4NATA

Inhibitors of 4-phosphopanthetheine adenylyltransferase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
159
structure length
153
Chain Sequence
b'EHTIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLGTFSLEERMDLIEQSVKHLPNVKVHQFSGLLVDYCEQVGAKTIIRGLRAVSDFEYELRLTSMNKKLNNEIETLYMMSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopantetheine adenylyltransferase
publication title Discovery of Inhibitors of 4'-Phosphopantetheine Adenylyltransferase (PPAT) To Validate PPAT as a Target for Antibacterial Therapy.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase/transferase inhibitor
total genus 49
structure length 153
sequence length 159
chains with identical sequence B, C
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2013-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4natA00
4UZFA 1KP2A 5TGTA 1YI8A 1PFYA 1JZQA 3X1JA 3IMGA 1LW7A 3RFFA 4EG5A 1N3LA 3IVGA 3H9CA 5J58A 3P0JA 3CLSD 3DV2A 1WXEA 1J70A 3SZ3A 1QU2A 4DNXA 2A4MA 3FHJA 3HZRA 3I05A 4NX2A 1NUUA 5FO1A 1T6XA 1J21A 1OD6A 1OWMA 1R6TA 2CYBA 4S1OA 1J1ZA 3H9BA 2J08A 4E1AA 1IRXA 1H3NA 4EGAA 4KR6A 1MBZA 3VU8A 2JA2A 3SEQA 2JANA 2X0KA 3IOEA 1T6YA 3INNA 1TEZA 1G59A 4R2MA 3RBAA 3RJZA 5HG0A 1YULA 4MW1A 3FOCA 2WQ7A 1EFPB 2YY5A 3IMEA 4CT0A 1JIJA 4MW9A 1U3CA 1NUTA 3BL5A 3KT6A 4K0RA 2D54A 1JIKA 1YUMA 1I6MA 3FIUA 3ILVA 2QTNA 3CLRD 2PZBA 1R6XA 1K97A 2E89A 2IELA 4DDHA 4MWBA 1EFPA 1IQUA 2TS1A 2H29A 5DASA 4PBRA 3D6UA 1XNHA 1TYAE 2J09A 3N2YA 1Q15A 4MAFA 3ZIUA 4ND7A 1GZUA 1JILA 1XNGA 3Q12A 3MXTA 1NZJA 4HJRA 1KAMA 3LE8A 4YP6A 1ZH0A 3AFHA 4JZYA 3CLTC 1O0CA 3K32A 1JEEA 1MB9A 1MJHA 5FO0A 3E27A 3HGMA 2DLCX 1WZ2A 1WXHA 4MUGA 4MW0A 4U63A 3OTWA 1EUQA 4MVCA 4UZEA 4NAHA 5JBNA 2EJCA 1N2HA 1EE1A 4MUEA 3IOBA 1VBMA 4ND6A 3COYA 1P7PA 3P52A 3CVXA 2GOYA 3ZJUA 4ZCRA 2QTRA 1Q19A 2A1TS 4MVYA 3CVYA 1VLHA 3G59A 3H97A 2YWBA 4WNYA 3S3TA 3UMVA 4YBRA 3X1MA 2ZUFA 2JAXA 1O97D 3A4IA 2G36A 1F4LA 4BWVA 2ZP1A 3KT3A 2CV1A 2PG3A 1COZA 1T9GR 1WKBA 2D5BA 1PG2A 1BS2A 1KQOA 2O8VA 2QUHA 2CV2A 4PY2A 1JGTA 4MW4A 1J20A 1NI5A 1WXIA 4EG1A 4MW6A 3N05A 2H2AA 1UFVA 2GKSA 5DK4A 3N8HA 3ZXIA 3GLVA 2Z08A 3RK1A 1EUYA 1H1TA 2Z09A 4GU5A 1G8GA 1F7UA 1N77A 1GN8A 4JYZA 3DLAA 4QRDA 4P2BA 5AHWA 4X0EA 2WQ6A 5HUJA 1CT9A 3SP1A 5K0TA 4KR9A 1JEDA 1IQ0A 2A86A 2E18A 2NZ2A 2DETA 1U7DA 3P0HA 4ZT2A 3PXUA 1N2EA 1K92A 3CLSC 2D13A 1D2RA 1ZUNA 3JXEA 4MQ6A 1IQRA 1IVSA 2CUZA 2R5WA 1JHDA 2WB2A 1MAUA 3AL0C 1RQGA 4KKVA 5TEVA 3CVUA 1U0BB 1K4MA 2OV4A 3IVXA 1N2IA 4GRIA 4XFDA 1X8XA 2HZ7A 4ZT7A 1N2OA 1A8HA 3KT8A 2XRZA 1R6UA 1X6VA 2B7LA 3NV7A 4ZT6A 2QJFA 3H05A 3UC5A 2DR2A 1O95D 4J76A 2A7XA 1VBNA 4MULA 4MUNA 1LI7A 1O94D 2AKEA 3CA8A 4YP5A 3COZA 4RUKA 1WJGA 3TS1A 1KORA 1Q77A 2X3FA 3CVWA 4XSVA 5J59A 4ZT3A 4G5YA 2PZAA 1FFYA 3G5AA 4Q16A 1B6TA 5F23A 4ZT4A 1NURA 3CLRC 3IVCA 2E21A 3X1KA 4DE5A 1OWNA 1KH3A 1NYLA 2PXHA 3DPIA 4MLPA 2CFOA 2XRYA 3ZJTA 3QE4A 2X1LA 1QRTA 1WQ4A 4MWCA 1K4KA 3ND6A 1KH1A 1JZSA 2A1UB 1WXFA 1O96A 3FH0A 2AZXA 3LCJA 4EG6A 3TQOA 3AKZA 4J75A 2DXIA 1NUSA 3MMXA 3RK0A 4OUDB 4MUKA 3SDBA 1I6KA 1MB2A 2A1UA 3TZLA 3ZXSA 1QNFA 1KAQA 4XFJA 2BTEA 3K9WA 3FNRA 3IOCA 3AG5A 3KFLA 3M5WA 4CDNA 1PFWA 1OWOA 2I1LA 3L93A 4HJXA 1O97C 2J07A 1M8JA 3AIIA 3IODA 1IFXA 3VGJA 4DDKA 3QTTA 1KKUA 1TYBE 4OUDA 1QRSA 4K03A 1VBKA 3L92A 5DEOA 3Q10A 3UK2A 4EG7A 3HFJA 4NAUA 5LM3A 4EFKA 4NATA 3IDFA 3SYTA 4ZT5A 3ISJA 3VRHA 1IHOA 1TYDE 4I6GA 1OBCA 4HPWA 4YMIA 5KWVA 5EKDA 3HMQA 1XNJA 1O6BA 1N75A 3D6VA 4EF6A 4TS1A 2V0CA 3C8ZA 3CR8A 2VTBB 1U7XA 1LI5A 4I6EA 1JIIA 1YIDA 2QUIA 2WSIA 2V0GA 4NDAA 2BYTA 4A91A 4KPUA 3ZGZA 4R0NA 4U8HA 2VXOA 4JFAA 1SURA 1QJCA 2OQ2A 4MUFA 3FWKA 1Q11A 3CVVA 1MRZA 1TYCA 2DUMA 1TQ8A 2QJTA 3TQIA 4ZCPA 3GUZA 4Q93A 1QTQA 2C5SA 2IP1A 1N2GA 1J09A 4ZCSA 2VTBA 1G8FA 3CLUD 2IJGX 1O5TA 2GM3A 1OWPA 3Q4GA 3IUBA 4AS1A 3A04A 4FZJA 3SEZA 2NSYA 1XJQA 1WXGA 1QU3A 3ZJVA 2A1TR 1H3FA 4NZPA 4QREA 1IH8A 4JXXA 1GTSA 3IMCA 2CSXA 4MVXA 2QJOA 2PIDA 5TEWA 1Y42X 1I6LA 2Z3VA 5TS2A 3U1VA 4OJMX 3UY4A 4F4HA 1JMVA 1U3DA 3G6KA 1HYBA 4MUJA 1N2JA 1O95C 5J5AA 1N78A 1TFUA 1YUNA 4ARIA 1V8FA 1O94C 3F3MA 1M8KA 4F3RA 5H7XA 2HGZA 1V47A 5K0SA 3FI0A 3ELBA 4CDMA 4U7JA 4MW5A 1ULHA 1OBHA 1O96B 1F7VA 3IH5A 2E0IA 1WY5A 2RE8A 4HK4A 3TNJA 4ARCA 1ZJWA 1NP7A 2O5RA 1KQNA 1H3EA 1I2DA 1KR2A 2CT8A 4KR7A 1ILEA 1NUQA 5IJXA 3ZUGA 4G6ZA 1KP3A 1MOPA 5DB4A 1GAXA 4DJAA 2A88A 1T6ZA 2X1MA 2AG6A 2DPLA 4ZCQA 2A84A 3MLBA 4MWDA 3A2KA 1T9GS 2J4DA 3HV0A 1ZH6A 1GTRA 4MUIA 4AQ7A 1GLNA 2YWCA 2EL7A 1G8HA 1NSYA 5FNZA 1PFVA 4DDMA 4EG4A 3H99A 4MWEA 2PFSA 1N2BA 3DO8A 3FETA 4CQNA 1M8FA 1EJ2A 3PNVA 5H16A 3NBAA 4L2IB 4RPIA 1NUPA 1O0BA 3SZGA 1M83A 3ND7A 1M8GA 4MW2A 5LFAA 1VL2A 3FY4A 2YXNA 3MLAA 1F9AA 2CV0A 3CLTD 2ZUEA 2RD2A 3COWA 4ZCTA 3A05A 4JXZA 4G5FA 2J5BA 3FG9A 5IHXA 1KH2A 1PG0A 5BNZA 3N9IA 3PNYA 4QBTA 2DERA 3AG6A 4L2IA 1MC1A 2PZ8A 3NBKA 3KT0A 4I6JA 2CYCA 1EXDA 3FDXA 4KPUB 2QTMA 4DLPA 1JECA 4MUHA 1EFVB 3GMIA 4H3SA 1OWLA 3ND5A 4R2LA 1J1UA 2CYAA 1YIAA 2HMAA 3P0IA 1M8PA 1MAWA 1GPMA 2DEUA 4EG3A 1WOYA 3LOQA 4MW7A 1S4MA 3IUEA 3MUEA 1M1ZA 4EG8A 3QTBA 4PBTA 1EFVA 2QUJA 5LLTA 1PFUA 1DNPA 4PBSA 1FYDA 3RHSA 3COVA 1QQTA 3PRHA 3CLUC 1WQ3A 3PNBA 1KQPA 2QUKA 4MVWA 5KHAA 3HL4A 4WSOA 3OP1A 5KCMA 1N1DA 4YP7A 3UOWA 5HUHA 1QRUA 3TZEA
chains in the Genus database with same CATH superfamily
5K09A 1CEEA 1GRQA 2A57A 1YR1A 4LZOA 3E4DA 1L4NA 3MK31 4ONEA 4NARA 2EBHX 4Z53A 4GWGA 1G64A 3TI9A 3LVQE 3AUTA 2GEUA 1P33A 1N7GA 3ICWA 4M36A 3U17A 2F7SA 3ROEA 2BKEA 1M73E 2XRFA 3K96A 4MV4A 3C87A 2PANA 4YP0A 1RAGA 1Y5MA 1AK9A 2R5NA 3QXHA 4MGHA 1HX7A 1M7BA 2GEBA 2G67A 4NBUA 5HFAA 3VPAA 2O2DA 5E95A 4ENTA 4Z51A 1M2OB 5BVHA 4EPTA 4NX2A 1NUUA 2XEXA 1I4WA 5F3RA 1TQHA 3CNEA 3OIUA 1SKQA 2EKDA 2Y1WA 4MXDA 3WQQA 4DN6A 3QPCA 3WLNA 1UDBA 5A6SB 3MCVA 3VDQA 4BLWA 1Q7BA 1IJBA 3VPDA 2W58A 4QDZA 4EGAA 3GVXA 3NKLA 4XWOA 4H7JA 2ST1A 1YDHA 4YLGA 4WH0A 1QV7A 1P74A 1IPHA 2B4TO 3GELA 3K09A 4BZXA 5K2MA 1XZAA 1LPPA 2VXCA 3HEMA 4NV3A 4RY2A 1JLSA 1YOVA 2R8OA 3IT1A 3FOCA 3MGAA 5ALOA 3KCQA 3OZCA 4RDHA 3NBXX 2PN1A 4RPHA 1UBGA 3V1TC 1OHHA 1NPDA 3EVNA 4KE8A 1X1RA 2GD0A 3FWPA 4K0RA 5LQAA 5DI9A 2XGMA 3UYLA 3W8DA 3EEOA 5TVKA 5EC8A 2P9HA 1YS6A 2OXEA 2C54A 1W35A 4HWGA 1MQ8B 2HL6A 2R1VA 2QTVA 2V4MA 1B93A 1EGMB 4MR9B 4AMYA 2XE6A 4CTJA 4E1BA 2V7WA 2PZBA 4F2HA 2WE7A 3FOBA 5TXGA 1Z39A 5HNKA 1TW3A 4J49A 1M2JA 4NE9A 4WW0A 4REQB 5DTEA 4LJRA 3VKVA 2J9FB 3MMSA 1NQAO 1XO1A 2Q28A 2Y1OA 4PX3A 4RK5A 2X0DA 4JLBA 3RYFB 5JSZB 1C1DA 1X14A 3N28A 1E58A 4HX2A 5JD5A 1KEKA 3HUDA 1VGQA 1ABBA 1EA7A 5BWNA 1HDYA 1TU4A 1Y6JA 5AJHA 5WRFA 4CTKA 5LQUA 1QKJA 4AFNA 4JZYA 5EHIA 1W2GA 2AOUB 2OC4A 2OO3A 5IT4A 3LW8A 1IAQA 3INRA 1JEEA 4NJEA 1F06A 2BH2A 1KRWA 2ZS7A 3IJ5A 3K9FC 1OXKB 1N5IA 3LWDA 1JR4A 4Q7LA 2GCOB 3S8EA 1DRKA 1O4WA 2B7CA 2QN6A 4MWOA 1TUIA 3MCAA 3ECSA 4E4YA 4U1RA 3N76A 3OX1A 1UJ6A 3EZYA 1ISPA 1NASA 1O0SA 4XAQA 4DMUB 3EGXA 3PEEA 3AV3A 2BISA 3QE9Y 3GAAA 3QUSA 1H2ZA 1VKZA 4WXEA 3CVYA 1BHQ1 2YR0A 1IHPA 1IY9A 4LXHA 4C5AA 3S3TA 4CQMB 5AW1A 2JLZA 4B3MB 3X1MA 2JAXA 4DLNA 2CNOA 3SHFA 2R9VA 2QE6A 1TLFA 2ZZKA 3E35A 3P2OA 1E6CA 2Z3ZA 4LWOA 1V1MA 4DYHA 1WV0A 1M10A 1XG5A 4L0CA 1H2RS 1SIUA 2FRXA 1HNZB 4KO1S 1L5LA 4KPGA 4GUDA 3H8SA 1RI1A 3UUFA 3EEYA 4HC4A 4HPJB 2IUTA 4QGSA 3UHFA 3KV1A 5CNIA 4BDSA 1QWOA 5J2TB 1WMDA 1E1CA 4QTZA 4DR6B 1B8UA 3DE6X 5K4AA 2FW0A 1QHNA 1PV4A 3ADBA 4QU0A 1C8BA 2O2GA 1N0HA 2IYQA 3SYMA 3HUEA 4D4JA 5AVWA 5FKJA 1URPA 1PGNA 4GR4A 1L1FA 4JYZA 2Z6QA 4FS3A 2QR5A 2A59A 3SS8A 1M1XB 2OZVA 4NHEA 4HNGA 4FP9A 2C4KA 2C5GA 3AETA 1MX1A 3NBQA 1QQ6A 4ZHQA 3KG2A 3JTMA 2GZRA 3OFJA 2F59A 2QDXA 4JLMA 5BYJA 2OCAA 5JNRA 3NIFB 1OMOA 1K92A 2CWWA 2M2IA 1P4GA 2QVCA 2LVBA 1W4CA 4U0JA 4AP6A 5REQB 1N2SA 3S1AB 2CVPA 3JYHA 4BNLA 1EP3B 5EZ6B 3AR2A 5ADVA 4XIGS 4BLVA 1G5HA 1I6WA 1HURA 1KBOA 3L8YA 3THXA 3QIVA 1H2WA 3OJFA 2Q9AA 9GPBA 3IHWA 3C3BA 3KOMA 3QNWA 1DUIA 2WTMA 1TMKA 2BGIA 1DAMA 4FKZA 3GLIB 1CFZA 4O2BA 2XUOA 3LWZA 5A2QA 1W4BA 4YMLA 3GD5A 1WZIA 1OROA 3UHPA 2HZ7A 4GM0A 4LNHA 4UTXA 3T7TA 4B47A 1NYQA 2W6QA 1VYTA 2VVTA 4TS4A 1DINA 5F1YA 4GLFA 5E0KB 4KQXA 5FUVA 5H70A 4DT1A 1SZCA 5FV4A 1PR0A 1IATA 1SBNE 4UOQA 1GTL1 3EASA 2ZT6A 4KYTA 5DP1A 2QRLA 5BORA 2FETA 3BULA 3OOYA 5HF9A 1QAQA 1AQJA 3G9XA 3KR1A 1CLUA 5LDGA 1UOQA 1QANA 1A8SA 1T2FA 2J0UA 1ML4A 1T9HA 1WU7A 1J8MF 3WV4A 2GWHA 3AERA 3CLRC 5KSOA 1YTLA 3GFBA 3N8NA 3EZ2A 3CURA 5JAMA 3RTCA 1ZLYA 2XECA 3JQRA 5EMMA 4FFBA 1I4TD 3CCBA 5DWQA 3F78A 3TGWA 4B6QA 5IAGA 2JBAB 2YV4A 2BSAA 3UHAA 2WSSA 1DQZA 3SQNA 5KQSA 2ZJ6A 2MSEB 4PPFA 4WTOA 2FMTA 3QX3A 2QVGA 1O95A 3QSYA 4PYLA 4NCJA 5H68A 1R4MA 2TMGA 3GRVA 1E7QA 5ICGA 1U8XX 2DJ5A 1N8NA 2UXDB 3HA7A 3IKJA 1C2TA 1W47A 2VWQA 5DHTA 2JI8A 4YQEA 3Q87B 1PDOA 4IVQA 3ZK9A 1YFZA 3I5YA 2ZJFA 4M0FA 4F7WA 2YW9A 4YYEA 1LI4A 2G7ZA 3TTXA 1IBCA 3AUAA 3M1IA 3FFTA 4H18A 2E37A 1UBUS 1UP6A 1CC1S 2ZUCA 4LJ8A 3MMXA 4BLOA 1PR6A 3NIDB 3EXFA 5HFJA 2W6ZA 2ZBFA 4PF1A 1RZVA 4JNKA 1LJLA 3N0TA 3MVEA 1VHDA 2EFDB 1K75A 1U3VA 3AI1A 5L6MB 1LJ8A 3TK1A 2RFLA 1P39A 2WU8A 3QM1A 3RAJA 3PC4A 4EKNB 3C74A 3G0GA 2ILTA 1BJRE 4YPFA 3M5WA 2BEJA 1NJ6A 1JX6A 5L45A 3G2QA 2AFHA 3DVAA 3FVRA 4KLCA 5DGCA 4XQGA 3CZQA 1L9XA 4AUEA 1E2EA 1L5GB 4OAPA 1PUJA 2JFQA 2PZKA 4G26A 5KPDA 4FE7A 4FWTA 2AE2A 1XAGA 3U80A 1Y89A 3IEVA 1R9GA 2XVAA 1L7NA 1O54A 1OXSC 1TVEA 2PVCA 1IHXA 1VIVA 1XMIA 1DELA 2YRWA 3Q6NA 4PC7A 2I1WA 1YQXA 1KSFX 1L5HB 3EIWA 1ZY2A 2D6FA 4C14A 3BRQA 5JSUA 2VDLB 1XZJA 3WISA 5KYTA 3BDVA 3UK0A 4WX2B 2AWOA 2OPBA 1D1QA 2IKQA 1VZ3A 2NTJA 4IHJA 5ALUA 2QX9A 1OXVA 1M33A 3ENVA 2PM8A 1W59A 3L06A 3OZVA 4ARSA 2ZIGA 1UK8A 5MFPA 3GRRA 4CV1A 1A1VA 1GQSA 3P9CA 4DUZB 3I04A 1Y7LA 3O7MA 4W1SA 5EPUA 5C8VA 5KINB 2UZ0A 1T3ZA 3L1JA 1NM5A 1JFTA 1EDDA 3KTAA 5KX5A 4PG8A 3JVUA 2XEDA 2F67A 4Z0NA 1X7WA 5FBKA 4NBNA 2JGFA 2YXPX 3GP5A 4GOKA 5AICA 1N5OX 2IOQA 4AX4A 2BYTA 4BO7A 4MRNA 3ZW8A 1K2WA 1DKOA 1ST3A 4EKEA 1Y4DE 5K0LA 1ZXLA 3TXAA 2XXAB 2C5HA 3KQOA 1Y4SA 4HDRB 3OF3A 3DHYA 3A1TA 5IDYA 2ZIVB 2PXAA 2QN2A 1Z7YA 4TN5A 4YAEA 5KJCA 3KB8A 1L7DA 1BROA 4HSGA 1TIKA 1YB6A 3GA0A 3LQYA 2IYAA 2W2NA 1GCOA 3G7UA 2VH1A 3AIKA 4RVNA 3R9IA 3ZDFA 4ZDIA 3DMYA 1J0DA 1CQWA 3FCUB 1KDPA 3S2GA 3DZIA 2NUPB 2DVMA 2ZU6A 4TKVA 1MABA 3A1CA 3LQ1A 3UMYA 3OFSA 4XM2A 4ESVA 1M3SA 1T3HA 2H0RA 1EP1B 1WXGA 2YRXA 1NG9A 1YR3A 3NAQA 3RASA 4FZ3A 4JXXA 3VSEA 3G49A 4YRSA 1DIBA 1GFIA 5LQCA 4JJKA 3AZQA 4G0VA 3UB3A 1F4PA 1XCMA 1MR3F 1G63A 1NUHA 2IPAB 2BM8A 4DJJA 4YIHA 1XJ5A 3LLUA 4HG2A 4UBJA 4V3BA 4MRMB 4O5AA 2RGUA 1ZU4A 5JSHA 4RNDB 3CONA 3N8KA 4PYRA 3T7AA 3W2HA 2OK8A 3I6QA 4DJTA 3LLVA 4MJ3A 2PSJA 1SIWA 2HGZA 3HYRA 4IZOA 3PPVA 1WBDA 2V0NA 1ZCBA 3ER9A 4BV8A 2MSLA 2NU7B 4L76A 4DTIA 1QBGA 1V9CA 5EFZA 2C7PA 3SKVA 2LXNA 4L74A 1WPGA 3S7TA 1WO8A 1JW9B 2E0IA 3JQBA 1ZM2A 4LFBB 2BM0A 2DWCA 1OYOA 2D4HA 3JAWB 1SBZA 3HWRA 4I14A 4OQQA 3BWEA 3LC1O 1YWGO 5ESWA 4IIXA 1AZSC 4BEBA 4CFSA 2FR8C 1ILEA 1XKXA 4IRMA 2JL1A 4TZ6A 5BUSA 3RYHB 3EC2A 4G6ZA 3WYEA 3MT7A 2FN7A 1XZIA 3LYHA 3AVQA 4ZV7A 3RARA 1CR4A 2QI9C 1KU6A 1L4LA 4OB7A 1EQUA 2DPLA 3RCBA 5GINE 4PC1A 2R7KA 1ZWLA 2FK7A 2JCVA 3G5TA 1CEQA 1PJZA 2B2NA 1WW2A 3E1GA 3GF4A 3H4MA 3L7CA 3QUQA 4JYPA 5AK4A 4S0ZA 4DA6A 2RCNA 2HRZA 5FUWA 3R9XB 4FJ1A 2BP7B 4JQZA 4DA0A 2BGMA 4BVHA 1J23A 3SR4A 2XE8A 4RDIA 3O90A 1AVTA 4NCAA 4I8XA 1H2HA 4P3OA 2XR1A 1PFVA 1UR5A 2ASVA 1SCUB 3Q0EA 1K3TA 1I3KA 3O8OB 4HXGA 4MWEA 5EIXA 1EPUA 1N2BA 1H85A 1JQLB 2PFSA 3DO8A 4QOFA 1NG1A 1M7GA 4GBED 4JROA 5JYCA 3RC7A 4G85A 5EJ2A 2AZMA 4MZXA 1I7PA 4C4YA 3WRWA 4DABA 3SZLA 3C3WA 3CT4A 1JVSA 2IOHA 3SZGA 4NBTA 5DWVA 5EVCA 3OZFA 4AZWA 3FHTA 1QO9A 5H1YA 3U3MA 5JYDA 4UAJA 1TZKA 1XTKA 4S1TA 5GIPE 1LLFA 2A0XA 5EP2A 5K0NA 1H1LA 2HJ9A 3QX9A 3PHCA 3U9SA 2EW2A 2PFGA 3VV3A 4Z4GA 5CT9A 4B3BA 1LQUA 3T7KA 2Z9CA 2HQBA 4ZGGA 5LXTB 1VECA 1E9EA 4QBTA 4S05A 3GVHA 3I34X 1WDKA 4O4HA 1QG4A 2IX9A 4HDNB 2CW5A 3LOPA 1CZHA 1NYRA 4BO6A 3OEED 3T0FA 1Z4JA 3QU9A 1EFVB 4HYYA 3DFUA 3NYIA 3VH2A 2AMLA 4S1WA 1SBIA 4X93A 1SIBE 4G9EA 3OQJA 4Z2AA 3P0IA 1M8PA 3TN7A 2QE7A 1J49A 5DXJA 1WDLA 1GU1A 1PDWA 2OGWA 3DZGA 3RHFA 4QOEA 3TLKA 3MTJA 1K7XB 2B5WA 2OBYA 2I6QA 1KAGA 1S8OA 4M0MA 4KGZA 4N18A 1E2IA 3D3WA 1N3YA 4LYFA 3TQQA 1CD5A 3W5CA 4WDRA 4CT5A 1YBVA 3ADDA 4WT7A 4Q19A 5A3VA 1R16A 2QUJA 4GP6A 1KQ3A 2YVQA 2BI8A 3NJRA 3HBFA 3LFUA 4LZLA 4TROA 4BMOB 4PNEA 1Y5NA 1Y4ZA 1EA5A 5AKHA 4PBSA 4BLUA 4QRIA 2ZIFA 1KJ9A 3EYWA 1H8HA 1TKAA 4DMCA 3CLUC 1P0QA 2N1BA 3NHRA 3AJAA 3L41A 5GGXA 2H59A 1JR3A 3JATB 4BQOA 4RSHA 4Z9BA 3IDAA 3VYVA 5CT4A 4BFSA 3S7ZA 3LBIA 1Y8QA 1VQ1A 3I6BA 5LR6A 1W5SA 4G81A 4MA0A 4CKWB 4DZZA 3I45A 3FLBA 2R1ZA 5FOQA 2Y6UA 3KDPA 3D8RA 2C7QA 5KOHB 4OYLA 5JAPA 1KY2A 2YXDA 3C6QA 2AX3A 1EP2B 3FUCA 5DBEX 2HHHB 1XQ6A 4A0RA 2XCOA 1KHHA 1O8BA 3C6MA 3P0JA 2HDOA 4OSEA 1E2NA 4RD2A 4RIIA 1JB1A 2GAFA 2WJ3A 5G4KA 5KYUA 2DSNA 5DE3A 5EL0A 1ADFA 1J70A 2ROQA 4G41A 3H2HA 2H9IA 4KXVA 1DDIA 1Z4NA 5BUQA 1ZW6A 5EJ4A 3VHRA 3K0BA 3V2UA 3B60A 1ZR2A 1OWMA 4BNIA 4E1AA 3H9BA 2CJWB 1GRVA 4Q05A 2X9LA 4U7GA 3G9UA 4TWAA 4DV1B 2ZK7A 5LMNB 3A1SA 1JEOA 4A6EA 5BXQC 4EVQA 1OTXA 1RWQA 2ZE8A 5CIWA 2B92A 2J31A 3VO2A 2FP4A 4YCLA 3O3MB 1M34A 2ZRMA 4BQIA 3C5EA 3R3ZA 1BX1A 2WJIA 4RV9A 1SO8A 4YREA 3U2QA 1U5BA 3FOAA 1LW6E 1T1IA 1XZKA 3ZEIA 1G59A 1E1KA 2PRIA 4R2MA 2AB0A 3RJZA 4K46A 4ROSA 1JEQB 3NR2A 2DWOA 1MA0A 1B26A 2PCLA 3R44A 4RNCA 5FI3A 3C6BA 3P9NA 3RAEC 1FMTA 4WXHA 3CVOA 2BE7A 3CPEA 1QC5A 4KLAA 1J0XO 3CZAA 1PD1A 2YOFA 2O4CA 4HWRA 5G0TA 4YJHB 4KO4S 1NUTA 1XRLA 1ZAKA 5HKLA 1AA6A 1H4TA 3BJIC 2BGWA 3HZZA 5DM1A 3PPIA 4KTVE 5H59A 3ZCVA 2I7CA 4UARA 4KNYA 3ZWNA 2MYNA 2VP6A 3D3KA 1LBSA 4OKIA 4J4HA 3O2NA 4BNUA 2FXIA 4KE9A 4JXKA 4AJKA 4MWBA 3ZE2B 3HDQA 3LQ4A 1DOZA 4A6PA 4OI0A 1JT2A 1ZGZA 1U7HA 1Z2AA 2HHCA 2NZWA 5C4GB 4FI3F 4J1TA 1N8SA 1TYAE 4BMVA 1Q15A 1FFSA 1NVVR 4HRYA 4AMGA 1JILA 1D8AA 1NVXQ 5DBGA 4L9RA 2FOLA 3DDSA 4PX2A 5CVDA 1KI8A 1B8NA 2R1TA 1F17A 3BE8A 4QBIA 4D3YA 5ESXA 2XVMA 5F52A 4MPPA 3AFHA 1TTQB 1OZGA 2RHCA 3PL1A 4BEWA 1ZD4A 2XQIA 4MIYA 3G8CA 4YMSA 2AJTA 3H9GA 3I73A 5FUXA 3L1IA 1ZCFA 2GN6A 2WF7A 2DLCX 2FFHA 3N6XA 2BFDA 2PQ0A 4G5HA 3HZOA 1YB1A 4GEKA 3ZGVA 3E22B 4MVCA 4TM7A 5HS6A 1XRPA 1QQ5A 4GXQA 1COWA 4N3GA 3LDHA 1QRRA 4HFJA 5FTLA 4PSAA 4PRYA 4ZVUA 3R3SA 4M0LA 2Z6UA 3RBXA 1T5HX 1U9JA 3EG9B 2SCUB 3F7TA 4J16C 2QMQA 2K2WA 5A2GA 1F38A 3ZDXB 1DC4A 1ODFA 1WNTA 5DPMA 1FFXA 2FPMA 4DMLA 1LY1A 5BV0A 4GE3A 2VP0A 3AESB 3B1FA 2FZGA 5C35A 1EXVA 2CHUA 3NANA 2JKVA 2A9OA 5EUCA 3PQ4A 2VUSA 1CFJA 4R1UA 3R3UA 3WRYC 4ZVSA 1A77A 1KQOA 1KGSA 2AMVA 1ACJA 4LIPD 5I9IA 3LCMA 4ZYYA 3MWDB 2R7NA 3DTVD 1YJBA 4L6IA 1BVYF 1XDSA 3A32A 3DZBA 1WXIA 3OA0A 3TW8A 4DV4B 4EG1A 2W2LA 2NYAA 4L02A 2WAOA 2ZXEA 1BFKA 3BJZA 1OSNA 4N9QA 3MUFA 3Q40A 1WAMA 2XYRA 4BNFA 2I6TA 1OUMA 1AXEA 2NXCA 1E4YA 3LU1A 5KVVA 4BFZA 4AJPA 2UAGA 1A4RA 2VDWB 4B4DA 5AJVB 2QXYA 4N54A 3VBCA 2BKVA 2H7VA 3CEMA 4YRCA 1AO0A 2IXAA 2P6NA 1G20A 1KZGB 2VHXA 3NJ4A 4QBGB 2IY9A 3WWZA 1CUYA 4RPCA 2C5EA 1EWTA 3GT4A 2UYYA 2WVGA 1REQA 4WAUA 2VK4A 3W6UA 1BHJA 2V7PA 3TAXA 1HNWB 1K5PA 3I0ZA 3EY4A 1ZN2A 2CVOA 2JCSA 1T5IA 4JEUA 3D81A 4PO1A 1C3LA 3ZH9B 2P2NA 5I3CA 3O93A 2QTZA 1WB9A 4FW8A 2EKZA 3DPUA 2H4WA 2ECQA 2PBZA 3C7TA 4PQYA 4Q1CA 4HB4A 1Y98A 3Q98A 3LZCA 1ILWA 3D4NA 3FFBA 4J8PA 3G8BA 3LCCA 2LPMA 3GUCA 3T6KA 2P8JA 2H1HA 1DBPA 1XK6A 2W6JD 4PG6A 2JGEA 1TD9A 3ICCA 3R7DA 3ZLJA 3RS7A 1HG1A 2B1RA 1B6GA 1QIJA 2OV4A 3CSUA 2JGIA 3FVTA 3OVMA 5D5HA 3W3AD 3VTKA 2P2DA 4AZ0B 2BHNA 2H1IA 3ESXA 5KNCD 1K6IA 1SQFA 1V6CA 1DUVG 1P2SA 2FLKA 4GRIA 2H2FA 4TMFA 3TECE 3KWLA 2H0QA 1A8HA 3A9WA 4U7HA 5JD6A 4DWJA 4JI5B 1WEHA 2XRZA 5IM5A 3FGOA 2JKZA 2B7LA 4FDMA 1WPQA 1XZMA 3EE6A 2B0JA 3NALA 1S6YA 2UVPB 3PXXA 4G8JA 4XFKA 4E13A 4F38A 3H6KA 3H87A 4XDZA 2BWJA 2A7XA 4OLHA 5TF4A 2ZYTX 3W34A 3HCPA 1PZEA 5DOZA 4F7DA 3AR7A 4L5BA 4X1OA 5LQJA 4BRUA 1EUDA 3NRBA 4NESA 1QRDA 2CJFA 4FDUA 1LPSA 1NXOA 2X41A 1G60A 4MQEA 2WWRA 1C9MA 2WD8A 5F23A 1T9KA 3HYTA 3CUYA 3BAZA 3IPXA 1G6Q1 1RKBA 5FP0A 4P54A 3ZW7A 2VPZA 2Q4RA 4ESHA 5ICEA 5HILA 1KH3A 1ZISA 3IXMA 1B1CA 1U11A 1RYMA 3K30A 4OM7A 5ES3A 3SMVA 3WIVA 4C7MA 4DJDC 2E3JA 2X3UA 5JAOA 1QLHA 1CR0A 1QRTA 4N8DA 2BFMA 2X0RA 1KJJA 4MWCA 4UUOA 2HX1A 3S8MA 4Z9XA 4IH4A 1G0OA 1G21B 4CMJA 3L6UA 3MUOA 1FZQA 2JIQA 4DA8A 2P2ZA 4HZGA 4QAJA 1XZGA 1W52X 1DAPA 3TO5A 1D0IA 3I30X 2A1UB 1FUYB 1RS0A 2VJMB 2JLUA 1M66A 1CZUA 3P0EA 4EUNA 5JW6A 3ADCA 2JLCA 1Z7BA 3MFYA 4F86A 5HR5A 2JDIA 3CNLA 3HTXA 2IQIA 4QYXA 4U02A 4GPD1 4FFNA 3LZ6A 5TMPA 4KLNA 2DR3A 4MHTA 1K9SA 1Y63A 2FMIA 4AKGA 3V4FA 1P19A 3D5QA 4IBOA 1GSOA 4FX5A 4FSHA 3BG5A 4JOCA 3AB3A 4URWR 4ZTUB 2A9FA 4IIGA 4IZ6A 1UPFA 1FXWA 1QG6A 4ZO6A 4CWAA 1Z06A 5D3ZA 3H5NA 2I3ZA 3HNOA 5F12A 5IXSA 3JQ8A 5ECYA 4R7ZA 2PQ6A 1II8A 1X0VA 4COKA 5CFNA 5LQNA 4KSYA 2J6CA 3ZWDA 2JI4A 1X92A 1NMQA 4R7GA 3DL0A 4BX3A 3C3JA 2R65A 4PWYA 3MN1A 4L5AA 1PR2A 3D8BA 3MRTA 3LW7A 4WNAA 3RHTA 4PSUA 3F0TA 2IEBA 1E5XA 4Q7MB 3IODA 2BMWA 2SECE 1EDZA 2PJZA 5F7OA 5IFKA 3KK0A 3LRPA 3JZAA 3H84A 4FONA 2VP5A 4KU4A 3DLPX 2JFFA 1YRWA 3EXHA 3U3KA 4FFRA 2VAPA 3HFJA 4DJ5X 4TYWA 3NDRA 4REMA 3KXPA 1RTTA 1HLGA 4NATA 3IDFA 2DY0A 2GJ9A 2XIJA 5P21A 1U8FO 4U7WA 5HPYB 4JLUA 1SCAA 3GZTB 3PFFA 3DVSX 3FPBA 1AQYA 3JYQA 3LHFA 2YWGA 1ZCJA 3O95A 5INTA 5JC1A 3K70C 2Z4SA 4PYNA 3AVOA 5JG7A 3ZBTA 1CVIA 4WL0A 4JJAA 1RHKA 5CFRA 4I6GA 1P2UA 4P5EA 1JJBA 2X9VA 4RVUA 1SH7A 3SK0A 3T41A 1QHHB 2AFHE 2IPNA 4WKBA 1UAGA 1V9SA 3D6VA 3CGWA 1DV2A 3Q9LA 3ZNQA 2WZQA 3D3NA 3QENA 4N39A 4RTPA 3Q3GE 4PAMA 2J87A 5JO0A 1MJ5A 4ND8A 2C2KA 2C7GA 4G1EB 3HXPA 5DU2A 4LEIA 4ZDWA 2FWIA 1J06A 4J4BA 2PL1A 2DTDA 2ZBQA 2ZI3A 3WLPA 3JQFA 3D4OA 4CLOA 2OQ2A 3DHWC 1Q1ZA 2ZQYA 1LDGA 5JBQA 2RGRA 4IH1A 1PR5A 3EGOA 1YZKA 5TPWA 4CIYA 5BMVB 1RYHA 3LBAA 3PRKE 3DA8A 5LBIA 3OAAA 1MPXA 5I47A 2KYRA 2Q3MA 2IP1A 3EWSA 4V0ME 3VOBA 4CR7A 5JAZA 5I8PA 1W88B 3NYQA 5DW3A 3MRVA 4GL4A 4KWHA 3QF4A 3IKVA 3NHPA 1ECFA 3P9ZA 5TQ0A 2HT1A 3MRXA 2W2QA 2PAAA 1VA5A 5AVQA 2CLDX 4B8ZA 5ITZA 4JEMA 4YUZA 2VOJA 4MROA 2FWRA 1E94E 4PX9A 3LK7A 4QOGA 3MTDA 5BW5A 3DKRA 1NN1A 1AM4D 4L75A 3HH8A 3PI6A 1U3DA 2IYXA 1OLUA 3G6KA 4HOYA 5EQJB 5BUCA 1KSGA 2VS1A 2R7AA 1K66A 5KKCA 3GGPA 1TFUA 5PGMA 1U3FA 5ILOA 1XLTC 5BXYA 1E6LA 4FPXA 3EH1A 1Y8ZA 1DTWA 1HT0A 1LWOA 3A3KA 3EJ6A 3CRMA 3FVQA 4XB1A 2PKQO 3PLNA 2UZ4A 2W0SA 2P68A 1R27A 5FOTA 3L4KA 1SRRA 2Q46A 4L5IA 4UHEA 2BDEA 5JISA 2HU5A 2C97A 1JHRA 1FQWA 1YTUA 3PHBE 4ZZ1A 4BGUA 5FTKA 2VPTA 2G08A 2O5CA 4EAAA 3OLVA 4GRDA 4NULA 4ENPA 2IEIA 3PHLA 4ARCA 2O5RA 1QCDA 3KIPA 3BIWA 4WLFA 4ZYXA 4KR7A 3KL4A 1NUQA 3DE1X 4HXYA 5BWBA 1SUPA 1J90A 3U4AA 4P33A 4NYIR 3L1HA 1JNYA 4RH3A 2G9NA 1XZPA 1LX6A 3P9RA 1OXTA 5BOSB 4IEEA 2OBBA 3DKPA 3GRAA 1V5WA 4I4CA 4D5GA 1M2EA 3LVRE 5J1TB 5B4UA 4MKRA 1VIAA 8OHMA 2R4QA 3MLBA 4X24A 3VTZA 5IASA 1DEKA 3GT3A 1E3SA 5AI8A 1UOEA 1L5FA 5CVVA 5DCLA 1GPYA 3QSGA 2OV1A 3ZCPA 2J0SA 2VSFA 3KTFA 2I1VB 2XUKA 3PFIA 3DDWA 1PT7A 4RAQA 3MHPA 5FNZA 4P4SB 3BN3A 4V3CA 5FHQA 3LCVB 3H2ZA 5G40A 4S24A 3FETA 2DT8A 5D3QA 1PVDA 2JZCA 2MINB 3SQLA 4NQZA 3D6HA 2O57A 2XB8A 4AK9A 1TZJA 2I8CA 5EYPA 5B3JA 1ND5A 3BB4A 2RBKA 2ONZA 3IIMA 1S89A 3R6GA 4KZPA 4CODB 4S1PA 3DE2X 3C8MA 1UOOA 5AVVA 4GMKA 4ZO8A 3VHQA 1BU5A 1FMJA 3I12A 3I9JA 4MRSA 1MN6A 1X1TA 4C4OA 5ALFA 2ERYA 1KERA 1TA9A 3CXUA 4LTDA 1FX0A 3DMTC 4TLLB 5LLSA 2V54A 2C9ZA 4ZREA 5LM3A 5EUQB 5C5DA 2XCTB 1DJMA 2RAPA 4CLHA 4ZA2A 3M3HA 4DVJA 5CCXA 2BEWB 4KREA 1HKHA 5DMXA 2HQRA 3B3AA 4ZJUA 4DSOA 1TJYA 1LSJA 2Y1CA 3AXTA 4FUQA 2DM6A 1Y6GA 5BY2A 3Q41A 1RCTE 3J80A 1XMVA 2YXEA 5LSAA 5TJ9A 4V03A 3T3MB 4Y6LA 2PU5A 1AXRA 4Q66C 3BTVA 5CFOA 4D26A 1BH6A 3NEYA 4D4HA 5HOEA 3DEIA 5A1TA 5IAOA 3D6AA 4PGHA 1ZG3A 3TTVA 4F11A 1D6MA 2B2CA 4JKYA 4F6LA 3ZCQA 3L7AA 5L7WA 1J5XA 1K6XA 2ZRJA 1T6BY 1WX1A 2EZ4A 4J03A 1FNNA 1N0VC 1QO0A 3GLHE 1XTIA 3IT3A 1SEPA 3V4VB 3ZU5A 1YZVA 3WGOA 2ADOA 1CY4A 3DMTA 3C3CA 4W9RA 3RNOA 4IWNA 4CDGA 1TM2A 4ZYWA 2P4SA 1NX6A 4QUJA 5EP3A 3SLRA 4B9EA 4O3MA 1WCV1 4EJSC 3NTRA 2TECE 1RP7A 3EIHA 1ODJA 3OP4A 1C9YA 1KSHA 1YE5A 1CNEA 3FZYA 2WHPA 4IHQA 5B37A 3KDSE 3UJ8A 2M32A 3NIWA 4AKSA 3DBOB 2HCTA 1QGOA 2C9CA 3C97A 4JL8A 4DDVA 4KRFA 3H04A 3IAM6 3E2PA 2A3NA 2O7QA 4ZPXA 5HCUA 4EJ0A 3SQXA 3FCAA 1ESEA 5TPZD 4CEJB 4HNAB 1XAIA 2VDPB 4RJ2A 5C1DA 4BRWA 4FCTA 1E0JA 2I6SA 4NLLA 2ATVA 1L7EA 4YECA 5TE9A 4H1UA 4O1MA 1VCOA 3OURA 1JZQA 4FYMA 1Z6XA 1LW7A 3IMGA 4JUAA 4O29A 2X7XA 3HR4A 4IIUA 1YZLA 3RUDA 3TSZA 4PQFA 1DAFA 4A2CA 4B4KA 1HI9A 4C2TA 3I8OA 2G7MC 4L3VA 4C4RA 1FIUA 2P7IA 3EVCA 4JT8A 4XJSA 3H5RA 1UZUA 1T9ZA 1X2EA 3UH0A 2A4MA 2Y1FA 9ABPA 2J3HA 2YWEA 2HHLA 3EW7A 3SJ7A 3O8RA 2ZIEA 3NVKI 3BE5A 3PXDA 3S2EA 2DFVA 3BSFA 3SX0A 1B0ZA 1R2QA 2JCBA 2G0NA 4LZJA 3DEKA 3LXRA 3WQBA 3L6EA 4RC9A 2J9RA 4B8WA 2J5KA 1CP3A 4UUBA 3PDIA 4LS3A 3SM3A 1ZVQA 4C89A 3RD5A 5LP1A 4RTJA 1ZITA 1EVLA 1F0PA 2DQYA 4JZKA 2J46A 1MGPA 3R41A 1NVEA 2HWWA 3E5MA 3RHZA 4ZQHA 1HTBA 3BA1A 4XKJA 3C8HA 4DC9A 2PUBA 5F3DA 2P3LA 1IK4A 3AF0A 3HB1A 4IDBA 5K6AA 2P9BA 1AS0A 3EZFA 3LT2A 4UFNA 1K3FA 2UYQA 3C3EA 2Y0BA 4Z1MD 3V9AA 5JFTA 2NNLD 2XXJA 3CN9A 4TMZA 4MQFB 3ZZUA 1KO7A 1SVIA 2X86A 4OBXA 5FEMA 4Q9LA 5FIUA 4YCJA 3KSRA 2OT3B 4Z8XA 2WJGA 1J33A 1YGPA 5J5VA 4CKYA 1D1TA 3VZDA 4YCNA 1E9VA 1P81A 2BZ0A 1DE0A 3JX9A 2FE1A 2EG5A 1A9XA 3SIXA 5IW8A 2PKXA 5FOVA 1WIWA 1CQJB 1Y7PA 1Q91A 3BAFA 3BD8A 1UADA 2ETVA 1LRJA 1S9DA 1BHSA 3A6LA 3OTGA 4Y7DA 3A6DA 4JCCA 1UMBB 5KYVA 2KMLA 4KPFC 2ZCVA 1X1SA 4B71A 3LIPA 3TE6A 3GFFA 3D6FA 4H35A 3V8PA 2D3TA 4JHLA 4B35A 2WM2A 3DL4A 3ZE0B 4AQDA 5AW6A 3B36A 3W3ZB 3ZCRA 3GGDA 4LC1A 1DX9A 5JNWA 3SQOA 1OI4A 1E64A 1VHQA 2B8EA 2FEOA 4ND7A 2V7QD 2Q7DA 2GHQA 3MWYW 2YZ2A 4QHTA 3OPYB 1FDOA 2F1OA 2IZ6A 3PT9A 1K6JA 4QQNA 4ECAA 1CB0A 1OFHA 3OM8A 4YP6A 4BNWA 1O0CA 1UBSB 2VIIA 2RONA 4DCPA 2J7PD 1I0LA 5U1PA 2JAUA 1J22A 3PL5A 5FFNA 3U7QA 2VF7A 2IS1A 2FXVA 1JI3A 2JEOA 2FSSA 2B36A 3ENZA 4E2FA 1UZAA 2ZUBA 5KYYB 2OG1A 1T0HB 2ARKA 3ESBA 3K9GA 4TRRA 1RWMA 1WKCA 3NEJA 4ETIA 4TVBA 5KDOA 2AZDA 3E9MA 1O4VA 2R86A 3OETA 3JAMA 3A9TA 1KDOA 5EWMA 4BMXA 2H8KA 1D2MA 1N0WA 2VSYA 1C0PA 3IQDB 2GVDC 1XMOB 3DDOA 5TC4A 1DBRA 2UYGA 3SICE 1Q19A 2PGNA 4KAJA 5CT6A 3MJ4A 1TAUA 1P45A 4GD3Q 3E1KA 3VSCA 1FP7A 5J2UF 4L4SA 2B94A 2JATA 3HU2A 3G7SA 3EOZA 2JD1A 2IEZA 4N7BA 1JXOA 1K8QA 4LF8B 5KSZA 3KJNA 3OCVA 2I4RA 2NO6A 3IT2A 4WD3A 1MU0A 4L15A 1AF4A 2JCXA 4BASA 3DFIA 3L02A 3EXIA 5BSHA 2PD6A 3RE1A 4EKYA 4WJZA 2XTNA 4EUHA 1JE0A 1NI5A 1NN0A 2CVFA 2OWDA 1IULA 4RIGA 2IS4A 4FILA 1M1YA 5LBTA 2H2AA 3T61A 1TF5A 2BEVB 2GKSA 4RANA 4DCUA 1J5PA 1WPXA 3KSUA 4EMTA 1I7SB 4N3CA 1EIZA 2QSZA 1V95A 2PYIA 4YXWA 4CF4A 3WQHA 4Q47A 2QYOA 3S8YA 2P75A 4Q3EA 4A23A 3ZHQA 2KQUA 5E7QA 5CB4F 3H4VA 1JFFA 1ZGAA 2B82A 4QYIA 2Y0CA 2KWIA 2QDKA 3THWB 1IEXA 2WYIA 2BLNA 4DCGA 3IC5A 4BECA 1C4OA 4MVJH 4I9UA 3ZX4A 4Y2TA 1G5QA 4B87A 4OHCA 4Q7QA 2IPLA 1BXRA 1IBRA 2E55A 3PXUA 3AP1A 4E2WA 2OB1A 4ZXPA 3CXRA 4I55F 3RU2A 4RO0A 3WGZA 2ZPAA 3EFEA 3H9JA 5IWAB 1UFRA 3LECA 3Q3IA 3KB6A 4FMDB 2LCIA 4W1PA 1AHPA 1W36D 1L5SA 2Q27A 2Y05A 2CUZA 5EJEA 4K6CA 4C0WA 2YWXA 4YJ3B 4AULA 5FBQB 3DOJA 4WK2B 3B8HA 2IDMA 4X7RA 2WB2A 2C03A 5C34B 2RGNA 1RWPA 3B2QA 3NKFA 3PJRA 3A1EA 4XA8A 5CLHA 2XE7A 1H5NA 1LVUA 3A9UA 1R15A 2QG4A 3IVXA 1K06A 2FHSA 2V45A 4JYBA 2XUJA 3UT0A 5I01A 3JD4A 4PLVA 2C3YA 2FJPA 2RAFA 1G20E 2WSMA 5BNIA 2AOTA 3EB9A 3F6CA 4CN9A 5DLEA 1D0VA 1ZEMA 4IOLA 2ZSEA 1X6VA 4DYVA 3DE7X 4REOA 4CQLB 4MMXB 1DOHA 4Q4DA 4TL7A 5J4YA 5HRCA 2FF7A 1E9FA 4WNCA 2PIAA 2DPHA 2F48A 1EG2A 2XMZA 3ND8A 4V0NA 4BY9E 1EHIA 1NJGA 1GGJA 2ZTSA 1E69A 2VPIA 1UT5A 2X3FA 1R74A 3QBJA 2IYLD 3VSAA 1UODA 3JQ7B 4HXEB 1UKZA 3P7MA 5AQ1A 3AHCA 3BXGA 2BEKA 2UZ1B 1KAOA 3P2YA 3PTLA 4GI5A 3G9ZA 4B0PA 2PGIA 1C8KA 1UJBA 3VKUA 4MVJI 5CURA 2GPSA 1E3MA 2X4DA 5HZMA 3AEQB 3IQZA 2O1SA 1RLOA 5I9TA 2GMWA 4P7GA 3F5SA 4TL8A 3WBKA 1KBZA 4LPKA 4ZI5A 4EPXA 1POWA 2OHOA 3W5BA 4UNPA 2QAGB 1FYXA 4AIRA 4E7PA 2DH5A 2YJ4A 3AR9A 1WXFA 1V2HE 4INPA 2CBZA 2P3SA 2JI9A 2ZWIA 2WFAA 2XSZD 4M53A 3SYKA 1NMZA 1MCZA 1RLTA 2F3RA 2QRMA 4KZKA 3T9BA 4I36A 1PF7E 4LI0A 1GZVA 1KZ9A 2VPXA 2N46A 1EEHA 1NHGA 1TZMA 2ZYGA 3ZK7A 5AD1A 2DXIA 2RBGA 3FTFA 4EZIA 4TYYA 1A9TA 1F8YA 4C07A 4P4TA 1R6AA 4CYMA 4QVIA 4BNDA 2VF5X 2PZMA 1GZHB 3B20A 2F1JA 4FYKA 4OKSA 5GONF 4PR0A 1Q0RA 2NXJA 3D6TB 1C3EA 3M34A 4U7PB 3BEDA 3K0FB 1YAJA 5A3JA 3ZXSA 1CF4A 1G42A 1C9EA 5DCYA 4C3VA 3VSDA 1RWXA 2WZBA 1DEOA 3EOAI 5BOVA 4YO8A 1BOFA 1KC3A 2GO1A 2D5LA 1PNVA 3TCXB 2QGZA 1UQTA 2JAPA 3HCCA 4Z1OA 2AVDA 5K8TA 4IEFB 1OWOA 1KDZA 3R7WA 2K7FA 1O0BA 1X1QA 2IH4A 3AIIA 3WFJA 4K40A 4NZOA 1MW8X 1H4SA 3ZBQA 3QPAA 4JODA 5JYEA 1KL7A 1NAIA 4RHTA 4CJXA 3PDJA 2IYOA 1IEQA 5EHZA 5BSFA 3AVUA 1NC3A 1I7NA 3ESDA 5G3YA 4AYXA 1QHIA 4XM0A 3VU9B 2GDZA 2Y4OA 3LDUA 1UZLA 1GGNA 3TVTA 5AMXA 3ZU2A 5A3SA 4EY8A 4CL2A 3M6UA 3F5MA 5BN3B 2GN4A 4TQUS 3SY8A 4LQLA 5IH7A 1APBA 4LXQA 1PTJC 3MRSA 5C9ZA 3ENKA 2QMYA 5KOYA 2ZSHA 3PNQA 1NSFA 4KLRA 5LNK6 4HPWA 4DNXA 3E61A 4U6NA 3FUWA 3ZD8A 2A9QA 3IP3A 3VU1A 4AZSA 2X5NA 4TRMA 4RV4A 4I2NA 2WM9B 4LYHA 4XGRA 4BX8A 4F6RA 3IUJA 1U7XA 4CG2A 5DNCA 4I6EA 1JHVA 2WTBA 5AK0A 1BDHA 1D03A 1F8FA 1Y6QA 2BJHA 2QUIA 2RGCA 2WU1A 3ADPA 1OV6A 3BERA 1U4SA 3G0BA 1W0JD 1VSVA 1UBHS 1XTTA 1WABA 2EX0A 4K9DA 3F6PA 1QZZA 2WYUA 4LVCA 1W4ZA 2IHUA 2QN9A 5DNDA 5KWEA 3AO0B 4JC0A 4XYMA 4RLFA 3T9AA 2CKDA 4LJ9A 4UDNA 1U7PA 4O4IA 2XOEA 3MS2A 3UK7A 3WDSA 4CW7A 1C7IA 4NCXA 5CU7A 3W9YA 2EWMA 2I33A 4EFMA 4BKMA 1KPHA 1NNUA 1E59A 3KVOA 2IA5A 4RQBA 1XKQA 3P2KA 2YYZA 5F7XA 2DHRA 2OAEA 3I6IA 1GCGA 3AONB 2HU8A 1HDXA 3LPNA 1MO6A 2RC6A 3ONEA 2Q3JA 2IEYA 4LW8A 5C3UA 2XPCA 4UNNA 3V46A 4DHEA 3W5IA 4KC0A 1I7QB 1FFAA 4J6EA 4OK5A 1FLAA 1MQSA 2FUG6 1TF7A 2OKGA 2YHIA 3IJRA 3ORQA 5JQWA 2GN2A 3E0XA 1NJ2A 5DM0A 2OB2A 3SJBA 5TEWA 3TAHA 4UTVA 1DFHA 4G09A 3NVMB 4M87A 4UU1A 4GLBA 4WCFC 3K4QA 2OGUA 5IRCD 3QJYA 4DRYA 2ZJYA 3EVBA 1NBMD 4HP8A 4TTIA 4A27A 5IYZA 5KJ1A 4K3VA 1XCPA 7YASA 3KWFA 5IM4A 1IB0A 4HVLA 4WLOA 1DAKA 1UMDA 2PPLA 1X94A 4BX2A 4L9WA 4UBLA 3FI0A 3PYLA 4AO6A 1P0MA 4EYGA 1CWUA 1SD1A 2PYZA 3M33A 1IUOA 4MW5A 1V5IA 1JQ5A 4R2IA 3T1HB 3NDBB 1UPAA 5TDHA 1J24A 2ERXA 4Y2SA 2OFWA 3HY3A 2Z2YA 5SZJA 3SHOA 4V0SA 5I9SA 1UK9A 2OQVA 1RPJA 4AICA 2F1KA 3SSMA 3IXLA 1L9KA 5EPOA 2BSQA 2PJRA 2EGUA 4Z7NB 4RY8A 2ZQZA 4RXMA 4XUGB 3W4KA 3R7SA 1SVLA 2IW1A 4LC0A 2QIPA 5G2OA 4GOLD 1MOPA 1SXJE 4LHEA 1JKXA 2VJCA 1X1CA 4B4VA 2WHQA 2BFFB 4R9VA 4RTQA 1PZHA 2FDRA 5GOTA 1KE2A 2X1MA 4QOIA 3B5JA 3FSRA 3B82A 2H1RA 1CK4A 2RARA 1Z4QA 1MNAA 3DVRX 3T0GA 3ZQKA 1RJFA 3DONA 2Y9PB 3MPOA 4MQBA 2Q1UA 1BMFA 2R8YA 3TD2A 2Z43A 5L8VA 5ENVA 1GTRA 2EL7A 5K3FA 1YRYE 2G4CA 4HGNA 4Q9NA 5FPSA 3T06B 4H7PA 5KYXB 3H5WA 1K6MA 1KRHA 4EG4A 2DU8A 4Q5IA 3QBEA 3WR5A 1D8TA 4MP6A 1PGQA 4MV7A 1EJ2A 1L5OA 3ZV6A 4KRYA 2FG7C 1E1QA 3DOUA 1EGQA 1SCDA 4R40A 4BQFA 1NQ5A 2Z1NA 5E6SA 3NEPX 4QM6A 1EFHA 1RZRD 1E89A 5A3RA 2WF6A 1L5NA 4JX9A 2ZUEA 1YZ3A 2MSKA 1FBNA 3GJ5A 2FPIA 4LMPA 4TLDA 1D2EA 4UM9D 3EUAA 4EHNA 5LZ4A 1DKUA 4A8JA 2ZB8A 3EMDA 3HN7A 4JHXA 4L4XA 4WOCA 1ETHA 1A71A 1RBMA 3P9YA 2W9XA 1BN7A 4WVLA 1MZPA 1CRZA 4IL5A 4KXFB 1LDNA 2FP3A 2ZRLA 4JB8A 4JL5A 4KQFA 4ND4A 1QE5A 4L2IA 2G5GX 4XB6B 4IG4A 1U8CB 2Y3IA 3T4XA 4RZIA 1KFBB 1SBCA 5EWLB 2HWUA 4A6DA 4CMKA 2QJRA 4UNRA 1Z3CA 5CBPB 5H4GA 5GJBA 4AZ3B 3NHMA 2WAXA 2IH2A 1U6KA 4BN4A 3HCAA 3NT5A 4QICA 2GBLC 4QYMA 1O8CA 2GBPA 5KVSA 2X4IA 1DJLA 1NMYA 1A9YA 2O0HA 2P4EA 1ZM9A 2EX1A 1VLVA 1TCCA 1GKYA 4Q3OA 1B3RA 1HNXB 1DG9A 1PWZA 4F46A 1QUEA 2LDBA 3FNHA 2GPBA 1M1ZA 3MBOA 4QNNA 3AR8A 1U7TA 3H5AA 1SC3A 3HBLA 1RAFA 4XLTA 5U4QA 2CKMA 1Y8RA 3GW8A 3M70A 4M60A 3UK6A 4LYEA 4MPRA 3VYSB 1PG5A 3R3XA 3GLFE 1Z5NA 1SY7A 2MSDB 2VYQA 3IIKA 4LHSA 5CHYA 3U9TA 3MWLA 4ZKDA 4N0PA 1H5UA 3I53A 4XX0B 1NQTA 4P4UA 9LDTA 4JLVA 2QUKA 4PQEA 3HL0A 1P0FA 1K1EA 2DTXA 3NQ41 3HL4A 4ZZ2A 2ATXA 4Z2YA 3WAGA 1FRFS 4R9RA 2QUZA 2ZSUA 1KP2A 2XDAA 3AEUA 1KNQA 3M6VA 3OZ7A 3TQHA 3T3IA 2RGGA 5M34A 3E8XA 2OLJA 1PQYA 4IIHA 1X7XB 4QODA 4URYR 4IKPA 4BLTA 5KTRA 4U9IS 2WOOA 3QLUA 3DC2A 2YIDA 1QVRA 4Q4HB 4CKCA 1NF3A 4O63O 1EKXA 3SCZA 5AO9A 3DDHA 1RYZA 2QOEA 1XYGA 1J8VA 5LZ2A 4LXUA 4TTTS 1PYGA 5IZCC 1EQAA 5C32A 3JQAA 2CLHB 1N5JA 3VR3A 4PTLA 4YRNA 4KIUA 4N3BA 4AAYA 1IIRA 3VC3A 4Y1RB 3GYGA 2C9DA 2Z1MA 2R0QC 1IUNA 1KEWA 3G13A 1J1ZA 3RBZA 3ZU4A 3D8TA 4JU9A 1U8AA 4PHTA 4DDTA 4ZIRB 1QQ7A 4RTRA 2CLMB 4NDZA 5JS7A 4U2BA 2QN1A 4TT8A 2VCYA 3QG5A 3AVXA 1UBCA 4MMZB 3RYIB 1Z74A 4D80A 4JA0A 4EF4A 4I81A 4K9SA 4NBSA 3A2MA 4PXAA 4B46A 4YEDA 1EJ6A 3WXBA 3GFSA 2O1XA 3KKPA 1D04A 4H1HA 1M2OA 3HO8A 4TL9A 4FFOA 4CE6A 1SVOA 1E1RA 1V43A 3C70A 3ON5A 1NRJB 5DXFA 3TD6A 2ZI6A 4X71A 3L7BA 4YPOA 4XRGA 5A6SA 4CTMA 2AV6A 2E85A 3MHTA 3B6JA 2XDYA 5EIBC 1OH8A 3AY3A 3OOSA 3NX4A 3U81A 3BH0A 3UO8B 3UOGA 1KC1A 3LAWA 5JPIA 3WAJA 2HQOA 1VCIA 2Q2OA 1QF9A 2A8YA 2IRWA 1FNCA 4W5WA 1TQDA 1GTVA 1JEAA 3IVMA 4LWZA 4C7XA 4PN3A 3AJRA 2B1QA 4BFYA 3H1BA 1TQ6A 3CLRD 3RDPA 3GI1A 1XOIA 3P96A 1MW9X 3I32A 4ND5A 6YASA 3U5ZB 4D9GA 2AFIA 4TTJA 1D2HA 4B3XA 4DJFC 3MA0A 1DBVO 4LFAB 1YS9A 3IV9A 5DASA 3F6RA 5AYVA 5BPHA 2ZT8A 3FPKA 1MT3A 3ZX5A 2OHJA 3KAKA 1I9CA 4H7FA 5DX0A 3KD3A 3O4FA 1KWGA 3C1OA 1SELA 3IRUA 3TGLA 4HLUC 4MR9A 3U6KA 1RYBA 4IMJB 1IRIA 1KYYA 3LE8A 1ZH0A 1GKKA 2AI1A 4E31A 1GUDA 3K20A 1GADO 4H6PA 2PUHA 2CNKA 4HL6A 3ULKA 5K4HA 2GNOA 3LFHA 3LRXA 4REQA 2OSVA 2LTAA 5KQLA 2TMDA 3RYFA 4TYNA 2Q8PA 4F8JA 1IONA 3OC6A 3OTWA 1ZK3A 3U44B 3A9CA 3B1VA 1LWNA 1VSBA 2BF7A 2FVXA 2EJCA 2O6LA 2WJYA 1EE1A 3H3JA 3KKKA 3M49A 4GM1A 4QJ5A 4FEGA 4UM7A 5FBLB 5GZ6A 1Q92A 2HCBA 4M55A 4Q0MA 3S6JA 4CT4B 3COYA 3RIGA 3DVQX 2I4NA 5TV2A 1IXSB 1XTBA 4DNQA 1KJIA 4PYJA 3EVAA 2P40A 3OECA 4QFCA 1H9CA 1PS9A 4FCWA 2QTRA 4CKXA 4AWXA 4IV5A 1VB5A 4TLBA 4N9WA 3M3DA 3CLKA 2RIRA 3DAGA 3EVFA 3OJOA 3DBIA 1I32A 1TZBA 4IV8A 2WG1A 3ZBUA 2AMJA 2JFZA 3A6KA 3IQFA 2P1RA 3GZ4A 3GUUA 1N6PA 5I7FA 2ZTLA 4HGPA 3ZDQA 3VQTA 1YQTA 3TRDA 5K0EA 3ZZTA 2QM0A 2F43B 2ZJBA 1I3CA 4GICA 4CV0A 4OU4A 5B3KA 4C7VA 5GQSA 1G38A 1YQQA 2DKFA 3DMDA 5AKJA 1KI2A 4CQMA 4HBGA 1PFKA 2YS6A 1OTYA 2FWNA 2GCIA 3AIMA 5D1HA 3RJ5A 2JLBA 4F3TA 1RJWA 2JFYA 2LR0A 3GHYA 1EUYA 2RAVA 1XD2B 2AH5A 2QG6A 1V1JA 1THMA 2V6IA 5DSTA 4CU2A 5I7SA 3L01A 3ZUPA 1J0CA 4DSZA 1UBFA 5HIAA 4P2BA 1P2BA 4YBZA 5E7IA 3X1YA 1NW4A 3E7PA 2XUPA 2C3OA 1GU0A 2YW2A 4KQGA 3TOZA 2EFHB 1ENOA 1TJNA 1CT9A 4BVBA 5HUJA 1KS9A 4KR9A 2PKWA 4JK3A 3VI3B 4B7AA 5KYWB 2NZ2A 3V3TA 3A7EA 5J2TA 2GO7A 4HUJA 3ZVLA 1QG2A 2DLNA 1DHRA 3DHVA 3DP9A 4LAFA 4Y2VA 4G3XA 4O8ZA 3NM5A 1ZUNA 4OQXA 1AIPA 4BHTA 3JXEA 3ZH2A 3FUXA 4P9NA 4RHEA 3ZVRA 2V3VA 4M21A 2GVNA 1K89A 1P6UA 4S1VA 4FHZA 3LO8A 5FYDA 4Y1GA 5BSUA 3ZVMA 4PV7A 1WSWA 3OM1A 3LHSA 2HSWA 1CRQA 5SICE 2QTGA 5DGTA 4JQCA 3FZGA 5E3IA 4GKKB 2RB5A 3NT2A 1W36B 1RE0A 3W2TA 2HF2A 4KQJA 4NG4A 3QMWA 3FYUA 4A8TA 5HIKA 1PVOA 4XFDA 1FVHA 1MH9A 3S1AA 2OMKA 3CW2A 3N0XA 1NW7A 2D3WA 4FOSA 1QYDA 5DK6A 4JI0B 2X8LA 1R6UA 3PIRA 4UVGA 5KOJB 3LJKA 2FA9A 3P94A 4I50B 4IIEA 5CD1A 1HDEA 1P31A 1KA9H 1T3SA 3E3AA 1EK1A 4JFRA 1XXHE 4D9BA 4BNVA 1K08A 3BWXA 1KVTA 2GZSA 5JROA 1XRSB 3D3EA 4G5YA 4IQ8A 4IX9A 1XTPA 2XQKA 1GQ2A 3KKNA 4ZRMA 2ZATA 2O05A 5AW9A 2OOKA 3VC1A 4YCAA 4B3IA 1KBQA 3CW9A 4E30A 2PXHA 1ESNA 2FGKA 4I1UA 4TVSA 5KDDA 1NZDA 3UJAA 4BCDA 1QHXA 3QI2A 1U9YA 4YJDA 4DUPA 1BKYA 3DO6A 5CDTA 4JY7A 4R3WA 4JI2B 4BATA 1VI6A 1IZYA 5KQMA 3NHFA 3FHCB 3RIXA 3BIFA 4RHFA 5F5LA 2VF2A 1K68A 1WTAA 1MHTA 1JFLA 1T13A 1LBEA 3R0JA 5JATA 2QUAA 4BQEA 2DF8A 5IBPA 1GRCA 2C2ZA 3JYLA 3ZXXA 1Q95A 2Z2JA 4CEHB 1PZFA 4GZLA 3T0IA 5A4DA 1ZLXA 4HR7A 1ZI9A 3Q7TA 5K5EA 3OT1B 2C59A 1EESA 3U19A 1JAYA 2J7KA 1T43A 2EW1A 4FHDA 5D7NA 2V5AA 2FY8A 1F5NA 2C88A 2JBAA 2NV2B 4I08A 4RZHA 3BORA 4K9QA 3X3HA 5K8IA 1C1HA 3X2SA 1BJTA 1DIOB 2A5LA 5FI1B 2KI5A 4CR6A 3H5IA 5IF3A 1XE3A 2I7VA 4DV3B 4ARZB 3DNFA 2WFZA 3U4GA 3CZRA 1AMUA 5F9FA 1UXKA 3LPMA 3QVUA 3N8IA 1C81A 1JH9A 1LK7A 1P4RA 4GZ3A 2QYTA 3SJAA 3E81A 3ILSA 2KW5A 3DXYA 1GSAA 4RTKA 2AN9A 3STXA 4YCMA 4J91A 2Q3LA 4AC9A 1NE7A 3M6FA 2J6BA 3HY6A 5J40A 1S9HA 5EJ5A 1TMGE 4L8WB 4KPEC 1TUBB 3GLGB 1ZJ4A 3E7DA 4GGOA 4AT1A 3AV0B 1XVAA 1WHSB 5JS1A 1L4BA 3ILYA 1KARA 4BNXA 2F1HA 3PQ7A 1QRAA 1CG6A 2R8BA 3BD7A 3KQQA 4V1CI 4QUGA 1W5AA 2VLBA 3DFZA 1EWYA 2EKLA 2G1UA 3FKJA 3PUJA 4ZVMA 1XBTA 1I8TA 1WUHS 1HEUA 4KTTE 4UAGA 1RXYA 2D5IA 2GN0A 4FFSA 3UWMA 5A5FA 1F1BA 4KR3A 3OD5A 1Y9EA 3BQNB 3NYRA 4O08A 1A2OA 3FJYA 4HTFA 4HVCA 1MG5A 1XQ9A 2W43A 4RH1A 1SVUA 1V26A 1SZDA 2QL5A 2Q29A 4F0JA 4UDYX 1U8TA 1DVRA 1JDTA 3O26A 1TU3A 4NL4H 4LJ4A 5GJVC 3CU5A 1MDBA 1KEUA 4ENUA 4MAMA 3GXBA 1L5HA 2R00C 5DULA 1XZLA 2WTUA 2BBTA 1DXQA 1U8ZA 2ZDGA 1X7YB 4IILA 1YMVA 2Q6TA 4ZAZA 5FLXA 3RREA 3STWA 4UDXX 2C5LA 3GPBA 4NDAA 1S2IA 4MZDA 2FDXA 1ORTA 1L7OA 2C4HA 1I3OA 3ZOZA 1CZNA 3R24A 4RJJA 4RJKA 2ID4A 2GBFA 4V0LA 1VL0A 4I66A 2AK2A 2D7DA 2DUMA 2YYAA 4D79A 4IWYA 5B7GA 3CX6A 3ORYA 1LBHA 3M6WA 2Q1YA 2XITA 3E4CA 3IBFA 3BKXA 3LVFO 4M0CA 3RQIA 3FJOA 1QB8A 1ZI6A 1F2VA 3CLUD 4Q24A 1RQNA 4N5HX 4GHWA 4IWXA 1GPBA 4HRVA 1CVLA 4DRXB 1L4GA 2WP0A 2NMVA 2CNWA 5AM4A 2RGXA 5TRTA 2R6DA 1QH1B 2NSYA 2OQRA 3TTSA 1WMEA 1VPLA 1TTPB 3I9NA 3NHAA 4ARBA 1IH8A 1YAHA 4PC2A 4O2LA 1UZMA 3PE4A 4HDRA 3X0DA 4ZMBA 4MVXA 5JT1A 2DOKA 4LOJA 1TTTA 4QGFA 1E3JA 2XHZA 5D01A 4L8FA 4L4RA 3ZLTA 4IIJF 4ZHQF 5E9WA 3KQNA 1U7UA 4WWHA 1K7CA 3TIIA 1S2LA 3AI2A 3OEHD 4MUXA 4G2NA 3C3PA 5CH3A 5G4LA 4G1UC 4W99A 2PE5A 4IGIA 4ARIA 4BBJA 4C1NA 4B0OA 2BFEB 1UJ2A 1VL5A 3ADOA 1USGA 4HBZA 8LDHA 2ZLBA 3G2OA 5H7XA 3KR9A 4MS1B 4GI3A 2ZM5A 1R8SA 3CT6A 3EC7A 4V02A 5FWXB 4G37A 5JMOA 1VXOA 1FLNA 2EQAA 5GV7A 4UHFA 3O2JA 2CXSA 2G0AA 2FH5B 3ZY3A 2YWFA 4BRSA 4JX8A 1GTZA 4QULA 4BV2A 1MHPA 1WY5A 2FRVA 5EXPA 5IJZA 3LY7A 4M2LA 4MRMA 1CUDA 4CHGA 5J3JA 4EY4A 3L2OB 2YJTD 1Z7WA 3GJ4A 1UQRA 2QRPA 3QU4A 1KQNA 2HDWA 2YV5A 3AI3A 4IGEA 5IT9A 1YRHA 3NTQA 421PA 2AC4A 4LXXA 2FN8A 2WJ4A 3D0OA 4Y2YA 1PCXA 1GA6A 4AMUA 4ES6A 4B2LA 1MEJA 1G3RA 5DB4A 1QH8B 4G0PA 3KB1A 4G0WA 1RMTA 4IX1A 4R9SA 3RVDA 1JMYA 3NBUA 3BFPA 1KI7A 4EPRA 4W8OA 3INYA 2LCQA 4TV9F 1Y6RA 4DV6B 2QMOA 3I92A 1BYIA 2BZGA 3JAWA 2W2KB 3NHBA 4LY0A 5L4SA 2HPAA 1IXKA 1A95A 4B6OA 3LQRA 3EQZA 3V7UA 2WFMA 3KJEA 3SR3A 2KPOA 4FFMA 1P7YA 3RYHA 2AG8A 1YVRA 1G8HA 1T4MA 3CM0A 4HWKA 4IW3B 2VPQA 5EXEA 4YAKA 1PR9A 2PKQP 1TCVA 1ONOA 2ZSAA 3AF3A 3E0QA 1ZI8A 3DMFA 4EBFA 3VU0A 4D92A 4EFNA 4S0XA 1M8FA 1RP1A 1V7PC 3VA7A 2MSNA 1G3QA 1WZUA 5CBKA 2WUDA 1T5TA 3UGTA 3GFGA 3R9XA 3ZTWA 1QHGA 2BP7A 1QDLB 1M8GA 5CPFA 2J3DA 3R09A 5F76A 2CVZA 4M6WB 3DEJA 3K0CC 5AKYA 1W94A 5FT9A 3T7SA 3UHOA 3A05A 1QZUA 5K8JB 1SCUA 4JXZA 3K6KA 3O8OA 3FG9A 1AXGA 2FX2A 4DFDA 3RK4A 1J2YA 2WWHA 1KMCA 1G4AE 1PG0A 2VH2A 4G1CA 5G1PA 1OX5A 5DNYB 1D2CA 1DAHA 1TMYA 3H7IA 4L0QA 4X6LA 4Y2QA 4KEAA 1QHEA 2JGAA 5F77A 4UM9B 2IH5A 2QR3A 1OZFA 1FFHA 5GTDA 3KT0A 1IM8A 1KIMA 2WTXA 4LCBA 5F3WB 3DBLB 4OFWA 4GOXA 2IXEA 3FDXA 3K5PA 1Z83A 5EE0A 4DLPA 2WYOA 2GXUA 4EGFA 4DY4A 3ND5A 1GO2A 1D09A 1TZCA 4YDHB 4NY1A 4NECA 3EDMA 4GT1A 1LBQA 2XB9A 4C2AA 2P0YA 4LVOA 2CFSA 4I1RA 3VJLA 1YZYA 1UBMS 2HUPA 3R0XA 2DEUA 4OF4A 4EG3A 4HAOA 4UMFA 2FPWA 1B8OA 3TI7A 1H22A 5CDYA 5LXTA 1SM4A 2QLLA 1ACMA 1RW4A 4HDNA 5EFOA 3OQOA 4M7RA 3B1WA 2WAMA 2XWPA 4GWKA 3U7EB 1RRGA 4GYWA 3VAZA 4EG8A 1TK2A 1EFVA 3C1AA 3G02A 5LA6F 5B6JA 4O2RA 2O0LA 3AOGA 2C84A 4XWGA 2LP4Y 3RHSA 3WB9A 4ER5A 3RKSA 1PV1A 1CUCA 2MR6A 3NGLA 4MQUA 2DFDA 4YRGA 2IOFK 2YMLA 2M9MA 4MVJD 2BZ1A 2FN4A 4CL3A 3E3LA 5KTOA 4LYGA 4IHKA 2PSHA 2I0FA 3UXMA 1I1NA 1PJAA 3D31A 2HLPA 4WY2A 3EPRA 5ETJA 4ZTBA 5CA1B 4UZFA 3LO5A 4WGFA 1N36B 4OLBA 4FR0A 5FWNA 4Q7JB 4WXPA 3IUMA 4Q4LA 3KZVA 5JEEA 1Y7TA 1PFYA 2B1GA 2NXNA 5L40A 3JU3A 4ZI3A 2WJWA 2J9XB 4Z54A 1U1CA 5EIWA 2HH9A 4NPCA 2EJTA 3JARB 1Z5WA 1KK2A 1FFBA 3AR3A 1E2HA 4FCVA 1HF3A 3WGVA 13PKA 1ONSA 1M0WA 2CXRA 2HSDA 2P1ZA 3A31A 2B6NA 3CF4G 1GGVA 2ZI5A 4YRFA 3QIAA 4X62B 3L1UA 1JXQA 3DWGA 1ULUA 4V2IA 5AKZA 3CZ9A 4P36A 3K05A 4CM8B 3UJ3X 3W2GA 4HLCA 3K35A 1R6TA 1Z8FA 3B1KA 3HPRA 3UXYA 4CKWA 4TWBA 4LZAA 1CUUA 1P0CA 5KC9A 3AVYA 5KOHA 3CIFA 2BCGY 2QTBA 1XQXA 2F55A 2OOSA 2VC2B 4G1VA 4D4MA 4B2PA 4D0NA 1VP9A 3VZCA 4X65B 4V24A 2HJHA 4DMFA 1CF9A 2JS7A 1ZA2A 3DDCA 1OPXA 2C95A 3IAXA 3IOEA 1T6YA 1XGKA 3NC0C 4JIGA 4LOHA 4B6FA 2WWIA 1ZD1A 3JPWA 5C8ZA 2RHOA 1G8AA 5M3BA 3U56A 1O57A 2FNAA 1CHNA 1E0DA 1OBFO 3EWAA 1PIWA 3LZDA 1F8UA 3IR6A 1OPRA 3V8MA 3WWDA 3UAOA 1S02A 1H42A 3HYLA 2CJWA 5BRNA 4MQ5A 3CF0A 3FMPB 3O84A 4NDNE 5IBRA 5DHUA 1GL6A 4Q9AA 3H5VA 1G8SA 1XL0A 1Z9BA 3CJQA 3ELWA 3IPAA 3UW1A 1Y9ZA 1W93A 1QV6A 3PZRA 3NHKA 3R3JA 5CT8A 4BB9A 3DD5A 5LWQA 1GAQA 4I4NA 1XWIA 4RTOA 1RWVA 2QS9A 4ENWA 1VC2A 4DR7B 3UPDA 2MR5A 2RAUA 5DYNA 1JEQA 5AJZA 1JA1A 1ATIA 4I4TF 1TO6A 2TS1A 2OXTA 4NP6A 3SX2A 1N2XA 1LBIA 1E92A 2JGKA 2YUIA 2RB4A 4PYMA 3R8XA 4I50F 2Q9UA 4TMWA 3FF4A 3SE0A 3PX7A 2BKUA 1MB3A 2AS0A 3F97A 3H5TA 4YJHA 2PWPA 1PDVA 1PUIA 1SBHA 3HS3A 3C3YA 1TFRA 2QW1A 2CMHA 1G0NA 2F9LA 4J6FA 2ZAIA 4LYDA 5E0OA 2PX3A 2XODA 7ABPA 3C7CB 2JLYA 3IEPA 2J0QA 3DLIA 3H1GA 4XASA 1MX5A 4H17A 1QX3A 2EGGA 2FFQA 3B6KA 4RYLA 2NPOA 2Q5LA 3I0NA 3VYUB 1R37A 1SBYA 1FTSA 4QJ3A 1MJHA 2BL4A 1K2VN 4MCIA 2JD0A 3A26A 2VPWA 4GQBA 2OZEA 1XMJA 2PNFA 4LHVA 2C4UA 1W85B 2HBYA 2WC1A 1D3AA 4XW2A 2O7SA 4YV2A 1ZNYA 3ZKWA 3I01M 4GI2A 4WKCA 5DSXA 2ZULA 3BMCB 2J3LA 4JGBA 3ZWWA 5NULA 1AN0A 1T2NA 1S1CA 2NTVA 2WDZA 4TUYF 5F7JA 1Q1BA 2OCBA 4YI3A 5BSEA 1RLIA 4WA7A 1W46A 4YRKA 4ZOEA 4U4AA 4M9RA 3WLAA 2QD2A 1U2RA 1TIBA 2IK8A 4HGRA 3I4CA 2OZLB 4RIHA 2PGDA 4R41A 1NBEA 3CCFA 2YVUA 3HXTA 4QUHA 2GJ8A 1R6BX 3T5DA 3TRJA 5BT8A 1XHFA 2QRVB 5JBIA 1SIOA 2EX4A 3Q8KA 1U1EA 4F4JA 1G5PA 2I71A 3GG9A 3CUTA 4LA4A 3KQKA 5FAXA 2I6GA 3E6AA 4ZI7F 4QC2A 3OE7D 4E3ZA 4RY0A 5CYGA 1NR7A 2FKAA 2PGJA 2BELA 3D2CA 4RJLA 1JHMA 1Q0LA 3C4JA 3EG9A 5AJTA 4LSWA 3ZCXA 3F67A 3PQ3A 1SXJC 3EXEB 1UBLS 1NYTA 2KJQA 1SKUA 4X63A 3PRYA 3RQSA 3KVYA 3QFTA 2QWXA 5LLDA 3AESA 3BHMA 3WYCA 2FUNB 1ODSA 2J32A 2DHCA 2ZB3A 2AC7A 2BMDA 1FTGA 1X74A 3CO5A 1YFKA 5EZYB 5EMLA 3SN6A 1KQGA 3TOVA 2CC2A 3F2IA 1OR8A 4C4SA 4JR0A 4F3KA 3WYNA 1UAYA 3GJZA 1GPNA 2P4UA 3ZWCA 3IAAA 2CFCA 4B43A 3V8BA 1W9HA 1ZOPA 3LQKA 4BZQA 4LDJA 1SXPA 4OMFG 3MWDA 1FS6A 1N0IA 5CT5A 3CZCA 3K8ZA 3AZPA 2QLFA 3WFZA 4EY6A 1MRNA 1A04A 1XZEA 4PIMA 3VDRA 1CW2B 4IR7A 4X8OA 2ZYVX 3P0HA 4HYEA 1TO1E 1SOAA 1OC4A 1WUYA 2HA4A 4X44A 3L05A 1AUOA 3W9UA 1SB9A 4E5PA 3MSXA 3AHIA 3ZNPA 5JHHB 2B8WA 3VV2A 2PMDA 4YT5A 1N5DA 3KOZA 3KKEA 5DGDA 1W8IA 2XUHA 1OVMA 5FNVB 4BVLA 2VDWA 1JHDA 1WETA 4M9ZA 1DAEA 4BXOB 2MMGA 5D3KA 5JADA 5I4KA 1RXEA 1V71A 1PO7A 4PLCA 3DQPA 1CUZA 2IPOA 2PGLA 1QPBA 1FUKA 4UHCA 4WE3A 2EC5A 4E22A 3IA2A 1B2RA 5A02A 1V37A 1SEVA 1M72A 1H1DA 1DKRA 2VXYA 1M2VB 1X8XA 3IAHA 1GNTA 3KM0A 3O0TA 3T1QA 3NM4A 3ZDEA 2DMRA 4KO3S 1V8DA 1Q12A 3KBBA 2OFOA 4PYQA 1E3TA 3V6MA 4AKEA 3A8TA 3PK0A 1FVXA 3RVLA 3G1WA 3UKJA 4GXNA 2PRKA 1RADA 5LIPA 1P9RA 4U2DA 1RT9A 1Y1PA 3PDHA 2BOVA 4IAOA 4C2UA 2QZ4A 1T4BA 2BGRA 5ED4A 2IZ5A 5LYJB 2ANBA 3VISA 3VNBA 4B9AA 2Z5VA 3G7NA 4DA7A 3QY0A 2WRZA 1BXZA 2H2DA 3KQYA 3PWSA 4ZT4A 1YD7A 4M99A 4AVYA 1AUPA 4DE5A 2CLCX 2BI7A 5B6PA 2WWWA 2UVPA 4LFCB 1A0OA 3DV0B 3RV3A 5K7SA 3RM3A 4GPEA 821PA 1I0IA 2FRDC 4O4JF 3E53A 3IP9A 3L82B 2R4TA 2CLSA 3CBQA 5KTYA 1EAMA 121PA 2BHRA 1QFXA 2PZEA 5JAHA 5ULLA 1VPTA 3L7KA 3ICOA 3TW4A 3VGPA 3BBPA 4PSVA 5EIFA 1KI9A 5THKA 5J4KA 4R69A 4M1WA 1KSJA 3L3BA 4HNTA 3V32A 2VHYA 5C8YB 2EV9A 2C4MA 1YIOA 2YX1A 3IEXA 4U3JB 4ZOLB 5IAAA 2I62A 1RKUA 4G86A 3WLTA 3NONA 2O8CB 3FCCA 4CUKA 4J75A 5CNKA 3LCUA 3U4DA 1JHYA 2IW3A 3D43A 2FW8A 3IKMB 4C0SA 1NJSA 1C7RA 1YU6A 1KMMA 3OO0A 4JB0A 4S35A 1G21A 1N34B 3QWHA 4G4SO 2OEPA 4MICA 4QLAA 3TMYA 5LOVB 4MUKA 3FDIA 3SDBA 5L4LA 3N0WA 1IM2A 5LB2A 2A1UA 5BYBA 4AF6A 1CDDA 2VJMA 2OV8A 3ZCTA 4PZEA 4GZ5A 1X7ZB 2IF2A 3MB5A 4AZTA 3TXXA 1QG0A 1XRJA 4D1YA 2FX3A 2X4LA 3OF5A 4XYGA 3W5HA 3EODA 4WOPA 4DMMA 3D8UA 1GR0A 2WPNA 3KDAA 3NGMA 3P9SA 5C3MA 3OKCA 4JI4B 4NG5A 2YVKA 3BEOA 3QA3E 3IX7A 3VDNB 1GPLA 2YS7A 5J23A 1CE8B 1ADCA 3BK7A 3HPQA 4MS3B 2PR2A 3H2SA 1NQXA 4BZWA 2YC2C 3NTUA 4JLDA 3I2YX 3F71A 3NHLA 4HCJA 2GUGA 4OQ4A 3S27A 4K03A 1QRSA 1HE5A 1T0JB 3BH6A 1BC5A 5TSDA 2AKAB 2AN3A 3PEFA 3Q10A 2C8LA 3OPNA 3UK2A 3EZ6A 3LY9A 4PZ9A 4F04A 1MB4A 4JBLA 4UZSA 2WWXA 3OJEA 1EXMA 5K8CA 4DR1B 1JTEA 3FRHA 2IU3A 3LHIA 1IHOA 5EEHA 2Q50A 3LYUA 5CB6A 2VYND 2FMKA 2B3DA 3FF1A 2HBQA 2DCUA 5KQPA 2WF5A 4YMIA 3EAFA 4FU0A 4NQRA 3IKLA 4U7FA 2EFGA 4TTAA 4P5DA 2IUFA 1BAPA 2ZUTA 1UKBA 2QYSA 2ZUVA 3CR8A 3DW3X 3C7KA 3WIDA 2AW5A 4JUFA 4QXQA 1H2BA 2G77B 2WJPA 1AKTA 2COUA 1I4DD 3E9ZA 2ZI9A 3H6HA 5KJFA 2HA7A 4R0NA 3HFRA 3PJEA 3U7FB 5HBGA 1SMKA 4Q48A 3WK4A 4B17A 3A14A 3TKAA 4B33A 4BLRA 1ZGBA 3ZNNA 3MINB 1XTSA 2OGTA 4BRZA 1P3JA 1QHHA 1WQ1R 2W90A 3ORHA 3TLAA 1FPQA 2F64A 3JS5A 1P2FA 1YZTA 4RM3A 3A06A 2APJA 3VZQA 5E1DA 3ZKAA 5BR7A 3AWIA 1I5OA 2D1FA 4ZVNA 2NTYC 1O5TA 2VQDA 5KU7A 2A14A 1EINA 1LLCA 4MH0R 4OMUA 4PHGA 4MKHA 1B3BA 621PA 3SEZA 4IQFA 4MWZA 4EO4A 1OXBB 2VNAA 1JBQA 4BWGA 3V48A 3FFWA 4QREA 1TD1A 3IMCA 4R7TA 3TFOA 3FCSB 4I99A 3WHKA 3NASA 1OAKA 5BMVA 4EYOA 1KYIA 3BD6A 3IO5A 4MUJA 3TVYA 4B74A 1W7AA 3PSHA 2AMYA 5M29A 3ANLA 4Y0NA 3CY6A 3AUSA 2FVYA 1T6NA 3P26A 1V7ZA 4G0QA 2W6MA 1C14A 2BFAA 3F3MA 5EGSA 4O4LF 3WB2A 3CWCA 3WLIA 1OGYA 3K9HA 5HBRA 4BVAA 2NO0A 4FOOA 1JFSA 3I6ZA 4YDQA 1XLUA 1HZZA 2WW8A 1LPMA 4WXYB 1Z37A 2IV7A