY3 A;  3TMG A;  4XEQ A;  4NED A;  4GQO A;  1FSA A;  3PGF A;  3C9H A;  3OEM A;  4GWY A;  4YAH X;  1DTZ A;  1B3G A;  4IO3 A;  4JB7 A;  4MBP A;  4RY1 A;  2Y7P A;  3S9M C;  4DCY A;  3MZ9 A;  5CMC A;  2PT1 A;  1Y3N A;  2OWT A;  3MPK A;  2KR0 A;  3U8Q A;  5I58 B;  1IIT A;  4HW8 A;  1G0H A;  2XX9 A;  3IOW A;  1MDP 1;  5B70 A;  4H67 A;  2DSF A;  4ELR A;  3T9U A;  3MVY A;  4IY5 A;  4YMA A;  1R9Q A;  4H8J A;  2WYP A;  3NOH A;  4R73 A;  2F3D A;  5ET7 A;  2Q88 A;  4EXK A;  3OO9 A;  4POX A;  5HM4 B;  2L5V A;  1R6Z A;  4EXL A;  4NMY A;  3L6G A;  2Y5K A;  3G3I A;  3TEL A;  1HSL A;  2YLN A;  3HFU A;  1Z7N E;  4G8H A;  3K2D A;  3FXR A;  2OZZ A;  2LAO A;  1USY H;  5T3J A;  3I5O A;  2I4C A;  5I57 A;  2P1S A;  2XXH A;  5CMB A;  4QRZ A;  5DVI A;  3MVW A;  2Q9T A;  3R7X A;  4F3P A;  5I7I A;  5IZ3 A;  5CBS A;  5IGA A;  3PTY A;  1UTH A;  2ZNU A;  1LB8 A;  3KOS A;  1B5H A;  2F36 A;  4Z0I A;  4K3F A;  1PEB A;  1AOV A;  1B5J A;  3KN7 A;  1MRP A;  1DTG A;  4UAB A;  4AB6 A;  2P3V A;  4IY6 A;  4XTC Q;  3RT6 B;  1SW4 A;  1LBZ A;  4GD5 A;  4AS5 A;  1Y3P A;  2D5W A;  3C4M A;  1GVC A;  2V25 A;  4OFO A;  4PFB A;  2X7P A;  4EF2 A;  3OSR A;  4RA1 A;  3LR1 A;  4OTE A;  3OXN A;  4R2B A;  1VSO A;  3W9V A;  1Q1K A;  1L5T A;  2R71 A;  3G3F A;  3EQ1 A;  2OBG A;  1FTM A;  2P0S A;  3LUY A;  4QFN A;  1MQD A;  1SW2 A;  1J1N A;  5H8Q B;  1EZP A;  3OD7 A;  2VPO A;  4PC9 A;  1DCU A;  3D1R A;  4I8C A;  4GLI A;  2DXY A;  3QAX A;  3T9H B;  1ZJL A;  3PPO A;  3TTM A;  3FIR A;  1D9Y A;  1FTK A;  4NF6 A;  5L9O A;  2GRV A;  4IGR A;  2Y7K A;  5I56 A;  2DE4 A;  4GIZ A;  4BDQ A;  1A99 A;  1OQG A;  1JW4 A;  3EHU A;  4M1V A;  2HZK A;  1POY 1;  2O1L A;  4YMB A;  1JNF A;  4YKJ A;  2Y7R A;  1PB8 A;  4THI A;  1G0I A;  1YYZ A;  1FPG A;  1FQC A;  1IXC A;  2WBB A;  5AE4 A;  1YTV A;  4MIJ A;  3G3H A;  3U65 A;  2AIX A;  3W15 C;  4NG7 A;  2Y7I A;  3SES A;  2I6E A;  1US4 A;  4PAF A;  2DVZ A;  4G8M A;  4OHN A;  4PGN A;  2E1S A;  3SEV A;  3OEN A;  4X04 A;  4YIC A;  2I0B A;  4PQJ A;  2NUV A;  4P1E A;  4N91 A;  5LDZ A;  1LAF E;  1O64 A;  2VGQ A;  4C0R A;  5DW8 A;  3DM0 A;  2XX7 A;  4KXP A;  1OIB A;  4RYA A;  3RUM A;  3B6T A;  3CFX A;  1PB7 A;  4E0W A;  3PV0 E;  3MPL A;  1NV6 A;  3GZG A;  3R26 A;  4N07 A;  5BWJ A;  3MYU A;  2Q89 A;  4KFQ A;  3GBB A;  2ZZX A;  2OX3 A;  5DTB A;  2GHA A;  1B7H A;  3BIH A;  4YB7 A;  4JVC A;  3ISP A;  4GX3 A;  2FBP A;  4QF9 A;  5DYH A;  3Q28 A;  1EZO A;  2O84 X;  2DYX A;  4FEC A;  4G2Z A;  5CI5 A;  2OK2 A;  3TYH A;  2V84 A;  4WEP A;  3A3U A;  4QSE A;  2F7B A;  4R75 A;  1LAX A;  2XXT A;  3UOR A;  2ONS A;  5ET8 A;  2HFB A;  1FPB A;  1AMF A;  2RF1 A;  1P1W A;  1MH3 A;  5CRY A;  4U1Z A;  5EYH A;  3U94 A;  1URS A;  3KEI A;  2ANJ A;  5ITO A;  4OEN A;  2YPN A;  4U23 A;  4PFI A;  4YU0 A;  1B58 A;  4PGP A;  1UQW A;  3HV1 A;  4FAJ A;  5TPA A;  2H9B A;  4FEB A;  2RC8 A;  3H06 B;  2X7Q A;  2F97 A;  4ISU A;  5AA1 A;  1B40 A;  4GWW A;  2IA4 A;  5ET6 A;  2O1M A;  2QSX A;  4NE4 A;  2F34 A;  1FQA A;  4I40 A;  3SEW A;  3N26 A;  3B8B A;  3M3F A;  4NF8 B;  3FXQ A;  3C33 A;  3TDJ A;  1FPJ A;  3LSL A;  1SI1 A;  4IO7 A;  5DEX B;  1NV2 A;  1WOD A;  4I3E A;  1RDX A;  4ELO A;  1QGX A;  2I58 A;  5FHN A;  3UN6 A;  3EHT A;  3ODB A;  1Y20 A;  3V89 B;  1OQH A;  2R6G E;  5ESY A;  2R9J A;  5IM2 A;  5I2K A;  5KCJ A;  2DOJ A;  3TTR A;  1S9T A;  1TFD A;  1NI9 A;  1P1N A;  3MP8 A;  5H8F A;  1MY0 A;  1SVX B;  3B6W A;  1FPK A;  4ESX A;  1M5E A;  4JBZ A;  4R9G A;  3G3J A;  1FJ9 A;  4ESW A;  3I3V A;  3HCQ A;  2WEF A;  3RLF E;  1XHY A;  3O97 A;  1B4H A;  4JWY A;  3FD3 A;  3IFC A;  1IME A;  1RDY A;  2G93 A;  2Y5L A;  5I58 A;  3H6V A;  1MXW A;  1FTJ A;  3KN3 A;  4KYD A;  5L8D A;  1QUJ A;  1NUX A;  5EHS A;  4OYV A;  2WYK A;  4GOT A;  3OMB A;  2F3B A;  5L9M A;  3MAM A;  4IB2 A;  3RPW A;  4N8Y A;  4NHB A;  3G3K A;  1FQF A;  1IMA A;  2Y84 A;  1NUZ A;  3M3L A;  2XA5 A;  1USY E;  3PU5 A;  3V5A A;  1ZBM A;  4P11 A;  1B1H A;  5ITP A;  4G68 A;  3K1M A;  4IO6 A;  4HCW A;  3TCH A;  2O7U A;  4Q30 B;  1LB9 A;  3SEX A;  4QFL A;  1OVT A;  2YJP A;  2PFY A;  3SET A;  4M4G A;  1MDQ A;  4MJO A;  1IMC A;  4P0I A;  1LBX A;  3F11 A;  4Z7E A;  2ZYN A;  4MCO A;  3D4C A;  3VFJ A;  1OVB A;  4R9F A;  3OOA A;  3K6X A;  2A5T B;  2AL5 A;  5H8H A;  3PMX A;  4OES A;  3LSX A;  3KSJ A;  1MXZ A;  1WVJ A;  4ZEB A;  4KPT A;  3ILT B;  4OVJ A;  2WBD A;  1P99 A;  2H4I A;  3TAJ A;  5I5P A;  3O6I A;  3FUZ A;  4F39 A;  5I59 B;  1KA0 A;  4N13 A;  2DWJ A;  4MX6 A;  2F6P A;  2V3Q A;  1LFI A;  4O3C A;  2DP8 A;  5JTY B;  4O3B A;  4YKK A;  4ZE9 A;  4F1Y A;  3K00 A;  2RKM A;  2VD2 A;  2RC7 A;  3T66 A;  1YPN A;  1QUL A;  1OLC A;  1SYI A;  2XXY A;  2XXW A;  1N76 A;  4N6P A;  4XKP A;  4ZZA A;  4WKM A;  3MBP A;  2KQZ A;  3TQL A;  3UK4 A;  4KR5 A;  1VDW A;  4AQ4 A;  4HCY A;  1GR2 A;  1YCJ A;  3ZSF A;  1TT1 A;  4U4S A;  3RPL A;  4OXV A;  3SEY A;  1XOC A;  3VXB A;  3VLV A;  2QS2 A;  1D4N A;  1KZ8 A;  1B5I A;  2R8T A;  5HBC A;  1Y9U A;  2OLB A;  4HS7 A;  2QS1 A;  2DWA A;  3ZS6 A;  1HSJ A;  3T93 B;  1LST A;  2UVI A;  3CSG A;  3CG3 A;  4FIM A;  4DI4 B;  2V3U A;  1UIU A;  5H8N B;  4NWC A;  4HTG A;  3CVG A;  2XD2 A;  4C1U A;  4ZEC A;  1B6H A;  4NF4 B;  4OQO A;  3MQ9 A;  4ECF A;  2FNC A;  2XXV A;  1MG1 A;  4N4U A;  1NV3 A;  4LZ5 A;  4ZEI A;  2QPQ A;  3LV0 A;  3DLN A;  1B32 A;  4EF1 A;  4XKQ A;  3D4G A;  1O63 A;  4I9D A;  4MNP A;  4LZ8 A;  2QVR A;  2W7Y A;  4ELQ A;  3IR1 A;  1B2H A;  4PDD A;  1D9V A;  5I2N A;  5AA2 B;  4NQ8 A;  2P2A A;  1FTL A;  3HO7 A;  5EYG A;  3ECR A;  1Q35 A;  1EH3 A;  1FBP A;  3UP9 A;  1D3K A;  4EDP A;  2HQ0 A;  2ONK E;  2WX9 A;  5CMK A;  1LCT A;  2UVJ A;  4F31 B;  1FPE A;  4P3L A;  3GYY A;  3Q27 A;  4GX4 A;  3PUY E;  4PBQ A;  1FTA A;  3O28 A;  4MH5 A;  3CI8 A;  1FBF A;  4OVS A;  4FOR A;  4PFT A;  1NMU A;  3RTF B;  3IJX B;  1T0K A;  1JW5 A;  1N3X A;  5EQ9 A;  2PVU A;  3FVO A;  1SBP A;  2VT5 A;  2V93 A;  3B6Q A;  4Q0C A;  1I6A A;  4P1L A;  4ZED A;  5CM6 A;  1Q9D A;  1LBC A;  2PBW A;  4JDF A;  3R6U A;  1ZLQ A;  1FBD A;  4P9K A;  4BLA A;  1P1Q A;  1LBV A;  4IR8 A;  4POW A;  3MW0 A;  4PBH A;  3RT8 A;  3WAF A;  4ZEK A;  3V83 A;  3MP6 A;  2ZZV A;  3TFL A;  2RCB A;  4U22 A;  1H45 A;  2OWS A;  1NNP A;  4TQU Q;  5FTH A;  1AH5 A;  2ZMB A;  5A5X A;  4OFJ A;  1IQ7 A;  3MVZ A;  3CIJ A;  2BJI A;  3ONM A;  2B3F A;  3LSF B;  1YAE A;  4NF8 A;  2NWJ A;  4OFL A;  2UXA A;  3E4R A;  1UIV A;  4IO5 A;  2RCA A;  3K6V A;  5FTI A;  1MPC A;  3VLW A;  1QW0 A;  4U2R A;  1NV1 A;  3TOD A;  3PUV E;  2REJ A;  5FHM A;  1B0H A;  3FVN A;  3FAT A;  3QSL A;  3SER A;  2I4B A;  5AA4 A;  4PFU A;  5KDT A;  1XC1 A;  5TP9 A;  3CRB A;  4L17 A;  3BBR A;  1H76 A;  1B3L A;  1N0T A;  3C36 A;  2ZZW A;  4DXB A;  4QHQ A;  3T9V A;  2XXQ A;  1N7X A;  2H5Y A;  5EQ8 A;  4O7M A;  5B7D A;  2AL4 A;  2P3N A;  4X48 A;  3S4U A;  4U4X A;  2G29 A;  4WED A;  1S7Y A;  2DWH A;  3OSQ A;  1FPL A;  3I6V A;  4EQ9 A;  2QMX A;  1JW1 A;  2UVH A;  2E0S A;  1LCF A;  3OO8 A;  1MQH A;  2PCR A;  2O7I A;  4ZZE A;  2CMO A;  2UYE A;  3UIF A;  2QVV A;  1VR5 A;  2PT2 A;  2THI A;  1B1X A;  3FZV A;  4KYE A;  1M5F A;  4FBP A;  4OVP A;  2H25 A;  2F35 A;  1EYK A;  4HE1 A;  1QUI A;  2BJJ X;  5I57 B;  2O6A A;  1FW0 A;  3H3G A;  1ELJ A;  1UTB B;  2PMS A;  5IZ3 B;  1NNF A;  1N84 A;  1UTH B;  1N04 A;  2F7A A;  1NL5 A;  1Y1M A;  1ZTY A;  5CBR A;  1MH4 A;  4GVO A;  4H5G A;  2VD3 A;  1DBZ A;  3FJG A;  2GFE A;  1MPB A;  1MY4 A;  5LTC A;  4NF5 A;  2VPN A;  2Z8D A;  3EKI A;  5I59 A;  3U93 A;  3FXB A;  4F3S A;  3RGY A;  5A5L A;  1JEU A;  3GLB A;  1EZ9 A;  4N6D A;  4F1U A;  4N8G A;  5TU0 A;  2FA7 A;  4XKR A;  3THI A;  1DPE A;  5J1D A;  3JYR A;  4N6K A;  3EPE A;  3UA8 A;  4R72 A;  1QJM A;  1LEV A;  4LQ2 A;  3W9W A;  1VFD A;  1IMF A;  1JVX A;  4XFE A;  3HN0 A;  1IZ1 A;  4NF6 B;  4IGT A;  5KZT A;  5I56 B;  4DZ1 A;  4XF5 A;  1ATG A;  3PPR A;  4LN5 A;  3RY3 A;  4F22 A;  5EHM A;  3SKP A;  4GXA A;  4F19 A;  3GBA A;  1A8E A;  4BDM A;  1VE4 A;  3MZ1 A;  5LOM A;  2ZXT A;  4YKP A;  4LZ7 A;  2REG A;  4BDN A;  1CE2 A;  2XXX A;  2XXI A;  4RK9 A;  2Q8J A;  1BIY A;  3FBP A;  3B50 A;  4TLM B;  1FPI A;  3DP8 A;  4GX6 A;  4E0X A;  1MQI A;  4GWZ A;  1GV8 A;  3IB0 A;  5H8N A;  1IXH A;  2HHM A;  3C35 A;  2CZI A;  5AA3 A;  3U1O A;  4MLV A;  3K0V A;  3PPP A;  4P47 A;  4GL0 A;  1BLF A; 
#chains in the Genus database with same CATH homology
 3KC0 A;  1KZ8 A;  2R8T A;  3T1B A;  2Q74 A;  1FJ6 A;  3T0J A;  2VPO A;  4MAG A;  4N81 A;  4PE3 A;  3RYD A;  4PC9 A;  1DCU A;  4DI4 B;  4PTK A;  3D1R A;  4MMP A;  2CEY A;  2DE4 A;  4NGU A;  1NV4 A;  5F24 A;  4N4U A;  1NV3 A;  2QPQ A;  3LV0 A;  4M1V A;  2HZK A;  2QFL A;  4MNP A;  3MST A;  2QVR A;  4PDD A;  3BIG A;  1G0I A;  4NQ8 A;  1YYZ A;  1FPG A;  5EYG A;  2WBB A;  3IFA A;  4MIJ A;  1FBE A;  1FBP A;  4GWU A;  3U65 A;  4GBV A;  4NG7 A;  4PAF A;  2WX9 A;  4MHF A;  4GBW A;  1FPE A;  2DVZ A;  4P3L A;  3GYY A;  4PGN A;  4PCD A;  4GX4 A;  4PBQ A;  4X04 A;  1FTA A;  4YIC A;  4P1E A;  4N91 A;  2DE2 A;  1FRP A;  5LDZ A;  1BK4 A;  4OAN A;  1FBF A;  4OVS A;  5DW8 A;  4KXP A;  2CEX A;  2FVZ A;  4NX1 A;  4F18 A;  1EYJ A;  1JP4 A;  1YXI A;  2DE3 A;  4F1V A;  1NV6 A;  5EQ9 A;  3MYU A;  1FBH A;  2FIE A;  2ZZX A;  2OX3 A;  2HXR A;  2VT5 A;  3BIH A;  4P1L A;  4N15 A;  4JVC A;  3KC1 A;  1D9Q A;  3ISP A;  4GX3 A;  2FBP A;  5CM6 A;  1Q9D A;  3ROJ A;  4O94 A;  1FBD A;  4P9K A;  2DDK A;  1LBV A;  4IR8 A;  3E78 A;  2FHY A;  4PBH A;  2ZZV A;  4NN3 A;  2OWZ A;  1FPF A;  5IZ1 A;  5ET8 A;  4OVT A;  1FBG A;  4N17 A;  3QMF A;  1FPB A;  2MKZ A;  2BJI A;  5FBP A;  1RDZ A;  4PF8 A;  5EYH A;  1NV5 A;  1IMB A;  1INP A;  2XXK A;  4X9T A;  2PFZ A;  4PFI A;  1NV1 A;  4H46 A;  4PGP A;  1KA1 A;  4GWW A;  5ET6 A;  4MNC A;  4H45 A;  2CZK A;  1FBC A;  1K9Z A;  2ZZW A;  4I40 A;  4OVR A;  2XWO A;  2HPG A;  3B8B A;  5EQ8 A;  1AWB A;  4QXD A;  4O7M A;  1FPJ A;  2P3N A;  1NV2 A;  3A29 A;  4DI3 D;  3SZP A;  1CNQ A;  4I3E A;  1RDX A;  2F5X A;  4O8M A;  1NV0 A;  3LUZ A;  4I3Y A;  1FPL A;  1QGX A;  2JJK A;  2GQ1 A;  3KBZ A;  3E79 A;  1LBY A;  4QBA A;  5ESY A;  5IM2 A;  5EQA A;  4YZZ A;  2PCR A;  1NI9 A;  2QVV A;  4PET A;  2CZH A;  4P56 A;  4PAK A;  5J16 A;  1LBW A;  4FBP A;  2FIX A;  4OVP A;  1FPK A;  5JK4 A;  1EYK A;  1FJ9 A;  2QVU A;  4GWS A;  4HE1 A;  5ET5 A;  2WEF A;  1XI6 A;  5IZZ A;  1EYI A;  4JVI A;  1SPI A;  4JVD A;  3IFC A;  1RDY A;  1IME A;  2Y5L A;  4O7I A;  2V4C A;  4NAP A;  1DK4 A;  4G61 A;  1NV7 A;  1NUX A;  5IZ3 B;  2WYK A;  1IMD A;  2F3B A;  2B4L A;  4N8Y A;  4NHB A;  1IMA A;  4XEQ A;  4OVQ A;  1NUZ A;  1FSA A;  4GWY A;  1DBZ A;  2XA5 A;  5LTC A;  5I3S A;  1NUW A;  2VPN A;  1YZ0 A;  4HCW A;  2KR0 A;  2XWI A;  3EKI A;  1G0H A;  2PFY A;  3FXB A;  5A5L A;  4MJO A;  1IMC A;  1LBX A;  5EQ7 A;  4MCO A;  2WYP A;  3NOH A;  2F3D A;  4N6D A;  4F1U A;  4HE2 A;  3RPL B;  2Q8M A;  5ET7 A;  4N8G A;  2L5V A;  2Y5K A;  3HFU A;  5J1D A;  4MEV A;  4N6K A;  2WBD A;  5T3J A;  4X8R A;  1LEV A;  3W9W A;  2XWK A;  5I5P A;  1KA0 A;  1FPD A;  4MX6 A;  1IMF A;  4MNI A;  2B4M A;  2Q9T A;  4XFE A;  5I7I A;  2V3Q A;  5IZ3 A;  3CHG A;  5IGA A;  4HE0 A;  4XF5 A;  3PTY A;  4P8B A;  4LN5 A;  2HZL A;  4GWX A;  4PDH A;  4PF6 A;  1K9Y A;  4F19 A;  4HXV A;  4OA4 A;  4UAB A;  2P3V A;  3FBP A;  3B50 A;  1FPI A;  1LBZ A;  4GX6 A;  4PAI A;  2XWV A;  2KQZ A;  1VDW A;  4GWZ A;  4AS5 A;  4HCY A;  1NUY A;  4PFB A;  2HHM A;  2CZI A;  4AS4 A;  3RPL A;  3W9V A;  4P47 A;  4PFR A;  4NF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...