4NAPA

Crystal structure of a trap periplasmic solute binding protein from desulfovibrio alaskensis g20 (dde_0634), target efi-510102, with bound d-tryptophan
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
308
structure length
308
Chain Sequence
PVTLNYANFPPASTFPCIQMEQWAHEVRTRTRGKVDVLTYPGGTLLGARNMLRGVMSGQADIGCISLAYHPGVFPVMSVFELPLGFTSAEAASSVLWELYSGLRPAELERVKVLTMFTSAPSHFMTVTPVRSLRDLQGMEIRGAGTLSAILEKLGATPVSMPMPEVPEAVQKGIIKGLFTSLDVMKDMNFAEMTGHVTRADQAVYPFAVIMNREAWERLSPDVQQVLDGLAAEHAAWTGRYLDAHVQDSMRWAEEKHGVQVHTLPEEDIAAMRRSVQPLFDAWAQRAADKGADPDAVMRTVDALKAQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Extracellular solute-binding protein, family 7
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Desulfovibrio alaskensis
molecule tags Transport protein
total genus 96
structure length 308
sequence length 308
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4napA00
2XWKA 4NGUA 4O8MA 4O7MA 4OVSA 4X04A 2ZZVA 5IZZA 4MMPA 4PDHA 4OA4A 4PAKA 4PDDA 2XA5A 4NG7A 2CEXA 4PF6A 2PFYA 4UABA 4P8BA 2PFZA 4MX6A 4MIJA 2XXKA 4OANA 4PC9A 4NF0A 5I5PA 2WX9A 2ZZXA 4PAIA 2XWIA 4N15A 2XWOA 4DI4B 5IGAA 4P1EA 4XF5A 4OVPA 4NX1A 4NN3A 4NAPA 4PAFA 2HZKA 4MNIA 4N91A 4MHFA 4MNCA 4N17A 4PFBA 4PBHA 4MCOA 2VPNA 4N8GA 4PBQA 5CM6A 4OVRA 4N6DA 4P3LA 3GYYA 3FXBA 4PCDA 4NQ8A 4NHBA 2CEYA 2V4CA 4OVQA 4PETA 4P1LA 4PFRA 4N6KA 2WYKA 4DI3D 2VPOA 4PGNA 4P56A 2HZLA 4XFEA 4XEQA 4MEVA 4P47A 4N4UA 4LN5A 4YICA 3U65A 2XWVA 5LTCA 3B50A 4PE3A 4PF8A 2HPGA 4YZZA 5IM2A 5I7IA 4N8YA 4PFIA 2WYPA 4OVTA 4MNPA 4P9KA 4MAGA 4PGPA 4X8RA 4O94A 2ZZWA
chains in the Genus database with same CATH superfamily
4WXJA 4KD5A 5FTIA 4UA8A 3IR1A 1SQYA 3S9MC 2XXQA 1JP4A 5EYGA 2YJPA 5CRYA 2FIEA 1NH8A 3USDA 2RC9A 1MPDA 2I4CA 4H1XA 1DK4A 4IGRA 1XHYA 2FA7A 4PP0A 1P99A 2XX8A 1SW1A 3S9LC 4R73A 1IZ1A 3OMBA 3CI8A 3C33A 4PC9A 1FPIA 2RKMA 1NNFA 1TFAA 2XXXA 4N81A 3IORA 3IJOB 5JK4A 3KFMA 4F2OA 5JTYB 4RY1A 2DXRA 4PAFA 1XI6A 2NWJA 4I8CA 3KC1A 2I3VA 1FBDA 4XKRA 3R6UA 5KCJA 1B46A 4LP2B 4Q30B 4QBAA 2NVUB 4YB5A 4OVRA 4PCDA 2RCAA 2QFLA 3O66A 3MZ1A 3EKIA 1FCKA 4FJPA 2V84A 3GLBA 1DSNA 1B5JA 3G3HA 1M5DA 2HZLA 1I6QA 4U1ZA 2ALUA 1A40A 3CIJA 1IMDA 4P47A 1K9YA 4N4UA 4OFOA 1LFHA 3PPQA 4FEDA 1B51A 1I6AA 3RYDA 1MXYA 4WEPA 5J1DA 5DVJA 2QVVA 1SBPA 2WKYA 3PUVE 2GRVA 4PFIA 4PFWA 4MNPA 1FRPA 5I2NB 4HS7A 3GBBA 3P7IA 3OO8A 1B5IA 3WAEA 1SI0A 3QK6A 1QULA 3D1RA 4GWZA 4POWA 2XXUA 3FZVA 4LZ8A 4ZE9A 4MFIA 1P1NA 1KWHA 2UVGA 1Y20A 2O7IA 1FSAA 3KGCA 1PB7A 2Y84A 1Q35A 1Y3QA 3CRBA 5I5PA 5BUUA 3PUZE 1FBFA 2H99A 4H5GA 4F1VA 5H8HA 4PE5B 4PFYA 4ECFA 1S50A 2Q9TA 4QF9A 4GX6A 4R9GA 2Z8EA 1LFGA 4IO5A 2F97A 1NV6A 1QUJA 4OQOA 2XXPA 4XTCQ 3KG2A 2A5SA 4LATA 1H3DA 2B65A 4Z7EA 1B3FA 4R6KA 1JEVA 3UN6A 1IMAA 4G61A 3QUJA 1BP5A 4DXUA 4ESXA 3MZBA 3ILTB 2VPOA 3FJ7A 4GVOA 3PMWA 4PGNA 2QRYA 3F11A 1FTLA 4ZS9A 5I2KA 2PYYA 3H7MA 2XXVA 1ELJA 2REJA 4WKMA 2WEFA 4QSDA 2ZMBA 4F31B 3V89B 4F3SA 1UTHB 4HE1A 1N04A 3ECRA 1IXIA 5FHOA 2DVZA 3H03A 3N5LA 2E0SA 2XWKA 1A55A 3RPLB 4OVSA 5AA2B 1MY3A 2ONRA 2ZYKA 3BKIB 5KZTA 2OCUA 1K9ZA 3T9XB 4R72A 2BJIA 4RK2A 3PV0E 1NUYA 2F7CA 3M3LA 4GRKA 4G4PA 2H4IA 4QXDA 3OSRA 4GLIA 1P1OA 1OLAA 2XWIA 3A3CA 2G29A 2QS1A 1FTKA 2UYFA 5EYFA 3QYTA 4QHQA 3MPLA 4OENA 2Y5KA 2F6PA 4Q5TA 1LB8A 3O28A 2KLFA 3SEUA 5K2YA 4GXAA 4TQUQ 4GXSB 3G7WA 1DTGA 1YCJA 4M1VA 4MCOA 2QVRA 1CB6A 2O51A 5KDTB 3U1OA 4GOTA 2DE3A 1WODA 3FUZA 3MZ9A 1MRPA 1RDZA 2FNCA 3T0JA 4OVQA 3TDJA 2PCRA 4KI0E 4X1DA 4K3FA 5ICQA 2CMOA 1GR2A 4MBPA 1FTJA 4DZ1A 4EDPA 4LQ5A 4GD5A 1IXGA 3GZGA 3DP8A 5BWJA 2O68A 2FIXA 3FVKA 2O1MA 4HW8A 4G8NA 5CMBA 1FPDA 5ET7A 2NOOA 5CMCA 2RC7A 3FVNA 2GQ1A 1TT1A 5I57B 4ZEKA 1IITA 4QRZA 2CZHA 2JJKA 2BJJX 4U21A 4AQ4A 1ATGA 3C9HA 4R6YA 3MC2A 2VP1A 4MMPA 2XXYA 4QFPA 5HBCA 4P11A 1YTVA 2XA5A 3U92A 2XD2A 3E78A 4JWYA 1ZIUA 3MYUA 5AA4A 3EHUA 4PF6A 1TXFA 3CG1A 2P3VA 2F78A 1FTMA 3EPEA 5I56B 2F6GA 3MAMA 5L9SA 1QVSA 1PDAA 1MH3A 3N94A 1MM6A 1POTA 4DI4B 5EQ9A 4OVPA 2DYXA 1FTOA 4NN3A 1NFTA 1JVXA 4F2QA 1VFEA 4MHFA 5FBPA 3TTRA 4H65A 1MXWA 2QVUA 4OMBA 3B8BA 1B5HA 2UYEA 1FQDA 1VDWA 3G3IA 4Q8RA 1A99A 3G3FA 1UIVA 4YKKA 1IEJA 3LSWA 5F1QA 3TQWA 1Y1MA 4PFRA 1RDYA 3LBSA 3SDFA 1B7UA 4AB5A 5TP9B 4FBPA 3PUWE 3IOWA 3EQ1A 3FJGA 4LN5A 5LTCA 4PE3A 3TZAA 1MM7A 3B7DA 5I2NA 1B05A 2I58A 3IFCA 5CBRA 2DWHA 1KA0A 1B7ZA 1LBZA 1DBZA 4NTLA 1Z7ME 3B6WA 1B0HA 1LGBC 4ELQA 1QGXA 2HQ0A 3W9VA 3GBAA 2DWAA 3VLUA 3TUSA 4LUBA 4NG7A 3SKPA 1A7LA 2I48A 3KN7A 4F1UA 3UA8A 1Y9UA 3KC0A 4KYEA 2WX9A 2DSFA 3O6IA 2DVCA 1P1UA 1IQ7A 3EHTA 1I6BA 4FIMA 2Q89A 2OZZA 3KN3A 4PFTA 5CMKA 2Z22A 1IXHA 1MXUA 4JDFA 3U93A 4ONYA 4F18A 4C1TA 2QSXA 4JBZA 3KOSA 1MXZA 1FBEA 1R6ZA 1B0LA 1N3XA 2ABHA 2CZKA 4O3AA 1IMBA 4P1LA 1EZ9A 1FQBA 2HXWA 1Y3PA 2ZXTA 1A8FA 1POY1 3IOTA 4BDOA 3B50A 1UTHA 4RNSA 5B70A 4C1UA 2PT1A 1B2HA 1DPPA 1BIYA 5IAIA 2A5TB 3M3KA 4ZECA 3OSQA 4U2RA 1UTBB 3RPLA 2RCBA 3SEXA 5AA2A 4JVIA 1N84A 2H25A 4O94A 2OK2A 1N7WA 1FBHA 1D4NA 3JYRA 4KXPA 4EXLA 3KOTA 3ISPA 4DLDA 2UVHA 4XXUA 4JSOA 4OZ9A 2REGA 4UABA 1NV4A 3E9XA 3K00A 3HSTA 4NF0A 4IO7A 2FHYA 2X7PA 1QW0A 3PD8A 4NE4A 5I84A 3Q29A 1R9QA 1H44A 3C4MA 3TODA 5KDTA 2V25A 3T22A 4LONB 2DOJA 1HSJA 3LSXA 3WAFA 1HSLA 1B52A 1DOTA 3RPWA 3TCHA 3CHGA 1SVXB 3FVOA 1NNPA 3LUYA 1G0HA 1FPBA 4BDNA 2F7BA 5IZ1A 4R6HA 2IA4A 2WBDA 3RNNA 2IEEA 3ODBA 4G8MA 3RN8A 1M5EA 3CFZA 3SEYA 4XFEA 5J16A 3TQLA 2O84X 4G68B 5I59B 1GV8A 4QSCA 4HE0A 4H0WA 1MQIA 4ELOA 3H4ZA 3ZS6A 4GIZA 1LBCA 1B3EA 2DWIA 1IIWA 4Z0IA 3OENA 3TCGA 3K6VA 3TKDA 5EHMA 3V5AA 4NF4A 4XKPA 4GWUA 2Y7PA 4DCYA 1LAGE 3TPAA 2LAOA 4PDHA 4RK9A 5CC2A 2X26A 3HV1A 3UK4A 4YU0A 3DP4A 5I56A 4LA9A 2PFYA 3UORA 1FJ9A 5L9MA 4IO4A 4AS5A 4MIJA 3SESA 3PU5A 1JVYA 4PAIA 3ZKKA 2QPQA 2P3NA 4Q0CA 3M8UA 3PMVA 1NL5A 3O97A 3HN0A 4F39A 3MVWA 4KYDA 4H46A 1XOCA 3DM0A 1L5TA 3MUQA 4N17A 4MH5A 4OESA 2PX1A 3VVFA 3K4UA 4NF8B 3U72A 3QSLA 4N6DA 2PBWA 2VD3A 2CZIA 4R2BA 1FPGA 5F7VA 4NHBA 2CEYA 5FTHA 3MVXA 1N7XA 3EF7A 3FGSA 3L6HA 3Q25A 1SW4A 4GL0A 3E4RA 3C31A 4FATA 1LFIA 2F7AA 4ELPA 3EHSA 1H76A 3FXQA 3H6TA 2F36A 3U8QA 1NI9A 5AA1A 4XKNA 4I3YA 1LBVA 1MY2A 5IKBA 1RYXA 1WDNA 3KEIA 1MDQA 1NNTA 2WYPA 1PB8A 1CNQA 3LR1A 3IOUA 1LAXA 4JVCA 4TLMB 2QJEA 4JSDA 3TTNA 2OJTA 5EQ8A 4JWXA 1JW5A 1AH5A 1MY4A 3K6XA 4QFKA 2QS3A 1XVXA 1LSTA 5TPAB 1JEUA 3TFLA 3U94A 3LC8A 4PDDA 3G3KA 3MP1A 2H98A 2KR0A 4NWDA 2B3BA 2ZNUA 3R26A 1VE4A 2XXWA 2Y7WA 4KPTA 1B40A 2ZZXA 1NV3A 1MQDA 5LOMA 1KA1A 1YPNA 5L9OA 4HCYA 4F22A 2HCAA 4ND9A 3D4CA 1GGGA 1DCUA 1SW2A 4EQ9A 2XXRA 1G0IA 2HZKA 1NV1A 2G93A 4E0XA 1LBYA 4EQ7A 2AL5A 1VSOA 2PMSA 2V3QA 3FXBA 2UXAA 2D21A 3G3GA 3CG3A 3S9EA 3HPIA 4MEVA 3IB1A 2A5TA 4NF6B 1B4HA 2XWVA 1USYH 2Y7RA 4GL8A 1UTBA 2H5YA 4U22A 1OVBA 2HPGA 4OVTA 3BIGA 4MAGA 5ESYA 3VLVA 4AS4A 3MPKA 3E79A 3GXAA 1O64A 4OEUA 3SEWA 4DIGA 2ONKE 4NF5B 4OWDA 2WBBA 1LB9A 1AIVA 2XXIA 3HO7A 4IR8A 4C0RA 1II5A 3K2DA 2ANJA 3IAZA 4DE8A 4ZDMA 3ILUB 2VHAA 5LDZA 3C35A 1R1NA 2F5XA 4QFLA 1EZOA 1QJMA 2QS2A 2GH9A 3THIA 2QL3A 4HCWA 4N15A 2XWOA 4H67A 3Q26A 3OD7A 4BLAA 2DWJA 4P1EA 1OQGA 4NMYA 2DE4A 1S7YA 3HFUA 4EF1A 5EQAA 1JW1A 1NUWA 3PTYA 4JVDA 3B6TA 3IL1B 1OIBA 2ZYMA 1OLCA 1XVYA 4MNCA 1LAFE 1AOVA 4PQJA 1ZKBA 3IK6B 5JTYA 3FBPA 1Q9DA 2ZNTA 4N13A 3FASA 3T9UA 4GX3A 4X48A 1QKAA 1USYE 1IMEA 2X7QA 3V8XB 3RGYA 1KZ8A 5T3JA 3TTMA 4G68A 5I59A 5A5XB 1MY0A 2P1SA 1FBPA 3TYHA 4OYVA 3FXUA 2AIXA 4HE2A 3HHGA 3LSFB 4KYSA 1B32A 5EYHA 2V93A 4N8YA 1HSEA 3T96B 1LCTA 3LV0A 3FXRA 2ESNA 2F34A 4KFQA 4I1DA 3LUZA 4I3EA 3PUXE 4KQPA 4F3BA 2RINA 1B1HA 2ZZVA 2F35A 3BBRA 1H45A 4P0GA 4JXIA 2I6EA 5CBSA 2R6GE 3OO6A 1DPEA 3ONMA 3SEVA 1F9BA 3KBRA 1EYJA 1SD3A 1FW0A 3VVEA 1FPFA 4F1YA 4OTEA 3T93B 2Z8FA 2PFZA 3H3GA 2P0SA 1EZPA 4MX6A 2FBPA 4OANA 4KR5A 4GWXA 1N0TA 1MG1A 1H43A 2D3IA 1ZU0A 3CSGA 1JW4A 2VT5A 2DDKA 3FIRA 1YYZA 2Q8JA 2O69A 4YMBA 3T1BA 1I69A 5FHNA 1JQFA 4O3CA 3TAJA 1FPLA 5L8DA 4NF8A 1FBCA 2XXTA 1MXXA 1B3LA 2VPNA 1WVJA 3PMXA 4R74A 4IY5A 3VXBA 4DXCA 3E3KA 2O6AA 4RA1A 4I9DA 2V4CA 2DQVA 4MF3A 4GWSA 3MSTA 1JNFA 1NKXA 1M5FA 4OHNA 1LBWA 3I6VA 1YXIA 1NMUA 4FECA 1ANFA 3RLFE 3PPPA 1M5BA 1SW5A 3C34A 4TOZA 5I7IA 4H8JA 4ZE8A 4BDQA 1FTAA 4P9KA 1AWBA 2O1LA 4PGPA 2DXYA 2ZZWA 1EYKA 3VV5A 5IZ3B 5DVIA 3MBPA 5DTBA 5F24A 3E13X 3C32A 1URSA 2W7YA 5JEIA 4GWWA 1BTJA 2GHAA 1UQWA 2HAUA 4U23A 1PEBA 4YKIA 3PD9A 3N6UA 1T0KA 3HCQA 1XS5A 3KSJA 2DP8A 4IO2A 1N76A 4E0WA 4FORA 4G68C 3FV2A 3CVGA 4QFOA 2HEUA 3VLWA 2E1SA 1PC3A 1VFDA 5H8SA 2XX7A 2VGQA 4IY6A 4NX1A 2GFEA 3Q28A 3VVDA 4GBWA 4GWYA 3IB2A 1LBXA 1SPIA 4L17A 2XHDA 3K1MA 4BDRA 4N8GA 5CM6A 4PTKA 5DVFA 2H9BA 2QMWA 4P3LA 1IMCA 3IX1A 3OOAA 2I49A 5I58B 4H8IA 5B7DA 4RPOA 3OEMA 4IO6A 4H5FA 4NF6A 3T66A 1B58A 1DMBA 5H8NB 1B7HA 4U1OA 3VE1B 2Q88A 2ZYNA 3PGFA 5H8FB 1AL3A 4LQ2A 4R75A 4ZEBA 2YPNA 4NF5A 3FD3A 2OX3A 2Q2CA 2QMXA 5AA4B 3V83A 5H8QB 5DEXB 3C36A 2XD3A 1Z7NE 4R9FA 4U4SA 5I57A 3T9HB 3IO6A 4PAKA 2Y7KA 3RT8A 2OWZA 3ZSFA 3UGWA 3A29A 4YKJA 5M2VA 4ZEFA 3O9PA 4OFJA 1NV0A 3TMGA 1D9YA 2M8CA 5ELVA 5CMMA 4EXKA 1YAEA 2OLBA 4DXBA 1QUIA 2ONSA 2O7UA 1QKBA 4R2FA 2V3UA 1A54A 1NUZA 4YKPA 4PBQA 3BFUA 3FATA 3RTFB 5A5XA 2B4MA 4OERA 4MLVA 5AE4A 3HHFA 4TLLB 1S9TA 2YLNA 2OWSA 1INPA 1O63A 4X1BA 4THIA 4XEQA 4FEBA 1OVTA 1LBBA 1MPBA 4FAJA 1B4ZA 3DELB 1GTKA 4X9TA 3RT6B 2P2AA 3IB0A 3O6GA 2D5WA 3IJXB 3PPOA 5TP9A 3EN3A 1MQHA 4NGUA 1D3KA 4HXVA 3RTWB 5AA2D 4X04A 5ET6A 4F3PA 1US5A 1Y1ZA 3QAXA 2R8TA 2KQZA 4NEDA 4ESWA 4OA4A 3K01A 1N3WA 1IMFA 2F3DA 3N26A 1LCFA 3K6UA 4XIGQ 3SZPA 1LAHE 4IGTA 4LVQA 1MQJA 2QS4A 3JZJA 2XXKA 3PUYE 2F3BA 2CZLA 2RF1A 1ZLQA 3DLNA 2VD2A 4O3BA 4U4XA 5ITPA 5CI5A 4GQOA 4G2ZA 3MVZA 1FQCA 2HHMA 1M5CA 1NNKA 3B6QA 1B9JA 3TTKA 2I4BA 1Q1KA 3GYYA 2AYSA 4YB6A 4DCXA 4HTGA 1P1WA 3G3JA 4PETA 5EHSA 4N6KA 1MY1A 1TFDA 3K1NA 5EQ7A 3RQTA 4KCDA 2VOZA 4P56A 4N6PA 3K6WA 4GF8A 2HAVA 3VFJA 2ZNSA 3OELA 1IXCA 1ZTYA 3KJ7A 4PF8A 1IUDA 4YZZA 5IM2A 4UACA 5IZ3A 1FQAA 4YAHX 3CFLA 2DS9A 4GX4A 1SYHA 4N07A 3ROJA 4O8MA 1R9LA 3Q27A 3MVYA 3W9WA 3MW0A 2HXRA 4QFNA 1MPCA 5IZZA 4RJZA 5HM4B 3TCFA 1JETA 1DTZA 5DW8A 4ELRA 1BKAA 3K02A 1LLSA 1B3HA 1BK4A 4OXVA 3N6TA 4P8BA 3KN8A 4ISUA 3I3VA 1RYOA 3O2AA 3ZKLA 2PT2A 2XX9A 3BFTA 1PBPA 3OO7A 5DYHA 5TU0A 2Z8DA 3MJNA 3W15C 4MNIA 4PBHA 3MP8A 3VXCA 5A5LA 1FJ6A 5I58A 4MLQA 5HPQA 4LZ5A 1XC1A 4XKQA 5KCJB 2NUVA 3FV1A 5FHMA 2R9JA 1B3GA 5H8NA 1ZJLA 3H6VA 4EUOA 4G8HA 1FQFA 4M4GA 5I3SA 4YICA 4EF2A 3IOVA 1Y4TA 5H8FA 4NF4B 1OMPA 1AMFA 1YZ0A 3O6HA 2PVUA 1NH7A 1MXVA 1B6HA 1GVCA 2I0CA 5H8QA 5DEXA 2THIA 2F8DA 3FJMA 4O7MA 2DE2A 3QUFA 4LZ7A 3H6WA 2V3TA 1NV5A 2Q8MA 1Y4CA 4POXA 1PB9A 3MWBA 1EU8A 3H06B 3VDFA 5AA3A 2OWTA 2FVZA 4OETA 5DT6A 3KBZA 2CEXA 4IB2A 1FPEA 2HFBA 2ZYOA 1URDA 3UP9A 4ZZEA 3SERA 3MP6A 4IO3A 1US4A 3QIMA 4AB6A 1O7TA 3JV9A 3R7XA 5IGAA 3OEKA 5ITOA 3CSBA 4ZZAA 2RC8A 4KHZE 4KCCA 2NXOA 3BIHA 5ET5A 4NAPA 2FYIA 3AXFA 2I3WA 4MJOA 4GBVA 1MH4A 4PFBA 4GFRA 5H8HB 2L5VA 4JWOA 2GHBA 3KJTA 3T9VA 2B3FA 4F19A 3SETA 4FE8A 3IO4A 3RY3A 1FPJA 3QMFA 2Y7IA 1BLFA 4ZEDA 4YMAA 2WYKA 3K1PA 4DDDA 4DI3D 1MS7A 2AL4A 1TWYA 4EQBA 4WEDA 5ET8A 3U65A 1EH3A 2MKZA 1FPKA 1D9QA 5ICTA 3FVGA 1URGA 4QSEA 2Y5LA 1RDXA 5I2KB 5ISUA 1PBQA 3RUMA 1SDXA 1OQHA 3KZGA 4PFUA 4I62A 2UVJA 1QUKA 3DP6A 3D4GA 2I0BA 2Q2AA 4NWCA 3CFXA 3PPRA 1ZMGA 4H45A 3L6GA 4H6DA 1UIUA 4RYAA 1Y3NA 2Q74A 4ZEIA 3S4UA 2B4LA 3TEPA 4O7IA 4OVJA 1VR5A 4OFLA 5TPAA 4YB7A 1RKMA 3A09A 1XT8A 4GWOA 4XF5A 1SI1A 3OO9A 2XXHA 1NV2A 2UVIA 3O29A 4I40A 3QXMA 1MDP1 3TELA 4N91A 3S2VA 3K0VA 5K2XA 3NOHA 4BDLA 1FQEA 4OEVA 4NQ8A 1SYIA 4JB7A 1B1XA 1P1QA 4G77A 1D9VA 1NUXA 4F3GA 3S9NC 1EYIA 4RPNA 1J1NA 1LEVA 3I5OA 3IFAA 3PPNA 4F29A 3TTLA 3CR9A 2OBGA 3H6UA 3OXNA 1NV7A 3M3FA 4P0IA 1MQGA 3A3UA 1A8EA 4BDMA 3MQ9A 1CE2A 3UIFA 3KSXA 1ZBMA 4RXLA 2Z23A 3LSLA 4X8RA 1FBGA 2R71A
chains in the Genus database with same CATH topology
4NGUA 3E79A 4HXVA 4X04A 5ET6A 1JP4A 2WBBA 5EYGA 1QGXA 3W9VA 2R8TA 2KQZA 2FIEA 4IR8A 4OA4A 1DK4A 1IMFA 4NG7A 2F3DA 5LDZA 4F1UA 3SZPA 2F5XA 2XXKA 4PC9A 1FPIA 3KC0A 2WX9A 2F3BA 4HCWA 4N81A 4N15A 2XWOA 5JK4A 4P1EA 2DE4A 3HFUA 5EQAA 1NUWA 3PTYA 4JVDA 4F18A 4PAFA 1XI6A 2HHMA 3KC1A 4MNCA 1FBEA 1FBDA 4QBAA 3FBPA 1Q9DA 4OVRA 3GYYA 4PCDA 2QFLA 4GX3A 2CZKA 3EKIA 1IMBA 1IMEA 4PETA 4P1LA 4N6KA 5EQ7A 1KZ8A 5T3JA 4P56A 2HZLA 1FBPA 1IMDA 4P47A 1K9YA 4N4UA 4HE2A 3B50A 3RYDA 4PF8A 5J1DA 4YZZA 5EYHA 2QVVA 5IM2A 4N8YA 5IZ3A 4PFIA 3LV0A 3RPLA 4MNPA 1FRPA 4GX4A 4JVIA 4O94A 3ROJA 3LUZA 4I3EA 4O8MA 1FBHA 3W9WA 2HXRA 3D1RA 2ZZVA 5IZZA 4GWZA 4KXPA 3ISPA 5DW8A 1BK4A 1EYJA 1FPFA 4UABA 4P8BA 1FSAA 1NV4A 2PFZA 4MX6A 2FBPA 4OANA 4NF0A 4GWXA 5I5PA 2FHYA 1FBFA 2VT5A 2DDKA 1YYZA 4F1VA 3T1BA 2Q9TA 1FPLA 4GX6A 4MNIA 1FBCA 4PBHA 1NV6A 2VPNA 5A5LA 1FJ6A 3CHGA 1G0HA 1FPBA 5IZ1A 1IMAA 2V4CA 4G61A 2WBDA 4GWSA 3MSTA 2VPOA 1LBWA 4PGNA 4XFEA 5J16A 5I3SA 1YXIA 4YICA 2WEFA 4HE0A 1YZ0A 5I7IA 4HE1A 1FTAA 4P9KA 1AWBA 4PGPA 2DVZA 2ZZWA 1EYKA 2XWKA 5IZ3B 4O7MA 2DE2A 3RPLB 4OVSA 1NV5A 4GWUA 1K9ZA 5F24A 2Q8MA 2BJIA 4PDHA 4GWWA 1NUYA 2FVZA 3KBZA 2CEXA 1FPEA 2PFYA 1FJ9A 4AS5A 4QXDA 4MIJA 4PAIA 2QPQA 2XWIA 2P3NA 5IGAA 2Y5KA 3BIHA 4NX1A 5ET5A 4H46A 4NAPA 4GBWA 4GWYA 4MJOA 4GBVA 4N17A 4PFBA 1LBXA 1SPIA 2L5VA 4M1VA 4MCOA 2QVRA 4N8GA 5CM6A 4PTKA 2DE3A 4N6DA 4P3LA 4F19A 2CZIA 1IMCA 1FPGA 4NHBA 2CEYA 1RDZA 1FPJA 3QMFA 3T0JA 4OVQA 2PCRA 2WYKA 4DI3D 5ET8A 1NI9A 2FIXA 2MKZA 3U65A 1FPKA 1D9QA 2Y5LA 1RDXA 4I3YA 1LBVA 1FPDA 5ET7A 2WYPA 2GQ1A 1CNQA 4JVCA 2CZHA 2JJKA 2OX3A 5EQ8A 4MMPA 4H45A 4PAKA 4PDDA 2XA5A 3E78A 2OWZA 3MYUA 2KR0A 3A29A 4PF6A 2Q74A 2P3VA 2B4LA 4O7IA 1NV0A 2ZZXA 1NV3A 1KA1A 4DI4B 4XF5A 5EQ9A 4HCYA 4OVPA 1NV2A 1DCUA 4NN3A 4I40A 1G0IA 2HZKA 4N91A 1NV1A 4MHFA 5FBPA 1NUZA 1LBYA 1LBZA 2QVUA 3B8BA 4PBQA 3NOHA 1VDWA 2V3QA 3FXBA 4NQ8A 2B4MA 4PFRA 1RDYA 1NUXA 1INPA 1EYIA 1LEVA 4XEQA 4FBPA 4MEVA 3IFAA 4X9TA 4LN5A 5LTCA 2XWVA 1NV7A 4PE3A 2HPGA 3IFCA 4OVTA 3BIGA 4MAGA 1KA0A 5ESYA 4X8RA 1FBGA 1DBZA 4AS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XWK A;  4NGU A;  4O8M A;  4O7M A;  4OVS A;  4X04 A;  2ZZV A;  5IZZ A;  4MMP A;  4PDH A;  4OA4 A;  4PAK A;  4PDD A;  2XA5 A;  4NG7 A;  2CEX A;  4PF6 A;  2PFY A;  4UAB A;  4P8B A;  2PFZ A;  4MX6 A;  4MIJ A;  2XXK A;  4OAN A;  4PC9 A;  4NF0 A;  5I5P A;  2WX9 A;  2ZZX A;  4PAI A;  2XWI A;  4N15 A;  2XWO A;  4DI4 B;  5IGA A;  4P1E A;  4XF5 A;  4OVP A;  4NX1 A;  4NN3 A;  4NAP A;  4PAF A;  2HZK A;  4MNI A;  4N91 A;  4MHF A;  4MNC A;  4N17 A;  4PFB A;  4PBH A;  4MCO A;  2VPN A;  4N8G A;  4PBQ A;  5CM6 A;  4OVR A;  4N6D A;  4P3L A;  3GYY A;  3FXB A;  4PCD A;  4NQ8 A;  4NHB A;  2CEY A;  2V4C A;  4OVQ A;  4PET A;  4P1L A;  4PFR A;  4N6K A;  2WYK A;  4DI3 D;  2VPO A;  4PGN A;  4P56 A;  2HZL A;  4XFE A;  4XEQ A;  4MEV A;  4P47 A;  4N4U A;  4LN5 A;  4YIC A;  3U65 A;  2XWV A;  5LTC A;  3B50 A;  4PE3 A;  4PF8 A;  2HPG A;  4YZZ A;  5IM2 A;  5I7I A;  4N8Y A;  4PFI A;  2WYP A;  4OVT A;  4MNP A;  4P9K A;  4MAG A;  4PGP A;  4X8R A;  4O94 A;  2ZZW A; 
#chains in the Genus database with same CATH topology
 4WXJ A;  4KD5 A;  5FTI A;  4UA8 A;  3IR1 A;  1SQY A;  3S9M C;  2XXQ A;  1JP4 A;  5EYG A;  2YJP A;  5CRY A;  2FIE A;  1NH8 A;  3USD A;  2RC9 A;  1MPD A;  2I4C A;  4H1X A;  1DK4 A;  4IGR A;  1XHY A;  2FA7 A;  4PP0 A;  1P99 A;  2XX8 A;  1SW1 A;  3S9L C;  4R73 A;  1IZ1 A;  3OMB A;  3CI8 A;  3C33 A;  4PC9 A;  1FPI A;  2RKM A;  1NNF A;  1TFA A;  2XXX A;  4N81 A;  3IOR A;  3IJO B;  5JK4 A;  3KFM A;  4F2O A;  5JTY B;  4RY1 A;  2DXR A;  4PAF A;  1XI6 A;  2NWJ A;  4I8C A;  3KC1 A;  2I3V A;  1FBD A;  4XKR A;  3R6U A;  5KCJ A;  1B46 A;  4LP2 B;  4Q30 B;  4QBA A;  2NVU B;  4YB5 A;  4OVR A;  4PCD A;  2RCA A;  2QFL A;  3O66 A;  3MZ1 A;  3EKI A;  1FCK A;  4FJP A;  2V84 A;  3GLB A;  1DSN A;  1B5J A;  3G3H A;  1M5D A;  2HZL A;  1I6Q A;  4U1Z A;  2ALU A;  1A40 A;  3CIJ A;  1IMD A;  4P47 A;  1K9Y A;  4N4U A;  4OFO A;  1LFH A;  3PPQ A;  4FED A;  1B51 A;  1I6A A;  3RYD A;  1MXY A;  4WEP A;  5J1D A;  5DVJ A;  2QVV A;  1SBP A;  2WKY A;  3PUV E;  2GRV A;  4PFI A;  4PFW A;  4MNP A;  1FRP A;  5I2N B;  4HS7 A;  3GBB A;  3P7I A;  3OO8 A;  1B5I A;  3WAE A;  1SI0 A;  3QK6 A;  1QUL A;  3D1R A;  4GWZ A;  4POW A;  2XXU A;  3FZV A;  4LZ8 A;  4ZE9 A;  4MFI A;  1P1N A;  1KWH A;  2UVG A;  1Y20 A;  2O7I A;  1FSA A;  3KGC A;  1PB7 A;  2Y84 A;  1Q35 A;  1Y3Q A;  3CRB A;  5I5P A;  5BUU A;  3PUZ E;  1FBF A;  2H99 A;  4H5G A;  4F1V A;  5H8H A;  4PE5 B;  4PFY A;  4ECF A;  1S50 A;  2Q9T A;  4QF9 A;  4GX6 A;  4R9G A;  2Z8E A;  1LFG A;  4IO5 A;  2F97 A;  1NV6 A;  1QUJ A;  4OQO A;  2XXP A;  4XTC Q;  3KG2 A;  2A5S A;  4LAT A;  1H3D A;  2B65 A;  4Z7E A;  1B3F A;  4R6K A;  1JEV A;  3UN6 A;  1IMA A;  4G61 A;  3QUJ A;  1BP5 A;  4DXU A;  4ESX A;  3MZB A;  3ILT B;  2VPO A;  3FJ7 A;  4GVO A;  3PMW A;  4PGN A;  2QRY A;  3F11 A;  1FTL A;  4ZS9 A;  5I2K A;  2PYY A;  3H7M A;  2XXV A;  1ELJ A;  2REJ A;  4WKM A;  2WEF A;  4QSD A;  2ZMB A;  4F31 B;  3V89 B;  4F3S A;  1UTH B;  4HE1 A;  1N04 A;  3ECR A;  1IXI A;  5FHO A;  2DVZ A;  3H03 A;  3N5L A;  2E0S A;  2XWK A;  1A55 A;  3RPL B;  4OVS A;  5AA2 B;  1MY3 A;  2ONR A;  2ZYK A;  3BKI B;  5KZT A;  2OCU A;  1K9Z A;  3T9X B;  4R72 A;  2BJI A;  4RK2 A;  3PV0 E;  1NUY A;  2F7C A;  3M3L A;  4GRK A;  4G4P A;  2H4I A;  4QXD A;  3OSR A;  4GLI A;  1P1O A;  1OLA A;  2XWI A;  3A3C A;  2G29 A;  2QS1 A;  1FTK A;  2UYF A;  5EYF A;  3QYT A;  4QHQ A;  3MPL A;  4OEN A;  2Y5K A;  2F6P A;  4Q5T A;  1LB8 A;  3O28 A;  2KLF A;  3SEU A;  5K2Y A;  4GXA A;  4TQU Q;  4GXS B;  3G7W A;  1DTG A;  1YCJ A;  4M1V A;  4MCO A;  2QVR A;  1CB6 A;  2O51 A;  5KDT B;  3U1O A;  4GOT A;  2DE3 A;  1WOD A;  3FUZ A;  3MZ9 A;  1MRP A;  1RDZ A;  2FNC A;  3T0J A;  4OVQ A;  3TDJ A;  2PCR A;  4KI0 E;  4X1D A;  4K3F A;  5ICQ A;  2CMO A;  1GR2 A;  4MBP A;  1FTJ A;  4DZ1 A;  4EDP A;  4LQ5 A;  4GD5 A;  1IXG A;  3GZG A;  3DP8 A;  5BWJ A;  2O68 A;  2FIX A;  3FVK A;  2O1M A;  4HW8 A;  4G8N A;  5CMB A;  1FPD A;  5ET7 A;  2NOO A;  5CMC A;  2RC7 A;  3FVN A;  2GQ1 A;  1TT1 A;  5I57 B;  4ZEK A;  1IIT A;  4QRZ A;  2CZH A;  2JJK A;  2BJJ X;  4U21 A;  4AQ4 A;  1ATG A;  3C9H A;  4R6Y A;  3MC2 A;  2VP1 A;  4MMP A;  2XXY A;  4QFP A;  5HBC A;  4P11 A;  1YTV A;  2XA5 A;  3U92 A;  2XD2 A;  3E78 A;  4JWY A;  1ZIU A;  3MYU A;  5AA4 A;  3EHU A;  4PF6 A;  1TXF A;  3CG1 A;  2P3V A;  2F78 A;  1FTM A;  3EPE A;  5I56 B;  2F6G A;  3MAM A;  5L9S A;  1QVS A;  1PDA A;  1MH3 A;  3N94 A;  1MM6 A;  1POT A;  4DI4 B;  5EQ9 A;  4OVP A;  2DYX A;  1FTO A;  4NN3 A;  1NFT A;  1JVX A;  4F2Q A;  1VFE A;  4MHF A;  5FBP A;  3TTR A;  4H65 A;  1MXW A;  2QVU A;  4OMB A;  3B8B A;  1B5H A;  2UYE A;  1FQD A;  1VDW A;  3G3I A;  4Q8R A;  1A99 A;  3G3F A;  1UIV A;  4YKK A;  1IEJ A;  3LSW A;  5F1Q A;  3TQW A;  1Y1M A;  4PFR A;  1RDY A;  3LBS A;  3SDF A;  1B7U A;  4AB5 A;  5TP9 B;  4FBP A;  3PUW E;  3IOW A;  3EQ1 A;  3FJG A;  4LN5 A;  5LTC A;  4PE3 A;  3TZA A;  1MM7 A;  3B7D A;  5I2N A;  1B05 A;  2I58 A;  3IFC A;  5CBR A;  2DWH A;  1KA0 A;  1B7Z A;  1LBZ A;  1DBZ A;  4NTL A;  1Z7M E;  3B6W A;  1B0H A;  1LGB C;  4ELQ A;  1QGX A;  2HQ0 A;  3W9V A;  3GBA A;  2DWA A;  3VLU A;  3TUS A;  4LUB A;  4NG7 A;  3SKP A;  1A7L A;  2I48 A;  3KN7 A;  4F1U A;  3UA8 A;  1Y9U A;  3KC0 A;  4KYE A;  2WX9 A;  2DSF A;  3O6I A;  2DVC A;  1P1U A;  1IQ7 A;  3EHT A;  1I6B A;  4FIM A;  2Q89 A;  2OZZ A;  3KN3 A;  4PFT A;  5CMK A;  2Z22 A;  1IXH A;  1MXU A;  4JDF A;  3U93 A;  4ONY A;  4F18 A;  4C1T A;  2QSX A;  4JBZ A;  3KOS A;  1MXZ A;  1FBE A;  1R6Z A;  1B0L A;  1N3X A;  2ABH A;  2CZK A;  4O3A A;  1IMB A;  4P1L A;  1EZ9 A;  1FQB A;  2HXW A;  1Y3P A;  2ZXT A;  1A8F A;  1POY 1;  3IOT A;  4BDO A;  3B50 A;  1UTH A;  4RNS A;  5B70 A;  4C1U A;  2PT1 A;  1B2H A;  1DPP A;  1BIY A;  5IAI A;  2A5T B;  3M3K A;  4ZEC A;  3OSQ A;  4U2R A;  1UTB B;  3RPL A;  2RCB A;  3SEX A;  5AA2 A;  4JVI A;  1N84 A;  2H25 A;  4O94 A;  2OK2 A;  1N7W A;  1FBH A;  1D4N A;  3JYR A;  4KXP A;  4EXL A;  3KOT A;  3ISP A;  4DLD A;  2UVH A;  4XXU A;  4JSO A;  4OZ9 A;  2REG A;  4UAB A;  1NV4 A;  3E9X A;  3K00 A;  3HST A;  4NF0 A;  4IO7 A;  2FHY A;  2X7P A;  1QW0 A;  3PD8 A;  4NE4 A;  5I84 A;  3Q29 A;  1R9Q A;  1H44 A;  3C4M A;  3TOD A;  5KDT A;  2V25 A;  3T22 A;  4LON B;  2DOJ A;  1HSJ A;  3LSX A;  3WAF A;  1HSL A;  1B52 A;  1DOT A;  3RPW A;  3TCH A;  3CHG A;  1SVX B;  3FVO A;  1NNP A;  3LUY A;  1G0H A;  1FPB A;  4BDN A;  2F7B A;  5IZ1 A;  4R6H A;  2IA4 A;  2WBD A;  3RNN A;  2IEE A;  3ODB A;  4G8M A;  3RN8 A;  1M5E A;  3CFZ A;  3SEY A;  4XFE A;  5J16 A;  3TQL A;  2O84 X;  4G68 B;  5I59 B;  1GV8 A;  4QSC A;  4HE0 A;  4H0W A;  1MQI A;  4ELO A;  3H4Z A;  3ZS6 A;  4GIZ A;  1LBC A;  1B3E A;  2DWI A;  1IIW A;  4Z0I A;  3OEN A;  3TCG A;  3K6V A;  3TKD A;  5EHM A;  3V5A A;  4NF4 A;  4XKP A;  4GWU A;  2Y7P A;  4DCY A;  1LAG E;  3TPA A;  2LAO A;  4PDH A;  4RK9 A;  5CC2 A;  2X26 A;  3HV1 A;  3UK4 A;  4YU0 A;  3DP4 A;  5I56 A;  4LA9 A;  2PFY A;  3UOR A;  1FJ9 A;  5L9M A;  4IO4 A;  4AS5 A;  4MIJ A;  3SES A;  3PU5 A;  1JVY A;  4PAI A;  3ZKK A;  2QPQ A;  2P3N A;  4Q0C A;  3M8U A;  3PMV A;  1NL5 A;  3O97 A;  3HN0 A;  4F39 A;  3MVW A;  4KYD A;  4H46 A;  1XOC A;  3DM0 A;  1L5T A;  3MUQ A;  4N17 A;  4MH5 A;  4OES A;  2PX1 A;  3VVF A;  3K4U A;  4NF8 B;  3U72 A;  3QSL A;  4N6D A;  2PBW A;  2VD3 A;  2CZI A;  4R2B A;  1FPG A;  5F7V A;  4NHB A;  2CEY A;  5FTH A;  3MVX A;  1N7X A;  3EF7 A;  3FGS A;  3L6H A;  3Q25 A;  1SW4 A;  4GL0 A;  3E4R A;  3C31 A;  4FAT A;  1LFI A;  2F7A A;  4ELP A;  3EHS A;  1H76 A;  3FXQ A;  3H6T A;  2F36 A;  3U8Q A;  1NI9 A;  5AA1 A;  4XKN A;  4I3Y A;  1LBV A;  1MY2 A;  5IKB A;  1RYX A;  1WDN A;  3KEI A;  1MDQ A;  1NNT A;  2WYP A;  1PB8 A;  1CNQ A;  3LR1 A;  3IOU A;  1LAX A;  4JVC A;  4TLM B;  2QJE A;  4JSD A;  3TTN A;  2OJT A;  5EQ8 A;  4JWX A;  1JW5 A;  1AH5 A;  1MY4 A;  3K6X A;  4QFK A;  2QS3 A;  1XVX A;  1LST A;  5TPA B;  1JEU A;  3TFL A;  3U94 A;  3LC8 A;  4PDD A;  3G3K A;  3MP1 A;  2H98 A;  2KR0 A;  4NWD A;  2B3B A;  2ZNU A;  3R26 A;  1VE4 A;  2XXW A;  2Y7W A;  4KPT A;  1B40 A;  2ZZX A;  1NV3 A;  1MQD A;  5LOM A;  1KA1 A;  1YPN A;  5L9O A;  4HCY A;  4F22 A;  2HCA A;  4ND9 A;  3D4C A;  1GGG A;  1DCU A;  1SW2 A;  4EQ9 A;  2XXR A;  1G0I A;  2HZK A;  1NV1 A;  2G93 A;  4E0X A;  1LBY A;  4EQ7 A;  2AL5 A;  1VSO A;  2PMS A;  2V3Q A;  3FXB A;  2UXA A;  2D21 A;  3G3G A;  3CG3 A;  3S9E A;  3HPI A;  4MEV A;  3IB1 A;  2A5T A;  4NF6 B;  1B4H A;  2XWV A;  1USY H;  2Y7R A;  4GL8 A;  1UTB A;  2H5Y A;  4U22 A;  1OVB A;  2HPG A;  4OVT A;  3BIG A;  4MAG A;  5ESY A;  3VLV A;  4AS4 A;  3MPK A;  3E79 A;  3GXA A;  1O64 A;  4OEU A;  3SEW A;  4DIG A;  2ONK E;  4NF5 B;  4OWD A;  2WBB A;  1LB9 A;  1AIV A;  2XXI A;  3HO7 A;  4IR8 A;  4C0R A;  1II5 A;  3K2D A;  2ANJ A;  3IAZ A;  4DE8 A;  4ZDM A;  3ILU B;  2VHA A;  5LDZ A;  3C35 A;  1R1N A;  2F5X A;  4QFL A;  1EZO A;  1QJM A;  2QS2 A;  2GH9 A;  3THI A;  2QL3 A;  4HCW A;  4N15 A;  2XWO A;  4H67 A;  3Q26 A;  3OD7 A;  4BLA A;  2DWJ A;  4P1E A;  1OQG A;  4NMY A;  2DE4 A;  1S7Y A;  3HFU A;  4EF1 A;  5EQA A;  1JW1 A;  1NUW A;  3PTY A;  4JVD A;  3B6T A;  3IL1 B;  1OIB A;  2ZYM A;  1OLC A;  1XVY A;  4MNC A;  1LAF E;  1AOV A;  4PQJ A;  1ZKB A;  3IK6 B;  5JTY A;  3FBP A;  1Q9D A;  2ZNT A;  4N13 A;  3FAS A;  3T9U A;  4GX3 A;  4X48 A;  1QKA A;  1USY E;  1IME A;  2X7Q A;  3V8X B;  3RGY A;  1KZ8 A;  5T3J A;  3TTM A;  4G68 A;  5I59 A;  5A5X B;  1MY0 A;  2P1S A;  1FBP A;  3TYH A;  4OYV A;  3FXU A;  2AIX A;  4HE2 A;  3HHG A;  3LSF B;  4KYS A;  1B32 A;  5EYH A;  2V93 A;  4N8Y A;  1HSE A;  3T96 B;  1LCT A;  3LV0 A;  3FXR A;  2ESN A;  2F34 A;  4KFQ A;  4I1D A;  3LUZ A;  4I3E A;  3PUX E;  4KQP A;  4F3B A;  2RIN A;  1B1H A;  2ZZV A;  2F35 A;  3BBR A;  1H45 A;  4P0G A;  4JXI A;  2I6E A;  5CBS A;  2R6G E;  3OO6 A;  1DPE A;  3ONM A;  3SEV A;  1F9B A;  3KBR A;  1EYJ A;  1SD3 A;  1FW0 A;  3VVE A;  1FPF A;  4F1Y A;  4OTE A;  3T93 B;  2Z8F A;  2PFZ A;  3H3G A;  2P0S A;  1EZP A;  4MX6 A;  2FBP A;  4OAN A;  4KR5 A;  4GWX A;  1N0T A;  1MG1 A;  1H43 A;  2D3I A;  1ZU0 A;  3CSG A;  1JW4 A;  2VT5 A;  2DDK A;  3FIR A;  1YYZ A;  2Q8J A;  2O69 A;  4YMB A;  3T1B A;  1I69 A;  5FHN A;  1JQF A;  4O3C A;  3TAJ A;  1FPL A;  5L8D A;  4NF8 A;  1FBC A;  2XXT A;  1MXX A;  1B3L A;  2VPN A;  1WVJ A;  3PMX A;  4R74 A;  4IY5 A;  3VXB A;  4DXC A;  3E3K A;  2O6A A;  4RA1 A;  4I9D A;  2V4C A;  2DQV A;  4MF3 A;  4GWS A;  3MST A;  1JNF A;  1NKX A;  1M5F A;  4OHN A;  1LBW A;  3I6V A;  1YXI A;  1NMU A;  4FEC A;  1ANF A;  3RLF E;  3PPP A;  1M5B A;  1SW5 A;  3C34 A;  4TOZ A;  5I7I A;  4H8J A;  4ZE8 A;  4BDQ A;  1FTA A;  4P9K A;  1AWB A;  2O1L A;  4PGP A;  2DXY A;  2ZZW A;  1EYK A;  3VV5 A;  5IZ3 B;  5DVI A;  3MBP A;  5DTB A;  5F24 A;  3E13 X;  3C32 A;  1URS A;  2W7Y A;  5JEI A;  4GWW A;  1BTJ A;  2GHA A;  1UQW A;  2HAU A;  4U23 A;  1PEB A;  4YKI A;  3PD9 A;  3N6U A;  1T0K A;  3HCQ A;  1XS5 A;  3KSJ A;  2DP8 A;  4IO2 A;  1N76 A;  4E0W A;  4FOR A;  4G68 C;  3FV2 A;  3CVG A;  4QFO A;  2HEU A;  3VLW A;  2E1S A;  1PC3 A;  1VFD A;  5H8S A;  2XX7 A;  2VGQ A;  4IY6 A;  4NX1 A;  2GFE A;  3Q28 A;  3VVD A;  4GBW A;  4GWY A;  3IB2 A;  1LBX A;  1SPI A;  4L17 A;  2XHD A;  3K1M A;  4BDR A;  4N8G A;  5CM6 A;  4PTK A;  5DVF A;  2H9B A;  2QMW A;  4P3L A;  1IMC A;  3IX1 A;  3OOA A;  2I49 A;  5I58 B;  4H8I A;  5B7D A;  4RPO A;  3OEM A;  4IO6 A;  4H5F A;  4NF6 A;  3T66 A;  1B58 A;  1DMB A;  5H8N B;  1B7H A;  4U1O A;  3VE1 B;  2Q88 A;  2ZYN A;  3PGF A;  5H8F B;  1AL3 A;  4LQ2 A;  4R75 A;  4ZEB A;  2YPN A;  4NF5 A;  3FD3 A;  2OX3 A;  2Q2C A;  2QMX A;  5AA4 B;  3V83 A;  5H8Q B;  5DEX B;  3C36 A;  2XD3 A;  1Z7N E;  4R9F A;  4U4S A;  5I57 A;  3T9H B;  3IO6 A;  4PAK A;  2Y7K A;  3RT8 A;  2OWZ A;  3ZSF A;  3UGW A;  3A29 A;  4YKJ A;  5M2V A;  4ZEF A;  3O9P A;  4OFJ A;  1NV0 A;  3TMG A;  1D9Y A;  2M8C A;  5ELV A;  5CMM A;  4EXK A;  1YAE A;  2OLB A;  4DXB A;  1QUI A;  2ONS A;  2O7U A;  1QKB A;  4R2F A;  2V3U A;  1A54 A;  1NUZ A;  4YKP A;  4PBQ A;  3BFU A;  3FAT A;  3RTF B;  5A5X A;  2B4M A;  4OER A;  4MLV A;  5AE4 A;  3HHF A;  4TLL B;  1S9T A;  2YLN A;  2OWS A;  1INP A;  1O63 A;  4X1B A;  4THI A;  4XEQ A;  4FEB A;  1OVT A;  1LBB A;  1MPB A;  4FAJ A;  1B4Z A;  3DEL B;  1GTK A;  4X9T A;  3RT6 B;  2P2A A;  3IB0 A;  3O6G A;  2D5W A;  3IJX B;  3PPO A;  5TP9 A;  3EN3 A;  1MQH A;  4NGU A;  1D3K A;  4HXV A;  3RTW B;  5AA2 D;  4X04 A;  5ET6 A;  4F3P A;  1US5 A;  1Y1Z A;  3QAX A;  2R8T A;  2KQZ A;  4NED A;  4ESW A;  4OA4 A;  3K01 A;  1N3W A;  1IMF A;  2F3D A;  3N26 A;  1LCF A;  3K6U A;  4XIG Q;  3SZP A;  1LAH E;  4IGT A;  4LVQ A;  1MQJ A;  2QS4 A;  3JZJ A;  2XXK A;  3PUY E;  2F3B A;  2CZL A;  2RF1 A;  1ZLQ A;  3DLN A;  2VD2 A;  4O3B A;  4U4X A;  5ITP A;  5CI5 A;  4GQO A;  4G2Z A;  3MVZ A;  1FQC A;  2HHM A;  1M5C A;  1NNK A;  3B6Q A;  1B9J A;  3TTK A;  2I4B A;  1Q1K A;  3GYY A;  2AYS A;  4YB6 A;  4DCX A;  4HTG A;  1P1W A;  3G3J A;  4PET A;  5EHS A;  4N6K A;  1MY1 A;  1TFD A;  3K1N A;  5EQ7 A;  3RQT A;  4KCD A;  2VOZ A;  4P56 A;  4N6P A;  3K6W A;  4GF8 A;  2HAV A;  3VFJ A;  2ZNS A;  3OEL A;  1IXC A;  1ZTY A;  3KJ7 A;  4PF8 A;  1IUD A;  4YZZ A;  5IM2 A;  4UAC A;  5IZ3 A;  1FQA A;  4YAH X;  3CFL A;  2DS9 A;  4GX4 A;  1SYH A;  4N07 A;  3ROJ A;  4O8M A;  1R9L A;  3Q27 A;  3MVY A;  3W9W A;  3MW0 A;  2HXR A;  4QFN A;  1MPC A;  5IZZ A;  4RJZ A;  5HM4 B;  3TCF A;  1JET A;  1DTZ A;  5DW8 A;  4ELR A;  1BKA A;  3K02 A;  1LLS A;  1B3H A;  1BK4 A;  4OXV A;  3N6T A;  4P8B A;  3KN8 A;  4ISU A;  3I3V A;  1RYO A;  3O2A A;  3ZKL A;  2PT2 A;  2XX9 A;  3BFT A;  1PBP A;  3OO7 A;  5DYH A;  5TU0 A;  2Z8D A;  3MJN A;  3W15 C;  4MNI A;  4PBH A;  3MP8 A;  3VXC A;  5A5L A;  1FJ6 A;  5I58 A;  4MLQ A;  5HPQ A;  4LZ5 A;  1XC1 A;  4XKQ A;  5KCJ B;  2NUV A;  3FV1 A;  5FHM A;  2R9J A;  1B3G A;  5H8N A;  1ZJL A;  3H6V A;  4EUO A;  4G8H A;  1FQF A;  4M4G A;  5I3S A;  4YIC A;  4EF2 A;  3IOV A;  1Y4T A;  5H8F A;  4NF4 B;  1OMP A;  1AMF A;  1YZ0 A;  3O6H A;  2PVU A;  1NH7 A;  1MXV A;  1B6H A;  1GVC A;  2I0C A;  5H8Q A;  5DEX A;  2THI A;  2F8D A;  3FJM A;  4O7M A;  2DE2 A;  3QUF A;  4LZ7 A;  3H6W A;  2V3T A;  1NV5 A;  2Q8M A;  1Y4C A;  4POX A;  1PB9 A;  3MWB A;  1EU8 A;  3H06 B;  3VDF A;  5AA3 A;  2OWT A;  2FVZ A;  4OET A;  5DT6 A;  3KBZ A;  2CEX A;  4IB2 A;  1FPE A;  2HFB A;  2ZYO A;  1URD A;  3UP9 A;  4ZZE A;  3SER A;  3MP6 A;  4IO3 A;  1US4 A;  3QIM A;  4AB6 A;  1O7T A;  3JV9 A;  3R7X A;  5IGA A;  3OEK A;  5ITO A;  3CSB A;  4ZZA A;  2RC8 A;  4KHZ E;  4KCC A;  2NXO A;  3BIH A;  5ET5 A;  4NAP A;  2FYI A;  3AXF A;  2I3W A;  4MJO A;  4GBV A;  1MH4 A;  4PFB A;  4GFR A;  5H8H B;  2L5V A;  4JWO A;  2GHB A;  3KJT A;  3T9V A;  2B3F A;  4F19 A;  3SET A;  4FE8 A;  3IO4 A;  3RY3 A;  1FPJ A;  3QMF A;  2Y7I A;  1BLF A;  4ZED A;  4YMA A;  2WYK A;  3K1P A;  4DDD A;  4DI3 D;  1MS7 A;  2AL4 A;  1TWY A;  4EQB A;  4WED A;  5ET8 A;  3U65 A;  1EH3 A;  2MKZ A;  1FPK A;  1D9Q A;  5ICT A;  3FVG A;  1URG A;  4QSE A;  2Y5L A;  1RDX A;  5I2K B;  5ISU A;  1PBQ A;  3RUM A;  1SDX A;  1OQH A;  3KZG A;  4PFU A;  4I62 A;  2UVJ A;  1QUK A;  3DP6 A;  3D4G A;  2I0B A;  2Q2A A;  4NWC A;  3CFX A;  3PPR A;  1ZMG A;  4H45 A;  3L6G A;  4H6D A;  1UIU A;  4RYA A;  1Y3N A;  2Q74 A;  4ZEI A;  3S4U A;  2B4L A;  3TEP A;  4O7I A;  4OVJ A;  1VR5 A;  4OFL A;  5TPA A;  4YB7 A;  1RKM A;  3A09 A;  1XT8 A;  4GWO A;  4XF5 A;  1SI1 A;  3OO9 A;  2XXH A;  1NV2 A;  2UVI A;  3O29 A;  4I40 A;  3QXM A;  1MDP 1;  3TEL A;  4N91 A;  3S2V A;  3K0V A;  5K2X A;  3NOH A;  4BDL A;  1FQE A;  4OEV A;  4NQ8 A;  1SYI A;  4JB7 A;  1B1X A;  1P1Q A;  4G77 A;  1D9V A;  1NUX A;  4F3G A;  3S9N C;  1EYI A;  4RPN A;  1J1N A;  1LEV A;  3I5O A;  3IFA A;  3PPN A;  4F29 A;  3TTL A;  3CR9 A;  2OBG A;  3H6U A;  3OXN A;  1NV7 A;  3M3F A;  4P0I A;  1MQG A;  3A3U A;  1A8E A;  4BDM A;  3MQ9 A;  1CE2 A;  3UIF A;  3KSX A;  1ZBM A;  4RXL A;  2Z23 A;  3LSL A;  4X8R A;  1FBG A;  2R71 A; 
#chains in the Genus database with same CATH homology
 4NGU A;  3E79 A;  4HXV A;  4X04 A;  5ET6 A;  1JP4 A;  2WBB A;  5EYG A;  1QGX A;  3W9V A;  2R8T A;  2KQZ A;  2FIE A;  4IR8 A;  4OA4 A;  1DK4 A;  1IMF A;  4NG7 A;  2F3D A;  5LDZ A;  4F1U A;  3SZP A;  2F5X A;  2XXK A;  4PC9 A;  1FPI A;  3KC0 A;  2WX9 A;  2F3B A;  4HCW A;  4N81 A;  4N15 A;  2XWO A;  5JK4 A;  4P1E A;  2DE4 A;  3HFU A;  5EQA A;  1NUW A;  3PTY A;  4JVD A;  4F18 A;  4PAF A;  1XI6 A;  2HHM A;  3KC1 A;  4MNC A;  1FBE A;  1FBD A;  4QBA A;  3FBP A;  1Q9D A;  4OVR A;  3GYY A;  4PCD A;  2QFL A;  4GX3 A;  2CZK A;  3EKI A;  1IMB A;  1IME A;  4PET A;  4P1L A;  4N6K A;  5EQ7 A;  1KZ8 A;  5T3J A;  4P56 A;  2HZL A;  1FBP A;  1IMD A;  4P47 A;  1K9Y A;  4N4U A;  4HE2 A;  3B50 A;  3RYD A;  4PF8 A;  5J1D A;  4YZZ A;  5EYH A;  2QVV A;  5IM2 A;  4N8Y A;  5IZ3 A;  4PFI A;  3LV0 A;  3RPL A;  4MNP A;  1FRP A;  4GX4 A;  4JVI A;  4O94 A;  3ROJ A;  3LUZ A;  4I3E A;  4O8M A;  1FBH A;  3W9W A;  2HXR A;  3D1R A;  2ZZV A;  5IZZ A;  4GWZ A;  4KXP A;  3ISP A;  5DW8 A;  1BK4 A;  1EYJ A;  1FPF A;  4UAB A;  4P8B A;  1FSA A;  1NV4 A;  2PFZ A;  4MX6 A;  2FBP A;  4OAN A;  4NF0 A;  4GWX A;  5I5P A;  2FHY A;  1FBF A;  2VT5 A;  2DDK A;  1YYZ A;  4F1V A;  3T1B A;  2Q9T A;  1FPL A;  4GX6 A;  4MNI A;  1FBC A;  4PBH A;  1NV6 A;  2VPN A;  5A5L A;  1FJ6 A;  3CHG A;  1G0H A;  1FPB A;  5IZ1 A;  1IMA A;  2V4C A;  4G61 A;  2WBD A;  4GWS A;  3MST A;  2VPO A;  1LBW A;  4PGN A;  4XFE A;  5J16 A;  5I3S A;  1YXI A;  4YIC A;  2WEF A;  4HE0 A;  1YZ0 A;  5I7I A;  4HE1 A;  1FTA A;  4P9K A;  1AWB A;  4PGP A;  2DVZ A;  2ZZW A;  1EYK A;  2XWK A;  5IZ3 B;  4O7M A;  2DE2 A;  3RPL B;  4OVS A;  1NV5 A;  4GWU A;  1K9Z A;  5F24 A;  2Q8M A;  2BJI A;  4PDH A;  4GWW A;  1NUY A;  2FVZ A;  3KBZ A;  2CEX A;  1FPE A;  2PFY A;  1FJ9 A;  4AS5 A;  4QXD A;  4MIJ A;  4PAI A;  2QPQ A;  2XWI A;  2P3N A;  5IGA A;  2Y5K A;  3BIH A;  4NX1 A;  5ET5 A;  4H46 A;  4NAP A;  4GBW A;  4GWY A;  4MJO A;  4GBV A;  4N17 A;  4PFB A;  1LBX A;  1SPI A;  2L5V A;  4M1V A;  4MCO A;  2QVR A;  4N8G A;  5CM6 A;  4PTK A;  2DE3 A;  4N6D A;  4P3L A;  4F19 A;  2CZI A;  1IMC A;  1FPG A;  4NHB A;  2CEY A;  1RDZ A;  1FPJ A;  3QMF A;  3T0J A;  4OVQ A;  2PCR A;  2WYK A;  4DI3 D;  5ET8 A;  1NI9 A;  2FIX A;  2MKZ A;  3U65 A;  1FPK A;  1D9Q A;  2Y5L A;  1RDX A;  4I3Y A;  1LBV A;  1FPD A;  5ET7 A;  2WYP A;  2GQ1 A;  1CNQ A;  4JVC A;  2CZH A;  2JJK A;  2OX3 A;  5EQ8 A;  4MMP A;  4H45 A;  4PAK A;  4PDD A;  2XA5 A;  3E78 A;  2OWZ A;  3MYU A;  2KR0 A;  3A29 A;  4PF6 A;  2Q74 A;  2P3V A;  2B4L A;  4O7I A;  1NV0 A;  2ZZX A;  1NV3 A;  1KA1 A;  4DI4 B;  4XF5 A;  5EQ9 A;  4HCY A;  4OVP A;  1NV2 A;  1DCU A;  4NN3 A;  4I40 A;  1G0I A;  2HZK A;  4N91 A;  1NV1 A;  4MHF A;  5FBP A;  1NUZ A;  1LBY A;  1LBZ A;  2QVU A;  3B8B A;  4PBQ A;  3NOH A;  1VDW A;  2V3Q A;  3FXB A;  4NQ8 A;  2B4M A;  4PFR A;  1RDY A;  1NUX A;  1INP A;  1EYI A;  1LEV A;  4XEQ A;  4FBP A;  4MEV A;  3IFA A;  4X9T A;  4LN5 A;  5LTC A;  2XWV A;  1NV7 A;  4PE3 A;  2HPG A;  3IFC A;  4OVT A;  3BIG A;  4MAG A;  1KA0 A;  5ESY A;  4X8R A;  1FBG A;  1DBZ A;  4AS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...