4NAPA

Crystal structure of a trap periplasmic solute binding protein from desulfovibrio alaskensis g20 (dde_0634), target efi-510102, with bound d-tryptophan
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
308
structure length
308
Chain Sequence
PVTLNYANFPPASTFPCIQMEQWAHEVRTRTRGKVDVLTYPGGTLLGARNMLRGVMSGQADIGCISLAYHPGVFPVMSVFELPLGFTSAEAASSVLWELYSGLRPAELERVKVLTMFTSAPSHFMTVTPVRSLRDLQGMEIRGAGTLSAILEKLGATPVSMPMPEVPEAVQKGIIKGLFTSLDVMKDMNFAEMTGHVTRADQAVYPFAVIMNREAWERLSPDVQQVLDGLAAEHAAWTGRYLDAHVQDSMRWAEEKHGVQVHTLPEEDIAAMRRSVQPLFDAWAQRAADKGADPDAVMRTVDALKAQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Desulfovibrio alaskensis
molecule tags Transport protein
molecule keywords Extracellular solute-binding protein, family 7
total genus 96
structure length 308
sequence length 308
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4napA00
4PETA 4OANA 2WYKA 3U65A 5I7IA 4PC9A 4P1EA 2XXKA 4NG7A 4NX1A 4LN5A 4P56A 4NGUA 2XA5A 4PDHA 4XF5A 4O8MA 2CEYA 4OVRA 4OVQA 4PGPA 4OA4A 4PAFA 4PE3A 3FXBA 2WYPA 4PDDA 4NHBA 4PAIA 4MMPA 4NAPA 5IGAA 2HZLA 4P1LA 2V4CA 4NF0A 4PBQA 4XEQA 4YZZA 4PFIA 4MAGA 3GYYA 2VPOA 4DI3D 5I5PA 4DI4B 4O94A 2XWVA 4P47A 4OVSA 4MCOA 4PGNA 2HZKA 4PBHA 4N6KA 4YICA 4N8YA 4N8GA 4PFRA 4PFBA 2XWOA 2HPGA 4OVTA 4MNIA 4MNPA 4O7MA 4X8RA 5CM6A 2ZZVA 2PFYA 2WX9A 4PCDA 4MIJA 4MEVA 4N17A 4NQ8A 2XWKA 4X04A 4MX6A 4N91A 4OVPA 2XWIA 4N4UA 4MHFA 2VPNA 2PFZA 5IZZA 4P8BA 4PAKA 4P9KA 3B50A 2CEXA 2ZZWA 4N15A 5LTCA 4PF8A 4MNCA 4P3LA 4NN3A 4UABA 2ZZXA 4PF6A 4XFEA 4N6DA 5IM2A
chains in the Genus database with same CATH superfamily
4NF4B 4BDNA 1YCJA 4Q5TA 1XI6A 4ELQA 3IB0A 5EYGA 2R6GE 2W7YA 5IZ3B 2M8CA 3C32A 4GWUA 4O8MA 4Z0IA 4XTCQ 3FV1A 3MVYA 4PTKA 2F6PA 1B3HA 4JVCA 2HFBA 4OERA 2CEYA 3SKPA 4OVQA 4LQ2A 4EDPA 1SW5A 4FEBA 2F6GA 3KN7A 4MMPA 4R6KA 5IGAA 2Z8EA 1Y3PA 3K1PA 4R72A 1DK4A 3VXBA 5ET5A 1MY3A 3K1MA 1ELJA 4LP2B 5CRYA 4F3BA 3TUSA 2RC7A 3RYDA 3TTMA 1B4ZA 1RKMA 3O9PA 3CHGA 4IO6A 2H99A 2Z23A 3C36A 1IXGA 4KYEA 2XXXA 1I6QA 3LUYA 3UP9A 4KHZE 3UK4A 4FATA 1IUDA 4PFWA 4O7MA 4ZEIA 1LAFE 3TQLA 2Y7PA 4PCDA 2H9BA 1A8EA 3KBZA 1B3FA 1NL5A 2VPNA 1A55A 3T9HB 4O7IA 1IEJA 2D21A 3QMFA 4RPNA 1VSOA 3B50A 3EKIA 3MP1A 4JB7A 1FBPA 3FVGA 4GWOA 3A3CA 5H8HB 3FD3A 2WYKA 2PT2A 1URSA 3D1RA 4JVDA 3TFLA 4R73A 3PMVA 4JWXA 4NWDA 4YU0A 1Y4TA 1N0TA 2FIEA 4F3SA 1B3GA 5DTBA 3E78A 1LBBA 1LBYA 2NWJA 1IXHA 1QGXA 1B3LA 3ONMA 1OLAA 3GBBA 1MQGA 4TQUQ 5I3SA 4NAPA 1B5JA 3SDFA 3M8UA 5EQAA 2PT1A 1DOTA 1Y3NA 3PPPA 3GYYA 1D9YA 1R9QA 2HQ0A 1XHYA 4F39A 2ZXTA 4RYAA 4AS5A 1NNKA 1LGBC 1OLCA 3R6UA 3W15C 3PD9A 2D5WA 4MNIA 5AA1A 3TCFA 3TCHA 3TEPA 1RDYA 4DIGA 5JEIA 2AL5A 3IX1A 5KDTB 1ZIUA 1A8FA 1IMFA 3FZVA 3TQWA 4F1UA 5ITOA 3RLFE 1N3XA 1B7HA 4QF9A 3T66A 3I3VA 4HE0A 4OMBA 4H67A 1FBEA 4QXDA 2H25A 3U1OA 3OSQA 2FBPA 1HSJA 1AWBA 4PC9A 4WXJA 1VFEA 5AA2B 4ZEFA 5EQ9A 2R71A 1A7LA 1QUIA 5B70A 4NG7A 1HSEA 2O1LA 3HHFA 2B65A 4P56A 1B6HA 4GF8A 1P1UA 4IO3A 4OFJA 2D3IA 2UVHA 1SW1A 4GFRA 4E0WA 2CZHA 5CI5A 3MVZA 4ELPA 4QFKA 5DVJA 1PEBA 4IGRA 3ZKKA 5H8FB 4R74A 3HV1A 4U4SA 5DVIA 3M3FA 4GD5A 4NEDA 1R1NA 2OWTA 3USDA 2F3DA 2ALUA 3IOTA 5I58A 4OVSA 1FBDA 3UGWA 3CI8A 2DOJA 1OQHA 2X7QA 4YMBA 3KC1A 2H98A 1PB7A 5HM4B 2F97A 3H06B 1FTMA 3H6TA 3K4UA 1Y3QA 2VP1A 5F7VA 4X04A 3IORA 5CMKA 2PFZA 5CC2A 2XXYA 4EUOA 4P9KA 3O2AA 3LBSA 3E9XA 4JWOA 5J16A 4OENA 1KWHA 4QBAA 4P3LA 1PBPA 2Q8MA 1MPBA 2PYYA 4F2OA 1LB8A 4OANA 1IIWA 2HAVA 1HSLA 3A09A 2P2AA 4N6PA 1SPIA 3N94A 1IXCA 3HN0A 5ET8A 2RKMA 2HHMA 2XA5A 1LFIA 1TFAA 1UTBB 1FPFA 2E0SA 4KCCA 4U1ZA 2UYEA 3QAXA 2CZLA 1MM7A 1FSAA 2ZYOA 3D4GA 1D3KA 3PUXE 1IMAA 4PDDA 4PAIA 2RF1A 3VV5A 3QXMA 5LOMA 1RYOA 3B7DA 4AS4A 4EF1A 1FBHA 3OOAA 2VPOA 4GQOA 5EHSA 3V5AA 3RTFB 1FTAA 5CBRA 5KZTA 4HXVA 5ELVA 1PDAA 2P0SA 3C33A 5DW8A 3RGYA 3VXCA 1NUXA 2VT5A 2NVUB 4YKPA 3BIGA 1MY1A 1LBWA 4MLVA 2UVGA 1FPEA 3T96B 1H45A 4DXUA 3MPLA 3K1NA 3VE1B 4AQ4A 1DPEA 3HO7A 4GIZA 1IMBA 1LAGE 1FPKA 1FTLA 3PPNA 3S9LC 3MVWA 3SEUA 4OHNA 2F35A 2O68A 2FHYA 4JVIA 4PETA 3K02A 2XX8A 3IAZA 4Z7EA 2UXAA 1JP4A 4FECA 3SEVA 4MFIA 4UACA 1FTOA 1EH3A 2ESNA 1B4HA 1EZPA 2P1SA 3QUFA 3G3GA 4KYSA 1NNTA 3KOSA 1UIUA 2OWSA 3FJ7A 2IA4A 3K6WA 1N04A 3V8XB 3C35A 1SYHA 3MP6A 3E79A 4BDQA 3MBPA 4GBWA 2NUVA 2DE2A 4O3CA 1SI0A 2VD3A 4KFQA 3FVNA 2THIA 1SVXB 3GLBA 2ZNSA 4P47A 4QSEA 1MY0A 4PBHA 1KA1A 2Y7WA 1FJ6A 1B5IA 4NF5B 4PFRA 3MWBA 3S9EA 1P1OA 1FBFA 4GRKA 3E3KA 4ZS9A 3C31A 4FEDA 3FBPA 1JQFA 2QS3A 1ZMGA 4YMAA 1PB8A 3RT8A 4I3YA 5AA4A 1IMCA 3B6TA 3K01A 4U2RA 5CMMA 5IZZA 3UIFA 1NUYA 2OBGA 2QS4A 1US5A 3BIHA 4NF6B 2QS1A 4I3EA 4XKRA 1P1NA 4QFNA 4NN3A 1B40A 3K2DA 4EXKA 2QVVA 2X26A 4H5GA 5IZ1A 1IQ7A 4OETA 3BFTA 4MJOA 1R9LA 2P3VA 5EHMA 2VD2A 3PU5A 3IOWA 3KN8A 1YYZA 3B6QA 4GLIA 1MQHA 1NI9A 2AL4A 4NF6A 3TDJA 4YB6A 3TMGA 4TLMB 3RY3A 5I84A 1DTZA 4IY6A 4OA4A 3JZJA 5L9OA 5ESYA 4YKKA 3U72A 2WKYA 4NTLA 2XXTA 3H6UA 3DLNA 4P1LA 4PQJA 4TOZA 3O6GA 4I62A 3HCQA 4RY1A 2GFEA 1H44A 3S9MC 4O94A 4GWWA 4HE2A 1H43A 2GH9A 4BDRA 3TCGA 1SBPA 2OCUA 3NOHA 1B0HA 1LSTA 5H8HA 2DE3A 4WEPA 2FIXA 2O84X 3L6GA 1D9QA 5A5XB 1B7UA 1LBXA 1NV0A 4ZECA 2F7AA 3ODBA 4LVQA 4NQ8A 4MX6A 4R2FA 1NV7A 5I57A 4NMYA 4R6YA 2FA7A 4R75A 2H4IA 4KD5A 5DT6A 3GBAA 1O64A 4LATA 2HCAA 1CE2A 5I59A 5A5XA 1MY4A 1G0HA 3O66A 4F2QA 4XFEA 4N6DA 3SEYA 4KI0E 1Y1MA 2KR0A 1URGA 2F3BA 3FV2A 3RT6B 3CIJA 4LQ5A 1B1XA 3C34A 1MPDA 4NGUA 4F18A 3FUZA 3PPOA 3VVEA 3LR1A 2I48A 2XXQA 3CFXA 1WDNA 2QFLA 4EXLA 1UIVA 1FBGA 4POWA 5ICTA 1FJ9A 1N76A 2Q9TA 5K2XA 1FTJA 4OFOA 4N81A 1JEUA 2HZLA 2XXVA 5L8DA 3IB2A 4YZZA 5L9MA 1LBZA 5KDTA 3MW0A 1KZ8A 1Y9UA 2Q74A 2IEEA 3TYHA 4ZEDA 3LSFB 4PGNA 4JSDA 4GXSB 3A3UA 2O51A 3RUMA 3VVDA 1M5BA 2OK2A 5H8NB 4DE8A 2LAOA 2PX1A 3IJOB 4FBPA 2RC9A 4OXVA 3O6IA 4G8NA 1LAHE 4MHFA 1IZ1A 4QHQA 2KQZA 4ZE8A 2DWHA 4IO5A 4JWYA 1FQBA 4LZ8A 2XD2A 3TELA 1BTJA 4ELRA 3IR1A 4BDLA 1FPLA 2I3VA 3O97A 3TODA 5IKBA 4KXPA 1FQFA 4P1EA 3OMBA 4G68B 3BKIB 1EYJA 3RTWB 1B52A 2BJJX 2Z8DA 4PDHA 3PUWE 4YB7A 1R6ZA 4WEDA 5DVFA 3T1BA 2A5SA 2V3TA 2ZYNA 5I2KA 3BBRA 1GV8A 4GWZA 1JNFA 4RK2A 1XVXA 4QSCA 1FQCA 3FXBA 1L5TA 1YZ0A 1JVYA 3THIA 2XXWA 4OESA 4XEQA 1AOVA 3H4ZA 2QL3A 1FPDA 5J1DA 4WKMA 1KA0A 3FXUA 1LCFA 4G77A 4N6KA 1QUKA 1OQGA 1TXFA 2DWJA 4C1TA 2HPGA 3JV9A 1P99A 4QRZA 1FBCA 3QUJA 3DM0A 1NH7A 3OO8A 1T0KA 2XHDA 1K9ZA 5TP9A 1GGGA 2I6EA 2XWIA 2RCBA 5H8QB 1JVXA 3T22A 1UTBA 1SYIA 4IO2A 4P8BA 1IITA 3DP4A 5AA3A 1LCTA 1FQDA 3FJGA 4R2BA 5M2VA 1MS7A 1MXUA 3R26A 4UABA 3L6HA 2YPNA 1USYH 4H8JA 3PGFA 1NKXA 3U65A 1DTGA 1USYE 2F5XA 1O63A 1NV3A 3Q29A 1IMDA 3Q27A 1MQJA 3FIRA 3ILTB 4ZZEA 3UORA 4IY5A 2FVZA 2XXPA 1VDWA 2PCRA 4HW8A 4GX3A 3N26A 3RPWA 4PAFA 4H46A 3PPQA 3IL1B 2B3FA 4M1VA 4ZZAA 4QSDA 1M5DA 2ABHA 1D4NA 1II5A 3KZGA 3QK6A 4MAGA 3SEXA 1O7TA 1EYKA 3PPRA 1MXWA 1RDXA 1H3DA 2UYFA 1JEVA 2PBWA 4FAJA 2O69A 4JDFA 4MCOA 1DSNA 4MH5A 4NE4A 1MY2A 1P1QA 4PFBA 2QJEA 4ESXA 5CMBA 1TT1A 4GXAA 1ZKBA 3T9VA 4HCYA 2F34A 2WX9A 2O7UA 4GL8A 4DDDA 2QS2A 2RCAA 3V83A 4U23A 4F3PA 2UVIA 2QSXA 3T9UA 2I3WA 3IJXB 3CRBA 1POTA 4F1VA 1ZBMA 2O6AA 1NV4A 5ET6A 1LB9A 1INPA 1SD3A 5LTCA 4FJPA 2DP8A 1Z7NE 3K0VA 4PF8A 3ZKLA 2F7BA 4RJZA 5I7IA 1UQWA 3SEWA 3T9XB 3E4RA 3V89B 1GTKA 4IO4A 2XXKA 4PFYA 3CSGA 5TP9B 1NV6A 3PUZE 2XXRA 1YPNA 4X9TA 3ZSFA 3ZS6A 2G93A 4C0RA 1CNQA 3C4MA 4ZE9A 3ROJA 3EHTA 4XKPA 2DQVA 5AA2D 4NF5A 1CB6A 2X7PA 5L9SA 1B51A 4PGPA 5CMCA 1H76A 2OLBA 4RK9A 1RDZA 2V3QA 2V4CA 5I56A 4NF0A 4E0XA 3P7IA 1Y1ZA 1NMUA 4RPOA 4DZ1A 1FW0A 1NUZA 4OQOA 2Z8FA 1JW1A 1N7WA 3KOTA 1YXIA 2I0BA 3UA8A 2O1MA 3HHGA 2XX9A 4MF3A 4PFUA 1B3EA 2E1SA 4IO7A 3EHUA 3I6VA 3FASA 1A54A 4G2ZA 2PMSA 5FTIA 3BFUA 4ZDMA 1NV5A 2WBDA 4GVOA 4FORA 4EQBA 1YTVA 4K3FA 3IK6B 4XXUA 4LUBA 2BJIA 1IXIA 4IB2A 3RN8A 3T0JA 4F22A 1Y4CA 2P3NA 3KSXA 1DCUA 2Q2CA 1XOCA 4U4XA 2ZNUA 1AMFA 4EQ9A 1F9BA 1OIBA 1TFDA 3CVGA 1B2HA 4PF6A 3FJMA 3MPKA 5IM2A 2F78A 1AIVA 1ZJLA 2AYSA 3IO6A 2ONRA 3QYTA 1QVSA 1B58A 1FRPA 4GWXA 4KYDA 4XF5A 2I4CA 3PMXA 2GHAA 5TU0A 2XXUA 3MZ1A 1SQYA 1J1NA 2PVUA 1MRPA 3MJNA 5JTYB 5EYFA 3LC8A 2GQ1A 3MQ9A 4N07A 2GHBA 3OENA 3F11A 3MYUA 3RPLA 3PMWA 5EQ8A 4DXBA 1RYXA 1Q9DA 2REJA 4PFTA 4XKQA 2DVZA 4R9GA 3RNNA 2HZKA 5DEXA 4YICA 5I59B 4N8GA 2XWOA 4OVTA 3DP6A 3E13X 4U21A 2NXOA 4MNPA 3RPLB 2PFYA 1S50A 1LAXA 3GZGA 3R7XA 2FNCA 5TPAA 3U94A 1TWYA 4GX6A 2DXYA 4G68C 3SESA 5LDZA 1GR2A 3LSLA 1DBZA 2ZYKA 2QRYA 4N13A 1M5FA 3HFUA 2DWIA 2F36A 4P0GA 2Y7KA 3KSJA 2QMXA 3G3FA 4UA8A 1SW2A 1M5CA 2Y84A 4G8HA 4DXCA 3K00A 4YKJA 4NF4A 2WBBA 4LONB 4TLLB 4OYVA 4MLQA 4ZEBA 3KG2A 2KLFA 3LSXA 4Q0CA 2XXHA 3G3KA 4GWYA 4DLDA 4PE3A 4GWSA 3KC0A 1QUJA 2V84A 1PB9A 1QKBA 4PBQA 3H03A 3UN6A 4F29A 1B0LA 2ZYMA 2Q2AA 4DI3D 1ANFA 3GXAA 1MG1A 2XWVA 2I49A 1B7ZA 1N84A 4H6DA 4JBZA 4AB5A 2O7IA 4YKIA 1M5EA 4PP0A 4FE8A 1LBCA 1MH4A 3PTYA 4KR5A 1AH5A 4X8RA 2ZZVA 4X48A 1S7YA 3OO6A 1B1HA 3H3GA 3W9WA 3TKDA 4ZEKA 1URDA 1NNPA 4LZ5A 3LSWA 2B3BA 1WODA 5H8NA 3U8QA 2R9JA 1QKAA 3EN3A 4PAKA 4OTEA 3K6VA 3M3LA 2ONKE 4N15A 3MSTA 5I2NB 3PV0E 2ZMBA 2ZZXA 5HBCA 5I2NA 4U1OA 4ELOA 4MBPA 4KCDA 2ONSA 2RINA 1Q35A 3PUVE 1Q1KA 1S9TA 4F1YA 4EF2A 1SDXA 4G4PA 4LN5A 2NOOA 5AA2A 5TPAB 3ECRA 4XIGQ 1BP5A 2Y5KA 4YAHX 2A5TB 3TZAA 4G68A 1B9JA 1VR5A 1B05A 1FTKA 4P11A 4PE5B 2DWAA 3SETA 4G8MA 3TTLA 3IOVA 4L17A 2WYPA 1XVYA 4X1BA 5FHNA 3FXQA 1AL3A 5H8FA 5JK4A 2DXRA 2A5TA 5ET7A 2QMWA 5I5PA 3O6HA 3FVOA 3EF7A 1LBVA 3A29A 1MXVA 1EYIA 5ISUA 1FPJA 2QPQA 2OWZA 4JSOA 1P1WA 4F31B 4QFLA 5EYHA 1SW4A 3KBRA 3IOUA 1FPBA 1G0IA 4NWCA 1OVBA 5IAIA 2Y7RA 3OELA 2CZKA 3N5LA 1JW5A 4HCWA 3CG1A 2HXRA 1DMBA 1EU8A 5FHOA 1YAEA 1B5HA 3CG3A 1Z7ME 2GRVA 1US4A 2OZZA 2ZZWA 2DDKA 1NUWA 4THIA 4RA1A 2I58A 3G3JA 5HPQA 2Q88A 3VVFA 1MM6A 2Y7IA 3K6XA 1A40A 4RXLA 4FIMA 3K6UA 2I0CA 1FCKA 4ONYA 4NX1A 4BDMA 1ATGA 1PBQA 1N3WA 2OJTA 4QFPA 4O3BA 1LFGA 3MAMA 1FQAA 1PC3A 2G29A 5FHMA 5I2KB 3WAEA 1A99A 4OEUA 5EQ7A 3IO4A 4ESWA 4OVRA 2HEUA 3T93B 3EPEA 1POY1 1OMPA 4JXIA 5I58B 3WAFA 1BK4A 3VLVA 4IGTA 1IMEA 3PD8A 1MXXA 2RC8A 1EZ9A 3S2VA 5CBSA 3Q25A 5DYHA 3FGSA 3W9VA 2QVRA 3CSBA 4I8CA 1NFTA 1MDQA 4IR8A 2B4MA 4G61A 1XS5A 2B4LA 1QJMA 3MUQA 4H45A 5T3JA 1QULA 2HAUA 3MVXA 3I5OA 4GL0A 4OFLA 4NF8B 3G7WA 3DP8A 1MXYA 4P0IA 4MIJA 3FXRA 2V93A 4N17A 3C9HA 4AB6A 1DPPA 4GBVA 4OVPA 1LFHA 3B8BA 1I69A 2YLNA 3CFLA 3O29A 4HTGA 4N4UA 4H1XA 3VFJA 2DSFA 3KJTA 2H5YA 3M3KA 2CZIA 5F1QA 3OSRA 2CEXA 4QFOA 1MQIA 4GOTA 4H5FA 4NF8A 4OZ9A 3VLUA 2Q89A 1FPIA 3CR9A 4H65A 2QVUA 3TTRA 5H8QA 5FTHA 3KEIA 3N6TA 1JETA 3VLWA 2DVCA 3H6WA 4KQPA 4C1UA 3MP8A 3JYRA 4OEVA 1N7XA 5ICQA 3OXNA 4LZ7A 3LV0A 4OWDA 1I6BA 3TAJA 2ANJA 4BDOA 4DCYA 2OX3A 3MC2A 2AIXA 4XKNA 4HE1A 3O28A 2ZNTA 4EQ7A 2V25A 4POXA 1VFDA 2XD3A 3PUYE 2HXWA 3KFMA 4DCXA 4NHBA 1FQEA 1XT8A 3S9NC 5H8SA 2XXIA 1B32A 2XX7A 3MZ9A 5AE4A 2YJPA 3B6WA 1B46A 1VE4A 4DI4B 2UVJA 3OO9A 1MPCA 1K9YA 1MQDA 3Q28A 4LA9A 4M4GA 3D4CA 1BIYA 4YB5A 1EZOA 2VOZA 1NV2A 1I6AA 2XWKA 3G3IA 1LLSA 1ZLQA 1UTHA 1ZU0A 4R9FA 1SI1A 4RNSA 5IZ3A 3EHSA 3KJ7A 2L5VA 1UTHB 4BLAA 3ILUB 4Q30B 3OD7A 2VHAA 3FVKA 1BKAA 5ITPA 1NNFA 3QIMA 1LEVA 4U22A 3EQ1A 3KN3A 4HS7A 3TTKA 1BLFA 3TTNA 1FPGA 4ND9A 3OEKA 2MKZA 3N6UA 3SZPA 4ISUA 1OVTA 3RQTA 2R8TA 1NV1A 3S4UA 3Q26A 2JJKA 3HPIA 3OEMA 4H0WA 4X1DA 5I56B 3U92A 1GVCA 4ECFA 4H8IA 2DS9A 3AXFA 5BWJA 4PFIA 4Q8RA 5JTYA 1WVJA 1XC1A 4KPTA 5FBPA 5A5LA 1D9VA 3FATA 4N8YA 5F24A 4I9DA 5K2YA 3ISPA 3H6VA 1MH3A 2Q8JA 3QSLA 5CM6A 1JW4A 5AA4B 2F7CA 2REGA 3IB1A 2FYIA 4F19A 5DEXB 2VGQA 3HSTA 3TPAA 3OO7A 3DELB 1MDP1 4MEVA 5KCJB 1NH8A 3MZBA 4O3AA 1MXZA 4F3GA 4N91A 2F8DA 3CFZA 3LUZA 1ZTYA 5KCJA 2DE4A 4OVJA 4I1DA 2DYXA 5I57B 2Y5LA 2WEFA 3SERA 2I4BA 4GX4A 3IFCA 1Y20A 2V3UA 1QW0A 4R6HA 5B7DA 3H7MA 3IFAA 3VDFA 5BUUA 3G3HA 2Z22A 4MNCA 3U93A 3KGCA 2CMOA 4I40A
chains in the Genus database with same CATH topology
4PETA 5IZ1A 4OANA 2WYKA 3U65A 1LEVA 5I7IA 2FBPA 1AWBA 2QVUA 3D1RA 4JVDA 2F5XA 4MJOA 4PC9A 4KXPA 2P3VA 2KR0A 5EQ9A 4P1EA 1JP4A 1NV3A 2F3BA 2XXKA 4NG7A 1SPIA 1XI6A 1YYZA 4LN5A 1NV6A 4NX1A 1EYJA 5ET8A 4P56A 1NI9A 2HHMA 1FRPA 4GWXA 4NGUA 1IMDA 2XA5A 5EYGA 4F18A 5IZ3B 4PDHA 2WBBA 2Y5KA 2FIEA 1FPGA 4XF5A 3LV0A 3T1BA 4GWUA 4X9TA 4O8MA 1CNQA 1FPFA 2MKZA 3E78A 3SZPA 4PTKA 2QFLA 3ROJA 4JVCA 1FBGA 2OX3A 1LBYA 2R8TA 2CZHA 5EQ7A 4HE1A 2FVZA 1QGXA 2CEYA 1NV1A 1FJ9A 1FSAA 1VDWA 2PCRA 2Q9TA 4GWZA 4GX3A 4OVRA 2JJKA 4N81A 4OVQA 4PGPA 4OA4A 1IMAA 4GWYA 4PAFA 4PE3A 3FXBA 4GWSA 2WYPA 3KC0A 4H46A 2GQ1A 4NHBA 4PAIA 4MMPA 4PDDA 1RDZA 4NAPA 5I3SA 2V3QA 4M1VA 5IGAA 2HZLA 1YZ0A 1BK4A 4P1LA 3E79A 2V4CA 3MYUA 5EQAA 1DK4A 4NF0A 4PBQA 4XEQA 5JK4A 3RPLA 4GBWA 4YZZA 4PFIA 5ET5A 1IMEA 1LBZA 4MAGA 2DE2A 5ET7A 4AS4A 1FBHA 3GYYA 2VPOA 5EQ8A 4DI3D 1KZ8A 1EYKA 5I5PA 3RYDA 1FPDA 1RDXA 5J1DA 1FTAA 2Q74A 1KA0A 1Q9DA 4HXVA 4DI4B 2F3DA 2XWVA 4O94A 5FBPA 3CHGA 4P47A 1NUZA 4GWWA 4HE2A 4OVSA 4MCOA 4PGNA 2DVZA 2QVRA 3W9VA 5A5LA 2HZKA 5DW8A 1K9YA 1FBDA 1KA1A 4PBHA 1LBVA 1NUXA 3A29A 4IR8A 1FJ6A 2VT5A 1EYIA 4N6KA 3NOHA 4N8YA 4N8GA 4PFRA 2B4MA 3BIGA 5F24A 4G61A 4AS5A 1FPJA 3ISPA 2QPQA 2OWZA 2B4LA 1LBWA 1FBFA 2XWOA 2HPGA 4PFBA 1YXIA 4OVTA 3PTYA 2DE3A 4H45A 3KC1A 4MNIA 5T3JA 2FIXA 4MNPA 4O7MA 4X8RA 5CM6A 4YICA 2ZZVA 3RPLB 1D9QA 1FPEA 2PFYA 1FBCA 5EYHA 4HCYA 4F19A 3W9WA 1FPBA 1G0IA 1LBXA 1NV0A 1RDYA 2WX9A 3FBPA 1NV2A 4PCDA 4MIJA 4FBPA 4MEVA 4N17A 2XWKA 4NQ8A 4X04A 2CZKA 4MX6A 1IMBA 1K9ZA 4GBVA 4N91A 4OVPA 1NV7A 4HCWA 2XWIA 3B8BA 3KBZA 3LUZA 4N4UA 2HXRA 4MHFA 2VPNA 2DE4A 4F1VA 1IMFA 4I3YA 5IZ3A 4O7IA 1IMCA 1FPKA 2L5VA 1NV5A 2PFZA 2WBDA 2KQZA 5IZZA 2Y5LA 3QMFA 4P8BA 4GX6A 4PAKA 2WEFA 4F1UA 1NV4A 1NUYA 5ET6A 4P9KA 2CZIA 4GX4A 3B50A 1INPA 2BJIA 2CEXA 2ZZWA 3IFCA 2DDKA 5ESYA 3T0JA 3EKIA 1NUWA 1DBZA 3BIHA 5LDZA 4N15A 5LTCA 2P3NA 3IFAA 4I3EA 1DCUA 1FBPA 3MSTA 4HE0A 5J16A 1G0HA 4PF8A 4QBAA 1FPIA 4MNCA 4P3LA 1FBEA 4NN3A 4UABA 3HFUA 2ZZXA 4PF6A 2Q8MA 2FHYA 4N6DA 4I40A 2QVVA 4QXDA 4XFEA 1FPLA 4JVIA 5IM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PET A;  4OAN A;  2WYK A;  3U65 A;  5I7I A;  4PC9 A;  4P1E A;  2XXK A;  4NG7 A;  4NX1 A;  4LN5 A;  4P56 A;  4NGU A;  2XA5 A;  4PDH A;  4XF5 A;  4O8M A;  2CEY A;  4OVR A;  4OVQ A;  4PGP A;  4OA4 A;  4PAF A;  4PE3 A;  3FXB A;  2WYP A;  4PDD A;  4NHB A;  4PAI A;  4MMP A;  4NAP A;  5IGA A;  2HZL A;  4P1L A;  2V4C A;  4NF0 A;  4PBQ A;  4XEQ A;  4YZZ A;  4PFI A;  4MAG A;  3GYY A;  2VPO A;  4DI3 D;  5I5P A;  4DI4 B;  4O94 A;  2XWV A;  4P47 A;  4OVS A;  4MCO A;  4PGN A;  2HZK A;  4PBH A;  4N6K A;  4YIC A;  4N8Y A;  4N8G A;  4PFR A;  4PFB A;  2XWO A;  2HPG A;  4OVT A;  4MNI A;  4MNP A;  4O7M A;  4X8R A;  5CM6 A;  2ZZV A;  2PFY A;  2WX9 A;  4PCD A;  4MIJ A;  4MEV A;  4N17 A;  4NQ8 A;  2XWK A;  4X04 A;  4MX6 A;  4N91 A;  4OVP A;  2XWI A;  4N4U A;  4MHF A;  2VPN A;  2PFZ A;  5IZZ A;  4P8B A;  4PAK A;  4P9K A;  3B50 A;  2CEX A;  2ZZW A;  4N15 A;  5LTC A;  4PF8 A;  4MNC A;  4P3L A;  4NN3 A;  4UAB A;  2ZZX A;  4PF6 A;  4XFE A;  4N6D A;  5IM2 A; 
#chains in the Genus database with same CATH topology
 4NF4 B;  4BDN A;  1YCJ A;  4Q5T A;  1XI6 A;  4ELQ A;  3IB0 A;  5EYG A;  2R6G E;  2W7Y A;  5IZ3 B;  2M8C A;  3C32 A;  4GWU A;  4O8M A;  4Z0I A;  4XTC Q;  3FV1 A;  3MVY A;  4PTK A;  2F6P A;  1B3H A;  4JVC A;  2HFB A;  4OER A;  2CEY A;  3SKP A;  4OVQ A;  4LQ2 A;  4EDP A;  1SW5 A;  4FEB A;  2F6G A;  3KN7 A;  4MMP A;  4R6K A;  5IGA A;  2Z8E A;  1Y3P A;  3K1P A;  4R72 A;  1DK4 A;  3VXB A;  5ET5 A;  1MY3 A;  3K1M A;  1ELJ A;  4LP2 B;  5CRY A;  4F3B A;  3TUS A;  2RC7 A;  3RYD A;  3TTM A;  1B4Z A;  1RKM A;  3O9P A;  3CHG A;  4IO6 A;  2H99 A;  2Z23 A;  3C36 A;  1IXG A;  4KYE A;  2XXX A;  1I6Q A;  3LUY A;  3UP9 A;  4KHZ E;  3UK4 A;  4FAT A;  1IUD A;  4PFW A;  4O7M A;  4ZEI A;  1LAF E;  3TQL A;  2Y7P A;  4PCD A;  2H9B A;  1A8E A;  3KBZ A;  1B3F A;  1NL5 A;  2VPN A;  1A55 A;  3T9H B;  4O7I A;  1IEJ A;  2D21 A;  3QMF A;  4RPN A;  1VSO A;  3B50 A;  3EKI A;  3MP1 A;  4JB7 A;  1FBP A;  3FVG A;  4GWO A;  3A3C A;  5H8H B;  3FD3 A;  2WYK A;  2PT2 A;  1URS A;  3D1R A;  4JVD A;  3TFL A;  4R73 A;  3PMV A;  4JWX A;  4NWD A;  4YU0 A;  1Y4T A;  1N0T A;  2FIE A;  4F3S A;  1B3G A;  5DTB A;  3E78 A;  1LBB A;  1LBY A;  2NWJ A;  1IXH A;  1QGX A;  1B3L A;  3ONM A;  1OLA A;  3GBB A;  1MQG A;  4TQU Q;  5I3S A;  4NAP A;  1B5J A;  3SDF A;  3M8U A;  5EQA A;  2PT1 A;  1DOT A;  1Y3N A;  3PPP A;  3GYY A;  1D9Y A;  1R9Q A;  2HQ0 A;  1XHY A;  4F39 A;  2ZXT A;  4RYA A;  4AS5 A;  1NNK A;  1LGB C;  1OLC A;  3R6U A;  3W15 C;  3PD9 A;  2D5W A;  4MNI A;  5AA1 A;  3TCF A;  3TCH A;  3TEP A;  1RDY A;  4DIG A;  5JEI A;  2AL5 A;  3IX1 A;  5KDT B;  1ZIU A;  1A8F A;  1IMF A;  3FZV A;  3TQW A;  4F1U A;  5ITO A;  3RLF E;  1N3X A;  1B7H A;  4QF9 A;  3T66 A;  3I3V A;  4HE0 A;  4OMB A;  4H67 A;  1FBE A;  4QXD A;  2H25 A;  3U1O A;  3OSQ A;  2FBP A;  1HSJ A;  1AWB A;  4PC9 A;  4WXJ A;  1VFE A;  5AA2 B;  4ZEF A;  5EQ9 A;  2R71 A;  1A7L A;  1QUI A;  5B70 A;  4NG7 A;  1HSE A;  2O1L A;  3HHF A;  2B65 A;  4P56 A;  1B6H A;  4GF8 A;  1P1U A;  4IO3 A;  4OFJ A;  2D3I A;  2UVH A;  1SW1 A;  4GFR A;  4E0W A;  2CZH A;  5CI5 A;  3MVZ A;  4ELP A;  4QFK A;  5DVJ A;  1PEB A;  4IGR A;  3ZKK A;  5H8F B;  4R74 A;  3HV1 A;  4U4S A;  5DVI A;  3M3F A;  4GD5 A;  4NED A;  1R1N A;  2OWT A;  3USD A;  2F3D A;  2ALU A;  3IOT A;  5I58 A;  4OVS A;  1FBD A;  3UGW A;  3CI8 A;  2DOJ A;  1OQH A;  2X7Q A;  4YMB A;  3KC1 A;  2H98 A;  1PB7 A;  5HM4 B;  2F97 A;  3H06 B;  1FTM A;  3H6T A;  3K4U A;  1Y3Q A;  2VP1 A;  5F7V A;  4X04 A;  3IOR A;  5CMK A;  2PFZ A;  5CC2 A;  2XXY A;  4EUO A;  4P9K A;  3O2A A;  3LBS A;  3E9X A;  4JWO A;  5J16 A;  4OEN A;  1KWH A;  4QBA A;  4P3L A;  1PBP A;  2Q8M A;  1MPB A;  2PYY A;  4F2O A;  1LB8 A;  4OAN A;  1IIW A;  2HAV A;  1HSL A;  3A09 A;  2P2A A;  4N6P A;  1SPI A;  3N94 A;  1IXC A;  3HN0 A;  5ET8 A;  2RKM A;  2HHM A;  2XA5 A;  1LFI A;  1TFA A;  1UTB B;  1FPF A;  2E0S A;  4KCC A;  4U1Z A;  2UYE A;  3QAX A;  2CZL A;  1MM7 A;  1FSA A;  2ZYO A;  3D4G A;  1D3K A;  3PUX E;  1IMA A;  4PDD A;  4PAI A;  2RF1 A;  3VV5 A;  3QXM A;  5LOM A;  1RYO A;  3B7D A;  4AS4 A;  4EF1 A;  1FBH A;  3OOA A;  2VPO A;  4GQO A;  5EHS A;  3V5A A;  3RTF B;  1FTA A;  5CBR A;  5KZT A;  4HXV A;  5ELV A;  1PDA A;  2P0S A;  3C33 A;  5DW8 A;  3RGY A;  3VXC A;  1NUX A;  2VT5 A;  2NVU B;  4YKP A;  3BIG A;  1MY1 A;  1LBW A;  4MLV A;  2UVG A;  1FPE A;  3T96 B;  1H45 A;  4DXU A;  3MPL A;  3K1N A;  3VE1 B;  4AQ4 A;  1DPE A;  3HO7 A;  4GIZ A;  1IMB A;  1LAG E;  1FPK A;  1FTL A;  3PPN A;  3S9L C;  3MVW A;  3SEU A;  4OHN A;  2F35 A;  2O68 A;  2FHY A;  4JVI A;  4PET A;  3K02 A;  2XX8 A;  3IAZ A;  4Z7E A;  2UXA A;  1JP4 A;  4FEC A;  3SEV A;  4MFI A;  4UAC A;  1FTO A;  1EH3 A;  2ESN A;  1B4H A;  1EZP A;  2P1S A;  3QUF A;  3G3G A;  4KYS A;  1NNT A;  3KOS A;  1UIU A;  2OWS A;  3FJ7 A;  2IA4 A;  3K6W A;  1N04 A;  3V8X B;  3C35 A;  1SYH A;  3MP6 A;  3E79 A;  4BDQ A;  3MBP A;  4GBW A;  2NUV A;  2DE2 A;  4O3C A;  1SI0 A;  2VD3 A;  4KFQ A;  3FVN A;  2THI A;  1SVX B;  3GLB A;  2ZNS A;  4P47 A;  4QSE A;  1MY0 A;  4PBH A;  1KA1 A;  2Y7W A;  1FJ6 A;  1B5I A;  4NF5 B;  4PFR A;  3MWB A;  3S9E A;  1P1O A;  1FBF A;  4GRK A;  3E3K A;  4ZS9 A;  3C31 A;  4FED A;  3FBP A;  1JQF A;  2QS3 A;  1ZMG A;  4YMA A;  1PB8 A;  3RT8 A;  4I3Y A;  5AA4 A;  1IMC A;  3B6T A;  3K01 A;  4U2R A;  5CMM A;  5IZZ A;  3UIF A;  1NUY A;  2OBG A;  2QS4 A;  1US5 A;  3BIH A;  4NF6 B;  2QS1 A;  4I3E A;  4XKR A;  1P1N A;  4QFN A;  4NN3 A;  1B40 A;  3K2D A;  4EXK A;  2QVV A;  2X26 A;  4H5G A;  5IZ1 A;  1IQ7 A;  4OET A;  3BFT A;  4MJO A;  1R9L A;  2P3V A;  5EHM A;  2VD2 A;  3PU5 A;  3IOW A;  3KN8 A;  1YYZ A;  3B6Q A;  4GLI A;  1MQH A;  1NI9 A;  2AL4 A;  4NF6 A;  3TDJ A;  4YB6 A;  3TMG A;  4TLM B;  3RY3 A;  5I84 A;  1DTZ A;  4IY6 A;  4OA4 A;  3JZJ A;  5L9O A;  5ESY A;  4YKK A;  3U72 A;  2WKY A;  4NTL A;  2XXT A;  3H6U A;  3DLN A;  4P1L A;  4PQJ A;  4TOZ A;  3O6G A;  4I62 A;  3HCQ A;  4RY1 A;  2GFE A;  1H44 A;  3S9M C;  4O94 A;  4GWW A;  4HE2 A;  1H43 A;  2GH9 A;  4BDR A;  3TCG A;  1SBP A;  2OCU A;  3NOH A;  1B0H A;  1LST A;  5H8H A;  2DE3 A;  4WEP A;  2FIX A;  2O84 X;  3L6G A;  1D9Q A;  5A5X B;  1B7U A;  1LBX A;  1NV0 A;  4ZEC A;  2F7A A;  3ODB A;  4LVQ A;  4NQ8 A;  4MX6 A;  4R2F A;  1NV7 A;  5I57 A;  4NMY A;  4R6Y A;  2FA7 A;  4R75 A;  2H4I A;  4KD5 A;  5DT6 A;  3GBA A;  1O64 A;  4LAT A;  2HCA A;  1CE2 A;  5I59 A;  5A5X A;  1MY4 A;  1G0H A;  3O66 A;  4F2Q A;  4XFE A;  4N6D A;  3SEY A;  4KI0 E;  1Y1M A;  2KR0 A;  1URG A;  2F3B A;  3FV2 A;  3RT6 B;  3CIJ A;  4LQ5 A;  1B1X A;  3C34 A;  1MPD A;  4NGU A;  4F18 A;  3FUZ A;  3PPO A;  3VVE A;  3LR1 A;  2I48 A;  2XXQ A;  3CFX A;  1WDN A;  2QFL A;  4EXL A;  1UIV A;  1FBG A;  4POW A;  5ICT A;  1FJ9 A;  1N76 A;  2Q9T A;  5K2X A;  1FTJ A;  4OFO A;  4N81 A;  1JEU A;  2HZL A;  2XXV A;  5L8D A;  3IB2 A;  4YZZ A;  5L9M A;  1LBZ A;  5KDT A;  3MW0 A;  1KZ8 A;  1Y9U A;  2Q74 A;  2IEE A;  3TYH A;  4ZED A;  3LSF B;  4PGN A;  4JSD A;  4GXS B;  3A3U A;  2O51 A;  3RUM A;  3VVD A;  1M5B A;  2OK2 A;  5H8N B;  4DE8 A;  2LAO A;  2PX1 A;  3IJO B;  4FBP A;  2RC9 A;  4OXV A;  3O6I A;  4G8N A;  1LAH E;  4MHF A;  1IZ1 A;  4QHQ A;  2KQZ A;  4ZE8 A;  2DWH A;  4IO5 A;  4JWY A;  1FQB A;  4LZ8 A;  2XD2 A;  3TEL A;  1BTJ A;  4ELR A;  3IR1 A;  4BDL A;  1FPL A;  2I3V A;  3O97 A;  3TOD A;  5IKB A;  4KXP A;  1FQF A;  4P1E A;  3OMB A;  4G68 B;  3BKI B;  1EYJ A;  3RTW B;  1B52 A;  2BJJ X;  2Z8D A;  4PDH A;  3PUW E;  4YB7 A;  1R6Z A;  4WED A;  5DVF A;  3T1B A;  2A5S A;  2V3T A;  2ZYN A;  5I2K A;  3BBR A;  1GV8 A;  4GWZ A;  1JNF A;  4RK2 A;  1XVX A;  4QSC A;  1FQC A;  3FXB A;  1L5T A;  1YZ0 A;  1JVY A;  3THI A;  2XXW A;  4OES A;  4XEQ A;  1AOV A;  3H4Z A;  2QL3 A;  1FPD A;  5J1D A;  4WKM A;  1KA0 A;  3FXU A;  1LCF A;  4G77 A;  4N6K A;  1QUK A;  1OQG A;  1TXF A;  2DWJ A;  4C1T A;  2HPG A;  3JV9 A;  1P99 A;  4QRZ A;  1FBC A;  3QUJ A;  3DM0 A;  1NH7 A;  3OO8 A;  1T0K A;  2XHD A;  1K9Z A;  5TP9 A;  1GGG A;  2I6E A;  2XWI A;  2RCB A;  5H8Q B;  1JVX A;  3T22 A;  1UTB A;  1SYI A;  4IO2 A;  4P8B A;  1IIT A;  3DP4 A;  5AA3 A;  1LCT A;  1FQD A;  3FJG A;  4R2B A;  5M2V A;  1MS7 A;  1MXU A;  3R26 A;  4UAB A;  3L6H A;  2YPN A;  1USY H;  4H8J A;  3PGF A;  1NKX A;  3U65 A;  1DTG A;  1USY E;  2F5X A;  1O63 A;  1NV3 A;  3Q29 A;  1IMD A;  3Q27 A;  1MQJ A;  3FIR A;  3ILT B;  4ZZE A;  3UOR A;  4IY5 A;  2FVZ A;  2XXP A;  1VDW A;  2PCR A;  4HW8 A;  4GX3 A;  3N26 A;  3RPW A;  4PAF A;  4H46 A;  3PPQ A;  3IL1 B;  2B3F A;  4M1V A;  4ZZA A;  4QSD A;  1M5D A;  2ABH A;  1D4N A;  1II5 A;  3KZG A;  3QK6 A;  4MAG A;  3SEX A;  1O7T A;  1EYK A;  3PPR A;  1MXW A;  1RDX A;  1H3D A;  2UYF A;  1JEV A;  2PBW A;  4FAJ A;  2O69 A;  4JDF A;  4MCO A;  1DSN A;  4MH5 A;  4NE4 A;  1MY2 A;  1P1Q A;  4PFB A;  2QJE A;  4ESX A;  5CMB A;  1TT1 A;  4GXA A;  1ZKB A;  3T9V A;  4HCY A;  2F34 A;  2WX9 A;  2O7U A;  4GL8 A;  4DDD A;  2QS2 A;  2RCA A;  3V83 A;  4U23 A;  4F3P A;  2UVI A;  2QSX A;  3T9U A;  2I3W A;  3IJX B;  3CRB A;  1POT A;  4F1V A;  1ZBM A;  2O6A A;  1NV4 A;  5ET6 A;  1LB9 A;  1INP A;  1SD3 A;  5LTC A;  4FJP A;  2DP8 A;  1Z7N E;  3K0V A;  4PF8 A;  3ZKL A;  2F7B A;  4RJZ A;  5I7I A;  1UQW A;  3SEW A;  3T9X B;  3E4R A;  3V89 B;  1GTK A;  4IO4 A;  2XXK A;  4PFY A;  3CSG A;  5TP9 B;  1NV6 A;  3PUZ E;  2XXR A;  1YPN A;  4X9T A;  3ZSF A;  3ZS6 A;  2G93 A;  4C0R A;  1CNQ A;  3C4M A;  4ZE9 A;  3ROJ A;  3EHT A;  4XKP A;  2DQV A;  5AA2 D;  4NF5 A;  1CB6 A;  2X7P A;  5L9S A;  1B51 A;  4PGP A;  5CMC A;  1H76 A;  2OLB A;  4RK9 A;  1RDZ A;  2V3Q A;  2V4C A;  5I56 A;  4NF0 A;  4E0X A;  3P7I A;  1Y1Z A;  1NMU A;  4RPO A;  4DZ1 A;  1FW0 A;  1NUZ A;  4OQO A;  2Z8F A;  1JW1 A;  1N7W A;  3KOT A;  1YXI A;  2I0B A;  3UA8 A;  2O1M A;  3HHG A;  2XX9 A;  4MF3 A;  4PFU A;  1B3E A;  2E1S A;  4IO7 A;  3EHU A;  3I6V A;  3FAS A;  1A54 A;  4G2Z A;  2PMS A;  5FTI A;  3BFU A;  4ZDM A;  1NV5 A;  2WBD A;  4GVO A;  4FOR A;  4EQB A;  1YTV A;  4K3F A;  3IK6 B;  4XXU A;  4LUB A;  2BJI A;  1IXI A;  4IB2 A;  3RN8 A;  3T0J A;  4F22 A;  1Y4C A;  2P3N A;  3KSX A;  1DCU A;  2Q2C A;  1XOC A;  4U4X A;  2ZNU A;  1AMF A;  4EQ9 A;  1F9B A;  1OIB A;  1TFD A;  3CVG A;  1B2H A;  4PF6 A;  3FJM A;  3MPK A;  5IM2 A;  2F78 A;  1AIV A;  1ZJL A;  2AYS A;  3IO6 A;  2ONR A;  3QYT A;  1QVS A;  1B58 A;  1FRP A;  4GWX A;  4KYD A;  4XF5 A;  2I4C A;  3PMX A;  2GHA A;  5TU0 A;  2XXU A;  3MZ1 A;  1SQY A;  1J1N A;  2PVU A;  1MRP A;  3MJN A;  5JTY B;  5EYF A;  3LC8 A;  2GQ1 A;  3MQ9 A;  4N07 A;  2GHB A;  3OEN A;  3F11 A;  3MYU A;  3RPL A;  3PMW A;  5EQ8 A;  4DXB A;  1RYX A;  1Q9D A;  2REJ A;  4PFT A;  4XKQ A;  2DVZ A;  4R9G A;  3RNN A;  2HZK A;  5DEX A;  4YIC A;  5I59 B;  4N8G A;  2XWO A;  4OVT A;  3DP6 A;  3E13 X;  4U21 A;  2NXO A;  4MNP A;  3RPL B;  2PFY A;  1S50 A;  1LAX A;  3GZG A;  3R7X A;  2FNC A;  5TPA A;  3U94 A;  1TWY A;  4GX6 A;  2DXY A;  4G68 C;  3SES A;  5LDZ A;  1GR2 A;  3LSL A;  1DBZ A;  2ZYK A;  2QRY A;  4N13 A;  1M5F A;  3HFU A;  2DWI A;  2F36 A;  4P0G A;  2Y7K A;  3KSJ A;  2QMX A;  3G3F A;  4UA8 A;  1SW2 A;  1M5C A;  2Y84 A;  4G8H A;  4DXC A;  3K00 A;  4YKJ A;  4NF4 A;  2WBB A;  4LON B;  4TLL B;  4OYV A;  4MLQ A;  4ZEB A;  3KG2 A;  2KLF A;  3LSX A;  4Q0C A;  2XXH A;  3G3K A;  4GWY A;  4DLD A;  4PE3 A;  4GWS A;  3KC0 A;  1QUJ A;  2V84 A;  1PB9 A;  1QKB A;  4PBQ A;  3H03 A;  3UN6 A;  4F29 A;  1B0L A;  2ZYM A;  2Q2A A;  4DI3 D;  1ANF A;  3GXA A;  1MG1 A;  2XWV A;  2I49 A;  1B7Z A;  1N84 A;  4H6D A;  4JBZ A;  4AB5 A;  2O7I A;  4YKI A;  1M5E A;  4PP0 A;  4FE8 A;  1LBC A;  1MH4 A;  3PTY A;  4KR5 A;  1AH5 A;  4X8R A;  2ZZV A;  4X48 A;  1S7Y A;  3OO6 A;  1B1H A;  3H3G A;  3W9W A;  3TKD A;  4ZEK A;  1URD A;  1NNP A;  4LZ5 A;  3LSW A;  2B3B A;  1WOD A;  5H8N A;  3U8Q A;  2R9J A;  1QKA A;  3EN3 A;  4PAK A;  4OTE A;  3K6V A;  3M3L A;  2ONK E;  4N15 A;  3MST A;  5I2N B;  3PV0 E;  2ZMB A;  2ZZX A;  5HBC A;  5I2N A;  4U1O A;  4ELO A;  4MBP A;  4KCD A;  2ONS A;  2RIN A;  1Q35 A;  3PUV E;  1Q1K A;  1S9T A;  4F1Y A;  4EF2 A;  1SDX A;  4G4P A;  4LN5 A;  2NOO A;  5AA2 A;  5TPA B;  3ECR A;  4XIG Q;  1BP5 A;  2Y5K A;  4YAH X;  2A5T B;  3TZA A;  4G68 A;  1B9J A;  1VR5 A;  1B05 A;  1FTK A;  4P11 A;  4PE5 B;  2DWA A;  3SET A;  4G8M A;  3TTL A;  3IOV A;  4L17 A;  2WYP A;  1XVY A;  4X1B A;  5FHN A;  3FXQ A;  1AL3 A;  5H8F A;  5JK4 A;  2DXR A;  2A5T A;  5ET7 A;  2QMW A;  5I5P A;  3O6H A;  3FVO A;  3EF7 A;  1LBV A;  3A29 A;  1MXV A;  1EYI A;  5ISU A;  1FPJ A;  2QPQ A;  2OWZ A;  4JSO A;  1P1W A;  4F31 B;  4QFL A;  5EYH A;  1SW4 A;  3KBR A;  3IOU A;  1FPB A;  1G0I A;  4NWC A;  1OVB A;  5IAI A;  2Y7R A;  3OEL A;  2CZK A;  3N5L A;  1JW5 A;  4HCW A;  3CG1 A;  2HXR A;  1DMB A;  1EU8 A;  5FHO A;  1YAE A;  1B5H A;  3CG3 A;  1Z7M E;  2GRV A;  1US4 A;  2OZZ A;  2ZZW A;  2DDK A;  1NUW A;  4THI A;  4RA1 A;  2I58 A;  3G3J A;  5HPQ A;  2Q88 A;  3VVF A;  1MM6 A;  2Y7I A;  3K6X A;  1A40 A;  4RXL A;  4FIM A;  3K6U A;  2I0C A;  1FCK A;  4ONY A;  4NX1 A;  4BDM A;  1ATG A;  1PBQ A;  1N3W A;  2OJT A;  4QFP A;  4O3B A;  1LFG A;  3MAM A;  1FQA A;  1PC3 A;  2G29 A;  5FHM A;  5I2K B;  3WAE A;  1A99 A;  4OEU A;  5EQ7 A;  3IO4 A;  4ESW A;  4OVR A;  2HEU A;  3T93 B;  3EPE A;  1POY 1;  1OMP A;  4JXI A;  5I58 B;  3WAF A;  1BK4 A;  3VLV A;  4IGT A;  1IME A;  3PD8 A;  1MXX A;  2RC8 A;  1EZ9 A;  3S2V A;  5CBS A;  3Q25 A;  5DYH A;  3FGS A;  3W9V A;  2QVR A;  3CSB A;  4I8C A;  1NFT A;  1MDQ A;  4IR8 A;  2B4M A;  4G61 A;  1XS5 A;  2B4L A;  1QJM A;  3MUQ A;  4H45 A;  5T3J A;  1QUL A;  2HAU A;  3MVX A;  3I5O A;  4GL0 A;  4OFL A;  4NF8 B;  3G7W A;  3DP8 A;  1MXY A;  4P0I A;  4MIJ A;  3FXR A;  2V93 A;  4N17 A;  3C9H A;  4AB6 A;  1DPP A;  4GBV A;  4OVP A;  1LFH A;  3B8B A;  1I69 A;  2YLN A;  3CFL A;  3O29 A;  4HTG A;  4N4U A;  4H1X A;  3VFJ A;  2DSF A;  3KJT A;  2H5Y A;  3M3K A;  2CZI A;  5F1Q A;  3OSR A;  2CEX A;  4QFO A;  1MQI A;  4GOT A;  4H5F A;  4NF8 A;  4OZ9 A;  3VLU A;  2Q89 A;  1FPI A;  3CR9 A;  4H65 A;  2QVU A;  3TTR A;  5H8Q A;  5FTH A;  3KEI A;  3N6T A;  1JET A;  3VLW A;  2DVC A;  3H6W A;  4KQP A;  4C1U A;  3MP8 A;  3JYR A;  4OEV A;  1N7X A;  5ICQ A;  3OXN A;  4LZ7 A;  3LV0 A;  4OWD A;  1I6B A;  3TAJ A;  2ANJ A;  4BDO A;  4DCY A;  2OX3 A;  3MC2 A;  2AIX A;  4XKN A;  4HE1 A;  3O28 A;  2ZNT A;  4EQ7 A;  2V25 A;  4POX A;  1VFD A;  2XD3 A;  3PUY E;  2HXW A;  3KFM A;  4DCX A;  4NHB A;  1FQE A;  1XT8 A;  3S9N C;  5H8S A;  2XXI A;  1B32 A;  2XX7 A;  3MZ9 A;  5AE4 A;  2YJP A;  3B6W A;  1B46 A;  1VE4 A;  4DI4 B;  2UVJ A;  3OO9 A;  1MPC A;  1K9Y A;  1MQD A;  3Q28 A;  4LA9 A;  4M4G A;  3D4C A;  1BIY A;  4YB5 A;  1EZO A;  2VOZ A;  1NV2 A;  1I6A A;  2XWK A;  3G3I A;  1LLS A;  1ZLQ A;  1UTH A;  1ZU0 A;  4R9F A;  1SI1 A;  4RNS A;  5IZ3 A;  3EHS A;  3KJ7 A;  2L5V A;  1UTH B;  4BLA A;  3ILU B;  4Q30 B;  3OD7 A;  2VHA A;  3FVK A;  1BKA A;  5ITP A;  1NNF A;  3QIM A;  1LEV A;  4U22 A;  3EQ1 A;  3KN3 A;  4HS7 A;  3TTK A;  1BLF A;  3TTN A;  1FPG A;  4ND9 A;  3OEK A;  2MKZ A;  3N6U A;  3SZP A;  4ISU A;  1OVT A;  3RQT A;  2R8T A;  1NV1 A;  3S4U A;  3Q26 A;  2JJK A;  3HPI A;  3OEM A;  4H0W A;  4X1D A;  5I56 B;  3U92 A;  1GVC A;  4ECF A;  4H8I A;  2DS9 A;  3AXF A;  5BWJ A;  4PFI A;  4Q8R A;  5JTY A;  1WVJ A;  1XC1 A;  4KPT A;  5FBP A;  5A5L A;  1D9V A;  3FAT A;  4N8Y A;  5F24 A;  4I9D A;  5K2Y A;  3ISP A;  3H6V A;  1MH3 A;  2Q8J A;  3QSL A;  5CM6 A;  1JW4 A;  5AA4 B;  2F7C A;  2REG A;  3IB1 A;  2FYI A;  4F19 A;  5DEX B;  2VGQ A;  3HST A;  3TPA A;  3OO7 A;  3DEL B;  1MDP 1;  4MEV A;  5KCJ B;  1NH8 A;  3MZB A;  4O3A A;  1MXZ A;  4F3G A;  4N91 A;  2F8D A;  3CFZ A;  3LUZ A;  1ZTY A;  5KCJ A;  2DE4 A;  4OVJ A;  4I1D A;  2DYX A;  5I57 B;  2Y5L A;  2WEF A;  3SER A;  2I4B A;  4GX4 A;  3IFC A;  1Y20 A;  2V3U A;  1QW0 A;  4R6H A;  5B7D A;  3H7M A;  3IFA A;  3VDF A;  5BUU A;  3G3H A;  2Z22 A;  4MNC A;  3U93 A;  3KGC A;  2CMO A;  4I40 A; 
#chains in the Genus database with same CATH homology
 4PET A;  5IZ1 A;  4OAN A;  2WYK A;  3U65 A;  1LEV A;  5I7I A;  2FBP A;  1AWB A;  2QVU A;  3D1R A;  4JVD A;  2F5X A;  4MJO A;  4PC9 A;  4KXP A;  2P3V A;  2KR0 A;  5EQ9 A;  4P1E A;  1JP4 A;  1NV3 A;  2F3B A;  2XXK A;  4NG7 A;  1SPI A;  1XI6 A;  1YYZ A;  4LN5 A;  1NV6 A;  4NX1 A;  1EYJ A;  5ET8 A;  4P56 A;  1NI9 A;  2HHM A;  1FRP A;  4GWX A;  4NGU A;  1IMD A;  2XA5 A;  5EYG A;  4F18 A;  5IZ3 B;  4PDH A;  2WBB A;  2Y5K A;  2FIE A;  1FPG A;  4XF5 A;  3LV0 A;  3T1B A;  4GWU A;  4X9T A;  4O8M A;  1CNQ A;  1FPF A;  2MKZ A;  3E78 A;  3SZP A;  4PTK A;  2QFL A;  3ROJ A;  4JVC A;  1FBG A;  2OX3 A;  1LBY A;  2R8T A;  2CZH A;  5EQ7 A;  4HE1 A;  2FVZ A;  1QGX A;  2CEY A;  1NV1 A;  1FJ9 A;  1FSA A;  1VDW A;  2PCR A;  2Q9T A;  4GWZ A;  4GX3 A;  4OVR A;  2JJK A;  4N81 A;  4OVQ A;  4PGP A;  4OA4 A;  1IMA A;  4GWY A;  4PAF A;  4PE3 A;  3FXB A;  4GWS A;  2WYP A;  3KC0 A;  4H46 A;  2GQ1 A;  4NHB A;  4PAI A;  4MMP A;  4PDD A;  1RDZ A;  4NAP A;  5I3S A;  2V3Q A;  4M1V A;  5IGA A;  2HZL A;  1YZ0 A;  1BK4 A;  4P1L A;  3E79 A;  2V4C A;  3MYU A;  5EQA A;  1DK4 A;  4NF0 A;  4PBQ A;  4XEQ A;  5JK4 A;  3RPL A;  4GBW A;  4YZZ A;  4PFI A;  5ET5 A;  1IME A;  1LBZ A;  4MAG A;  2DE2 A;  5ET7 A;  4AS4 A;  1FBH A;  3GYY A;  2VPO A;  5EQ8 A;  4DI3 D;  1KZ8 A;  1EYK A;  5I5P A;  3RYD A;  1FPD A;  1RDX A;  5J1D A;  1FTA A;  2Q74 A;  1KA0 A;  1Q9D A;  4HXV A;  4DI4 B;  2F3D A;  2XWV A;  4O94 A;  5FBP A;  3CHG A;  4P47 A;  1NUZ A;  4GWW A;  4HE2 A;  4OVS A;  4MCO A;  4PGN A;  2DVZ A;  2QVR A;  3W9V A;  5A5L A;  2HZK A;  5DW8 A;  1K9Y A;  1FBD A;  1KA1 A;  4PBH A;  1LBV A;  1NUX A;  3A29 A;  4IR8 A;  1FJ6 A;  2VT5 A;  1EYI A;  4N6K A;  3NOH A;  4N8Y A;  4N8G A;  4PFR A;  2B4M A;  3BIG A;  5F24 A;  4G61 A;  4AS5 A;  1FPJ A;  3ISP A;  2QPQ A;  2OWZ A;  2B4L A;  1LBW A;  1FBF A;  2XWO A;  2HPG A;  4PFB A;  1YXI A;  4OVT A;  3PTY A;  2DE3 A;  4H45 A;  3KC1 A;  4MNI A;  5T3J A;  2FIX A;  4MNP A;  4O7M A;  4X8R A;  5CM6 A;  4YIC A;  2ZZV A;  3RPL B;  1D9Q A;  1FPE A;  2PFY A;  1FBC A;  5EYH A;  4HCY A;  4F19 A;  3W9W A;  1FPB A;  1G0I A;  1LBX A;  1NV0 A;  1RDY A;  2WX9 A;  3FBP A;  1NV2 A;  4PCD A;  4MIJ A;  4FBP A;  4MEV A;  4N17 A;  2XWK A;  4NQ8 A;  4X04 A;  2CZK A;  4MX6 A;  1IMB A;  1K9Z A;  4GBV A;  4N91 A;  4OVP A;  1NV7 A;  4HCW A;  2XWI A;  3B8B A;  3KBZ A;  3LUZ A;  4N4U A;  2HXR A;  4MHF A;  2VPN A;  2DE4 A;  4F1V A;  1IMF A;  4I3Y A;  5IZ3 A;  4O7I A;  1IMC A;  1FPK A;  2L5V A;  1NV5 A;  2PFZ A;  2WBD A;  2KQZ A;  5IZZ A;  2Y5L A;  3QMF A;  4P8B A;  4GX6 A;  4PAK A;  2WEF A;  4F1U A;  1NV4 A;  1NUY A;  5ET6 A;  4P9K A;  2CZI A;  4GX4 A;  3B50 A;  1INP A;  2BJI A;  2CEX A;  2ZZW A;  3IFC A;  2DDK A;  5ESY A;  3T0J A;  3EKI A;  1NUW A;  1DBZ A;  3BIH A;  5LDZ A;  4N15 A;  5LTC A;  2P3N A;  3IFA A;  4I3E A;  1DCU A;  1FBP A;  3MST A;  4HE0 A;  5J16 A;  1G0H A;  4PF8 A;  4QBA A;  1FPI A;  4MNC A;  4P3L A;  1FBE A;  4NN3 A;  4UAB A;  3HFU A;  2ZZX A;  4PF6 A;  2Q8M A;  2FHY A;  4N6D A;  4I40 A;  2QVV A;  4QXD A;  4XFE A;  1FPL A;  4JVI A;  5IM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...