4NATA

Inhibitors of 4-phosphopanthetheine adenylyltransferase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
159
structure length
153
Chain Sequence
EHTIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLGTFSLEERMDLIEQSVKHLPNVKVHQFSGLLVDYCEQVGAKTIIRGLRAVSDFEYELRLTSMNKKLNNEIETLYMMSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopantetheine adenylyltransferase
publication title Discovery of Inhibitors of 4'-Phosphopantetheine Adenylyltransferase (PPAT) To Validate PPAT as a Target for Antibacterial Therapy.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase/transferase inhibitor
total genus 49
structure length 153
sequence length 159
chains with identical sequence B, C
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2013-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4natA00
2H2AA 1ILEA 2QUKA 2G36A 2BYTA 4MVCA 5H16A 1H3EA 2X1LA 1WOYA 3TZEA 3CVXA 4FZJA 1M8JA 2D54A 4MW4A 1MJHA 1MRZA 3FG9A 1GN8A 4NDAA 1I2DA 2QJFA 4G6ZA 5HG0A 1HYBA 3DO8A 1GLNA 1CT9A 1U7DA 1VBNA 1A8HA 1J1UA 1VLHA 4NZPA 4MUHA 1TYAE 5K0SA 3A4IA 4P2BA 5KCMA 2OV4A 3ELBA 3ISJA 4MVXA 3S3TA 1GZUA 2IP1A 1IH8A 2PXHA 1JGTA 4ZT3A 2I1LA 4EG4A 4R2MA 1OWNA 2E18A 1NSYA 5TEWA 5IJXA 2YXNA 2DUMA 4G5YA 4ZCRA 3MLAA 1NYLA 2JA2A 4R2LA 2J08A 1R6TA 2HMAA 3FDXA 1O0CA 3ZXIA 4YP5A 3ND7A 1R6UA 2HGZA 2A7XA 1EXDA 3IOEA 4DE5A 2Z09A 3OP1A 3DPIA 4RPIA 3SEZA 2DPLA 3H9CA 4MWBA 1KR2A 3TQIA 1OBCA 3MXTA 3GLVA 4EF6A 4DNXA 3P0IA 2A86A 3Q4GA 3CVWA 2PIDA 4OUDB 3X1JA 3ZGZA 4MQ6A 4A91A 1O0BA 3IVXA 3Q10A 2IJGX 1GPMA 2ZUEA 4MWDA 4OUDA 3KT8A 1NUPA 2IELA 1G8HA 1TQ8A 5LLTA 1O5TA 2GKSA 3IH5A 3SP1A 1XNJA 4JXXA 1DNPA 4DJAA 2V0CA 1J70A 3CA8A 2DETA 1KP3A 3HMQA 5DK4A 4YBRA 4QBTA 5DASA 1UFVA 1JEEA 3UY4A 1YULA 3PXUA 4ZT6A 1QRSA 3COYA 3CLSD 4JXZA 2EJCA 4EG1A 1IQUA 1WY5A 1NUUA 4MUNA 4PBTA 3BL5A 1KKUA 3CLSC 4KKVA 1V47A 3AG5A 1TFUA 1JMVA 1I6LA 3CLTD 3H05A 3N05A 4CT0A 4ND6A 3C8ZA 1T9GS 3SYTA 1KQOA 4WNYA 1K4MA 1KQNA 4ZT2A 4JYZA 4H3SA 3CLTC 1KAQA 1Q19A 3CLUD 4E1AA 3KT6A 3A2KA 1QJCA 2J07A 4ZT4A 2D5BA 2O8VA 4GRIA 4NAHA 4ZT7A 1IQRA 1WXEA 4GU5A 4U7JA 3ZJVA 3RFFA 3CLUC 1O6BA 3QE4A 1KH3A 3HFJA 3RHSA 1JIKA 1O95C 3P52A 1KORA 1KH2A 1WQ4A 3COZA 1PG2A 5J59A 3OTWA 1K92A 2X3FA 4ZT5A 2OQ2A 2RD2A 4PBRA 2D13A 3IODA 4I6GA 3ZXSA 1O96B 2JAXA 4K0RA 3TNJA 3D6UA 3HL4A 2E0IA 4KPUB 2DEUA 1M1ZA 4EG5A 4HJRA 4NAUA 3ZJUA 5LFAA 1O96A 3X1MA 4AS1A 4HK4A 5J58A 4KPUA 3LCJA 3P0JA 4HJXA 3RK0A 4JFAA 2WQ6A 1T6XA 1XNGA 1XJQA 2A88A 4YP7A 2VTBB 3GMIA 5KHAA 3AKZA 1MBZA 2J09A 4MW1A 3IDFA 1OWMA 1NI5A 1MOPA 2PZ8A 1M8KA 2VTBA 2CV2A 2CV1A 1YUNA 2PZAA 1Q77A 2PG3A 5HUJA 1OWOA 3MMXA 4JZYA 1O97C 1J21A 1M8PA 3FI0A 3PRHA 2YWCA 1J20A 2PFSA 4CDMA 3NBAA 4MW5A 2CFOA 3FIUA 1NUSA 1ZJWA 3H97A 5TGTA 1T9GR 3COVA 1I6MA 4Q93A 3Q12A 3FY4A 3KFLA 3NBKA 4ZCTA 1K97A 2H29A 1OBHA 1M8FA 3M5WA 2NZ2A 1N2EA 4DLPA 1QRTA 3FHJA 4MWEA 3L92A 1PFWA 3NV7A 2QUIA 1KH1A 2A1TS 3QTTA 2QUJA 4NX2A 1JILA 4ZCPA 4BWVA 2AG6A 2O5RA 3VU8A 3ILVA 4EGAA 2ZP1A 1D2RA 1IRXA 1ZH6A 4HPWA 1PFUA 4MW9A 3RBAA 2AZXA 1SURA 1KQPA 1WXGA 2B7LA 3N9IA 1YIAA 3D6VA 1PG0A 2A4MA 3E27A 3L93A 4Q16A 1Q11A 4R0NA 3CVUA 1G59A 2WB2A 5K0TA 1JECA 4MUEA 1GTSA 3TQOA 3GUZA 3CVYA 1OWPA 3FETA 1T6ZA 4MULA 1MAWA 3P0HA 3COWA 1J1ZA 1IQ0A 4MW6A 1NUTA 1RQGA 3F3MA 4F4HA 3IOCA 2GOYA 1X6VA 2CYCA 1M83A 4XFJA 1IHOA 3KT0A 4ARCA 3IVCA 4L2IB 1JZQA 3G59A 1GAXA 4RUKA 3IOBA 1EUYA 1U3DA 2EL7A 1EE1A 4MW7A 4PBSA 2J5BA 3FWKA 4L2IA 1QNFA 1O95D 3IMCA 1F7UA 3SZGA 2CT8A 2JANA 3HV0A 5LM3A 2R5WA 2TS1A 4DDMA 1TEZA 4MVWA 1QQTA 1EJ2A 3DLAA 1OD6A 1ZUNA 1JZSA 5KWVA 1B6TA 3PNBA 3TZLA 4XFDA 3UMVA 4I6JA 1R6XA 1N2BA 5JBNA 4MWCA 1VBMA 3ND6A 4YP6A 4EFKA 2XRZA 2J4DA 3HZRA 3CVVA 4U8HA 4MUFA 1F7VA 1F4LA 2YY5A 1YUMA 4MLPA 4ARIA 1JIJA 1NURA 2QTMA 5TEVA 3A04A 3CLRD 2A1TR 4ND7A 4KR6A 4TS1A 4OJMX 2WQ7A 4U63A 5HUHA 1I6KA 3PNVA 3AG6A 4F3RA 2GM3A 1COZA 4ZCQA 3CLRC 3CR8A 1N2OA 3SDBA 2QJTA 3X1KA 1FFYA 1O97D 3DV2A 3K32A 4S1OA 2E21A 3QTBA 5EKDA 3UOWA 1EUQA 3ZIUA 1KP2A 1JIIA 5F23A 4MUIA 2A1UB 1VL2A 3G5AA 4WSOA 5DB4A 2A1UA 1NUQA 2C5SA 3RJZA 1N2GA 5TS2A 1BS2A 5FO1A 3AFHA 3FOCA 4EG7A 2CYAA 3LE8A 1QU3A 3ND5A 4G5FA 1WXIA 5BNZA 1KAMA 1MB2A 2X1MA 2E89A 5FNZA 1M8GA 1QU2A 3SEQA 3H9BA 3UC5A 1MC1A 1OWLA 1N75A 4UZEA 2XRYA 3FH0A 1FYDA 1WKBA 5AHWA 2NSYA 2QUHA 1Y42X 1YI8A 3AIIA 1N3LA 4J75A 5H7XA 1T6YA 2V0GA 4CQNA 2YWBA 4QREA 1U0BB 2X0KA 2CSXA 3RK1A 1J09A 1O94D 2QTNA 2DLCX 3G6KA 1WQ3A 1JEDA 5J5AA 2Z3VA 1QTQA 4EG6A 1LI7A 1U7XA 3ZUGA 2HZ7A 3IVGA 1K4KA 1V8FA 2WSIA 3A05A 1VBKA 1X8XA 1O94C 3U1VA 1H1TA 3AL0C 1ULHA 1N2IA 3IMEA 2QJOA 4MUJA 2VXOA 4J76A 4MVYA 2A84A 4CDNA 5DEOA 1WXFA 4X0EA 1PFVA 1G8GA 4XSVA 3IMGA 4PY2A 4DDKA 4EG3A 4AQ7A 1F9AA 2AKEA 3K9WA 2DERA 2PZBA 1N2JA 3N8HA 1P7PA 4UZFA 1LW7A 1EFVB 3INNA 4KR9A 2BTEA 1MB9A 5FO0A 3FNRA 4EG8A 3N2YA 2DXIA 1Q15A 1H3FA 3UK2A 1N77A 1S4MA 1NZJA 3JXEA 1EFVA 1N78A 3IUBA 1IFXA 1GTRA 1LI5A 3SZ3A 2CYBA 4MW0A 1NP7A 4ZCSA 1PFYA 4K03A 4MUGA 1IVSA 2RE8A 3KT3A 1JHDA 3VRHA 1U3CA 4NATA 3VGJA 3ZJTA 1YIDA 1TYDE 1XNHA 1ZH0A 3MLBA 1G8FA 1WZ2A 1N2HA 3TS1A 2DR2A 1H3NA 4MAFA 3IUEA 1TYCA 3HGMA 4I6EA 4MW2A 4QRDA 5IHXA 3I05A 4YMIA 1N1DA 1MAUA 3H99A 4MUKA 2CV0A 1EFPB 2CUZA 4KR7A 4DDHA 1WXHA 1TYBE 2QTRA 3MUEA 1WJGA 3PNYA 2Z08A 2ZUFA 1EFPA 3LOQA 1QRUA
chains in the Genus database with same CATH superfamily
2H2AA 4MEBA 2FPPB 13PKA 3VNAA 2ZJFA 3EA5A 4P93A 1AB5A 3M2TA 4CZ2A 4F3CA 1T43A 3TZEA 1RXEA 2ZTUA 4N40A 4QG3A 3BAZA 2HJWA 4OKSA 4AJOA 4F60A 1GRQA 3WP0A 3R5FA 4FFSA 3W6UA 3FG9A 4A4DA 3NZEA 2XKBA 1W5SA 4GP6A 3U81A 4UEKA 3JRNA 3PD7A 2JAQA 2VXBA 2OCAA 4S2UA 3K2EA 5AHKA 5DDIP 3EULA 3E9DA 5KYUB 1MW9X 2RHGB 4U2KA 1VLQA 1MZVA 5IAOA 4W1RA 2NXCA 5FULA 2YWJA 2CNDA 3MAAC 3JQ8B 2M6KA 5KVAA 2OO7A 3SK0A 4QBHA 5BOVA 4EJSC 3GEGA 1GNSA 2XYQA 1I9CA 3IUYA 4GOXA 4XWAA 1YE8A 5B4TA 1Z7EA 1HI9A 1TO6A 3OHPA 4QPZA 2IH5A 1YTUA 4FBLA 3NT2A 1NVUQ 2FPLA 1NM5A 3KEFA 4A26A 2HHLA 4XQCA 3I30X 5B3JA 5KYWB 4G1BA 2R85A 4JJGA 2FPIA 4M7OA 4ZDJA 2XOXA 3PEEA 1Z07A 1GQSA 4HEA6 4XAQA 3IELA 4KN8A 5DTEA 3KS9A 4OHRA 5CYGA 2NUTA 1OREA 3HN7A 4LJ9A 1FYXA 4ZCRA 3CNOA 2OO3A 4PLZA 1OX4A 4A0HA 1OH5A 3C7KA 2MSEB 2FWNA 1XVUA 2W6NA 4QUEA 2PBZA 1VL5A 3SDSA 2J7KA 3L0CA 3FDXA 1ORWA 4HWRA 1XDGA 2WVAA 4NS4A 1UC9A 1PRYA 2NO4A 4ZVNA 1HT0A 3SSMA 2FMKA 4MYHA 3EARA 1P73A 4R1NA 3WKDA 3WLHA 3G85A 1U0GA 3LY9A 5SYAA 4DE5A 2PKYX 3HEAA 1HOTA 2Z09A 1O08A 1ORTA 4ZIRA 1E1MA 3HSSA 1XXHA 2HW8A 2G1KA 3BMOA 4UTXA 4DCGA 4D9CA 3IHKA 2VTVA 4B4KA 2GJ9A 5I7RA 4LDQA 2ZJ0A 4EB6A 1V95A 1KU6A 2J0EA 1TIBA 1XQVA 3H2SA 1T13A 1SZCA 4IOLA 1FS5A 2C5BA 4A91A 2D1RA 4LCBA 1FVHA 3K09C 5FPPA 4BS9A 1F2VA 4RYDA 1DX4A 3DMTA 5JFOA 1OX6A 1JWBB 1CY2A 2H6EA 5GVSA 1JE0A 3FPKA 2BZGA 1G8HA 2IELA 4YI5A 1FMJA 4EKGA 3IJRA 1Z5ZA 4D2IA 2IXTA 1CU1A 4JNCA 4E6EA 1JDTA 1U1IA 3LQ1A 4FX5A 5C8YB 4DMMA 5KX5F 4JC0A 4ZV7A 4BQQA 3D8SA 4I3GA 1MQ8B 1HYHA 1TIPA 1YKSA 1OFHA 4CMBA 1NXWA 2BGRA 2CD7A 1KI1A 2XDQB 1W0KA 3A1WA 3OFVA 2Q50A 1DADA 3UUWA 2J0SA 1L5RA 1SG0A 5FLXA 1Q0UA 4QU5A 3TCKA 1G38A 3K9QO 4EVIA 3OEYA 3PT9A 4M7RA 3UMSA 3RWMB 4C0LA 2I0FA 3OQBA 1VB3A 2EERA 3CLSD 4JXZA 1V4VA 5TY0A 1WHSA 4A3SA 4YR7A 1L5NA 5KYYB 2ZWIA 2YZGA 4FNOA 4E15A 1V1MB 1IWPB 1ZXXA 4MUNA 1FTYA 3R0JA 4LV6A 2LW7A 5KOJB 2MSCB 3EPJA 2YIDA 5CDTA 3OQNA 4G1VA 3BL5A 3E9MA 2HTEA 1GN9A 3DMYA 3NO4A 3BOSA 1CVRA 1FUYB 3NASA 2H9IA 1Q1BA 1RBQA 4RD0A 3TFOA 4KXFB 1ODLA 4ZQCB 4S1TA 5IYZF 3SX4A 4NZYA 4LTNA 2IWRA 2CMDA 5EWLB 3AXSA 3SHVA 1QPZA 3NTLA 4I1VA 4C6RA 3FFBA 4II2A 1R0XA 4FYVA 1KZ6A 4HATA 4JKOA 4TV9A 4Z9BA 1V3UA 3BFVA 1ISHA 2Z8ZA 1U9IA 4LHZA 2Y4NA 2MYTA 2O48X 2YIJA 3N76A 4HAYA 1S8OA 2ODPA 4KAAA 1SOMA 3AW8A 4I9UA 5ALXA 1Q7EA 1VP3A 1Z5UA 1ZCBA 3N53A 5AKXA 2IY8A 3K1ZA 3PSHA 3EW7A 4E5KA 4ISBA 2C2KA 2P2SA 4Q4LA 1YK1A 5CT4A 5H9VA 3K3PA 4CR7A 1N2CA 4RELA 5HSGA 2OBMA 1NU6A 1XJ0A 4ALLA 1YMQA 1PDOA 1CF2O 2RI0A 2Q2QA 1R3UA 1UP6A 1YJAA 5EJ8A 1R0RE 2ODQA 1UOEA 1ZVKA 3P4YA 3PDJA 3PC2A 1WXEA 4H6PA 5HM8A 4PQGA 3ITEA 5DYNA 4BYMA 3FOEC 1TM4E 1Z2PX 4J0HA 4R2IA 1ST2A 5ALVA 1J56A 3T0FA 1GQ2A 4HRYA 3WL7A 1KH2A 4AJNA 3MWGA 2MU1A 1LZKA 2HIHA 5T5QA 5AVZA 4DW8A 1RRCA 2RARA 2HJVA 4JBXA 3EEOA 3EIHA 3BE5A 1E3QA 4KPUB 4KUGA 1JJ7A 1KI4A 2VPYA 4G36A 1RWWA 3CKLA 3NC4A 1BWQA 2JBWA 3D54D 2HFJA 2C9ZA 1RI3A 3LXXA 2DUJA 3NDJA 4ZO7A 4Y67A 5EP1A 4BZPA 3DKKA 4L6CA 1UBTS 5JSQA 1PT7A 5KWSA 1EK5A 2Z6UA 2BFMA 1BXGA 4GI2A 4DSUA 4JFRA 2C2GA 4HFRA 4CLOA 2WJGA 4JQCA 4XDZA 1XZGA 2X9NA 4ZVMA 3F78A 2EZUA 4JLWA 1OX5A 3VR0A 4WXYB 4M8SA 3UJHA 3PWKA 3VHQA 1IN6A 1JR3D 1E9EA 1W4RA 3AT1A 3RC9A 3H13A 3FROA 1OWMA 1DKNA 1JX6A 2G06A 4LHVA 4P4NA 4BKPA 3BFJA 1SPXA 4QM6A 5L7TA 4B7ZA 1ZBQA 5CA1F 2CEAA 2AMVA 3WSVA 1WSDA 5DTQA 3L8EA 3ETLA 4IDFA 1OIXA 1NQWA 1QYRA 2VHWA 2VJQA 1E5LA 2PS3A 3KZOA 4TLEA 4D4GA 2WNSA 5AM5A 4NLLA 1SXJC 2WICA 3P9QA 1LJLA 2YIVX 3LLCA 4CDMA 1UXJA 1WEHA 3L6RA 5BMOA 2ZJ6A 3ZE8A 5CFOA 1DBIA 2QWXA 3WK5A 5DBFA 5FOXA 4BFCA 4NI5A 4BO7A 1P4AA 2FA9A 3ORYA 2ZSFA 3COVA 3T7RA 5FOVA 1OILA 4Q3CA 2IHJA 3R6LA 1MORA 2VLIA 5EIWA 4FJ0A 3WGTA 2CB0A 3M5WA 3OIWA 2GHTA 5ALNA 2AOUA 1XZQA 1C4XA 3A9VA 1PYGA 4OJTA 3TAXA 2ZUVA 1X9HA 1K8XB 2XB4A 1H23A 1XDUA 5I9SA 1AUQA 1PVVA 3C74A 2BJWA 2HI0A 1WA5A 2XNHA 3WR5A 5ELXA 4OHVA 2N0SA 4DMRA 2XRFA 3U09A 3I45A 2I4OA 4TXMA 1MX9A 4TLMB 2IYAA 3IB3A 8GPBA 3AVQA 4KAFA 1AG9A 4B5LA 5FQNA 1X9IA 5KMGB 2FV8A 4TQUS 1PBNA 1JQEA 2WE7A 4G9BA 1ZD2P 2OPHA 3T61A 1FDWA 1CJUC 4IVQA 4RL6A 4BO0A 2WOJA 1LF5A 1BEUB 1ZGBA 4YRSA 2ZULA 1QP0A 2HCBA 3TQOA 1TEVA 3LY7A 3VNSA 4FD3A 2NG1A 1Q1QA 4HQRA 2INGX 3C1AA 1XA4A 1A8PA 3OMXA 3QWFA 3NIBA 3DEJA 4KPFC 4OLJA 5KNCD 5JV5A 1BC5A 1CZRA 4HNAB 4LNUB 4NQRA 1U6JA 4BNFA 1DHRA 7GPBA 1R4NA 1YA6A 1QDUA 4JSRA 4C6HA 3NHRA 3NUQA 4X8LA 5CK5A 1XE3A 3R5KA 4JCCA 1Z5VA 2VR1A 4E2XA 4W1QA 2ODBA 4E4RA 3H1TA 3FJYA 3PHLA 2EDAA 5CLQA 5JQWA 1I4EB 1AKMA 2OXRA 3P9CA 1B93A 1JDNA 5EINA 4RESA 4CL3A 3T54A 3AUYA 3B3GA 1E32A 5CJPA 4L3VA 4MW7A 4PBSA 5KDDA 3H1GA 1QFJA 3LPLA 2H63A 1W88B 2P77A 3BXFA 3EZ7A 3IMFA 4GZMA 2PXCA 1D07A 4JN6B 3UF0A 4Q34A 1B3BA 1FDVA 1K6XA 1ML4A 2AFIE 2AB0A 3GEHA 4WJZA 4C0BA 4IO1A 5FP0A 3VR5H 3ZN2A 2CJWB 2A14A 2HBRA 3M6LA 1PQWA 2JW5A 2WWXA 5DBGA 1SUBA 1E9RA 2IV2X 1JA9A 4URXR 3U44B 1M5RA 1H2ZA 5EMNA 3LK7A 2WLTA 1E2FA 1D6NA 2B5OA 2WP8J 2NO9A 3D7SA 3KZVA 3OJWA 3UGKA 3NHYA 2Q9CA 2R66A 4FDMA 4QXMA 2QBYA 3DKIA 2XBMA 3OIDA 1PZGA 2D0IA 1K7CA 2ODEA 3UFXA 5BRAA 3EEYA 2C58A 2BMJA 3SDZA 3HJCA 4MUFA 4RMGA 4LRUA 1G1MA 3PG5A 4C29A 1L4GA 4C7VA 4YLYA 4B1FA 2YHIA 4FNGA 2XUGA 4FQ8A 5M3BA 3EHEA 2D5IA 4MI3A 2A1TR 4YT8A 5HEKA 3IDAA 1GKIA 1K8RA 1OYOA 5GY7A 1PZFA 3R74A 3KXIA 1TAQA 3QMMA 1I1HA 3GOHA 2P2LA 4WLEA 3I64A 2AEFA 4A2WA 1W4BA 4ZCQA 3V8EA 4WBNB 2QG4A 5BNFA 3GDOA 5ITZA 3TGLA 3GH1A 1HSOA 3VSAA 5D3MA 3RBVA 4RTPA 2PVCA 2O8FB 1NDQA 1MKYA 3MWJA 3FR8A 2D00A 2DC1A 3W5AA 3TYXA 3NHUA 3PFKA 1QIDA 4BP9A 3UKOA 1Z6TA 2AQ8A 2OGSA 1IG0A 4QYTA 2AE2A 5BQ5A 3PJEA 2EX1A 1TF5A 3IBFA 1RAEA 1U2DC 2IEBA 5C34B 5KOHA 2M6RA 4WMLA 2X0EA 4PFSA 1VYHA 4YCSA 3FVRA 2YWHA 3Q3IA 4RENA 4C08A 2RKOA 3MTJA 2C82A 2NV0A 2HF8A 3D7RA 3TCXB 4ZFNA 1IZ0A 1QFMA 1TDJA 2C29D 2GBCA 2H31A 4OGKA 3L7YA 5LXTF 3H65A 5C8ZA 2F3RA 2ZJ5A 4TKVB 5EN4A 4G5FA 1IJBA 5FOSA 1WNTA 1NV9A 2WV9A 4RMIA 1R7RA 2BCGY 4MS4B 3LW7A 1NVVQ 2H11A 1ENPA 1JHYA 2C9DA 2QAJA 4IM7A 4L6AA 4QIHA 1ZUHA 1P4JA 3FCEA 1G55A 4PM4A 5GM1A 5HK8A 1FYDA 2EX0A 2QUHA 1YDHA 3T7SA 2FLWA 1YI8A 1KDYA 3U3DA 4WZBA 4I5DA 2JGDB 3BQMB 1EZZA 1P9LA 4H6WA 2ZQ5A 3QVGB 4RTRA 2WPDA 2CSXA 2YZ2A 2UVQA 3OCYA 3BTOA 1WQ3A 3RAFC 3P20A 4IIXA 2O59A 3EDOA 1NQTA 2G77B 3QYPA 2IP4A 2YZKA 3OT5A 1G21E 4I8DA 4E88A 1XZ8A 2WJYA 3DCJA 2AVNA 3INTA 3KO8A 1KYYA 3T3GA 2NU6A 1DWQA 4HMOA 2R6AA 1HDOA 2C4UA 4BNDA 1RRKA 1Z6GA 2DTDA 3BSWA 3HZZA 1STOA 3IAM6 3TQFA 3VNBA 2BHTA 1IHUA 3AL3A 1CE8A 2JZNA 2PWPA 1VLVA 3KKKA 3OE7D 3S8MA 4GVPA 2DKOA 1V5GA 1V37A 2FPGB 3EN0A 3ORRA 3D3QA 5H83A 1IM5A 3ESAA 3JVVA 2PSSA 2UZAA 3CWQA 3IAAA 3DR3A 3F46A 3R3ZA 4BNGA 1NOJA 4W5TA 4OAQA 2GJKA 4Q3NA 1G9TA 4RKQA 5IWAB 4I50F 4IIVA 1R4MB 4MS1A 4H16A 2YV1A 3CPHA 1K0UA 1CJVC 3TQTA 4MV8A 2UUPA 3HXQA 1MB9A 1KMQA 4DIKA 1JQBA 3PITA 1C1HA 5KTYA 4C4TA 4W9MC 2HRZA 2IKSA 3FPSA 3IUBA 2QMQA 4MDHA 2QGNA 5EXPA 5K4AA 4CLDA 3U4DA 3ZDQA 3P5SA 2HPAA 2GA8A 4ARVA 1Y4SA 2CLEB 4YAGA 2PFGA 4HVTA 2E4XA 5AR1A 3V4ZA 4BLSA 4E51A 2C4HA 1PFYA 2Y0DA 1CR6A 2SCUA 2CXQA 3BGWA 3I9NA 4YLEA 1IVSA 1U5CA 2Y4OA 5B12A 1UMKA 2PRJA 3TUIC 3KT3A 2ZT7A 2QL6A 4ZK6A 1UJ5A 1EPUA 4Q9NA 1DIOB 1DAKA 1RKVA 1KJYA 1OZHA 2Z57A 4I9FA 4PTYA 2PUBA 3LHIA 4KI7A 3IP9A 3MWDB 5T4BA 4I1PA 1TYDE 1ZH0A 4M9SA 3FSEA 5KDLA 2PX4A 1Z6AA 4A15A 2GD2A 4GYJA 4WI1A 4HRXA 6AT1A 3I2IA 2Y3IA 4KQCA 3GYGA 4O29A 1M0WA 1QP7A 3VU1A 2QY6A 2FRXA 3DE7X 4FD2A 3U7QA 4D99A 2O7NA 3ZZ0A 5IZCA 2GK6A 1J0XO 4EJSA 1NF9A 2D4HA 3SYNA 4EX7A 4IFEA 4NC9A 5JMTA 3A6ZA 2UVPB 3W3ZB 2AN3A 2PT9A 5AKIA 1NI4B 3HR7A 1M6HA 2V4ZA 4M55A 1GKKA 1VGRA 4Y3UA 2XOKD 5L40A 5LYJA 1YB2A 1XO1A 1SKYB 2OMKA 1OT5A 4YDSA 1ZCFA 1F3OA 2R2AA 3HVKA 4TN1A 4PO9A 1XROA 4TZKA 4A6EA 1CULC 4BHTA 1GVHA 4MVCA 2XT6A 3LKVA 5DHUA 4EENA 4PN3A 4UU0A 2A30A 1Z7WA 4FZJA 3LXRA 5IKOA 2EGGA 5JR3A 1E0AA 4H7EA 5HIJA 4LEIA 4YMHA 2IXFA 2RGBA 4YUXA 4J90A 3IESA 1SJ9A 4F84A 4NMXB 2OCLA 4PHHA 2EQBA 5IZ4A 1VG0B 2UV8A 3O9VA 4IVRA 1SRRA 1XTQA 1Y3HA 3ASUA 3TKAA 1TL7C 1G66A 5IANA 5H3LA 5HCIA 4S3MA 1F12A 3AFOA 1DJNA 4S05A 1QFYA 4TV8B 5EFOA 1T4BA 2O07A 3SC2A 1QCZA 5JXWA 1C9MA 3I9MA 5L9AA 3D4LA 1TKCA 1ZLXA 5FYQA 3V9PA 4JOCA 1ZIDA 4TS9A 3PX7A 4WKOA 5J4VA 1E4EB 3L0PA 3U7JA 3K09A 4LY0A 4C01A 3I62A 1Z2EA 5L45A 2FFRA 2Q1UA 2AI2A 3O3CA 4QTUB 4REQA 2XYGA 2JBHA 5ILGA 4ROSA 4PLWA 4WVLA 3S2IA 4ME6A 1FFEA 4Q4HA 1EAMA 2OGTA 2J3QA 3IXQA 1P45A 2LE0A 3OAAA 4IUCS 1NW9B 3F74A 1TX4B 2KS6A 3EY9A 4ZQIA 4N0DA 1NVAA 3CRRA 4REOA 1SO8A 1W94A 4I8IA 2IYWA 4GQIA 2C2HA 3BE4A 3IP7A 5BN5A 3OCCA 3EGWA 1DXQA 1ZM9A 3S7TA 2I8CA 3AR3A 5EE5B 3CZ9A 4ZQHA 1NDHA 5JROA 1QTRA 3CS3A 3EQ8A 3W5VA 4MX8A 5CA1B 3RR2A 2XNKA 4L0CA 1V16A 3HM9A 2NU7A 3GLVA 2QW0X 3R5JA 3W2EA 4BO3A 2H65A 5FBZA 2QAGB 2GLTA 4WV3A 2AHOA 3X1JA 3IVAA 3ZGZA 5LMZA 3OECA 1XVAA 3GRFA 3QKUA 5HKKA 3QYAA 1DAOA 5FWNA 2JLXA 3FUXA 1YQWA 3HJGA 1O54A 1WXDA 1FS4A 1AX9A 2P69A 3DUWA 3I4FA 3KT8A 3M6AA 4XARA 1CD5A 3VKUA 2YJ3A 1C8KA 5T41A 2O52A 5I51A 1W0CA 2CC2A 1P0FA 1OASA 1W4LA 3FFWA 3KTAB 5BUCA 1ZICA 2WJ4A 3RAEC 1J9GA 1CC1S 5AH0A 1JP7A 4B34A 3CA8A 2YVQA 2C9CA 2D0DA 4GPBA 4FB4A 2JAPA 3GVXA 2CXXA 3SBDA 3SXUB 3WIVA 2AN1A 4AXXA 2VJKA 3HFRA 2PT6A 4AP9A 4FB5A 1NMEA 4M38A 2N1MA 3HA3A 1Y4ZA 2G76A 3V8BA 4IP0A 1U5BA 4U2BA 2G1PA 4Q0MA 3V1MA 3DA8A 3OQMA 3N8NA 4DIBA 1N5DA 3U5TA 3A6DA 1OR8A 1YB5A 5EJ5A 2C5LA 4D3SA 1VRWA 4NZOA 3IIEA 5TQ2B 3HDHA 5DWVA 4RFSA 1RHRA 1E96A 1ZEJA 3WSWA 1EM8A 4B0PA 2WI8A 1FUUA 5FL3A 4KRGA 2GPAA 3R0QA 3SC3A 1UXOA 2XD9A 3C3PA 5JNRA 2O50A 4XB6B 4OHOA 1S89A 3UJAA 1N77A 2VJAA 1MGPA 2QXTA 4ZT2A 3UMFA 3HACA 2OXFA 3ZHCA 4FOTA 1ZK4A 2WV7A 2HL6A 3ILSA 4IHJB 4F96A 3ZGYA 1NMXA 3ETJA 4LAFA 3S2SA 2O8CB 1L4HA 2TECE 3TIVA 2JHPA 4EI9A 2GCGA 3L2OB 4WBNF 2V8OA 4DCJA 3PR1A 3R0ZA 3TLGA 4CQLA 2GYUA 3C3BA 5LZ4A 1E6CA 4X97A 3IKLA 2RGDA 1OH8A 2EG9A 4X54A 1AU9A 1NR7A 5FBRB 1CB0A 3OU2A 5G40A 1ZIPA 2XCIA 1NYQA 1NYTA 1NJ8A 5EZSA 1M1XB 1WPRA 1JR2A 5JY6A 2R3SA 3K0AA 2VDLB 4GQBA 1M66A 10MHA 1WQ4A 2V4UA 3RARA 3WE7A 5AXAA 2GBFA 1NHGA 3UW1A 4MNTA 4M54A 1T8YA 5TXGA 4BVKA 1Y89A 1D09A 1JT2A 3ONFA 4F6RA 2OORA 4OXKA 4F38A 4K6CA 5ALQA 5I4IA 1H2WA 1SULA 2ZJAA 1T8TA 3HKDA 3HHEA 5EMKA 2B4KA 2QVXX 1DEAA 1SXJA 2QRNA 4KXUA 5JSYA 2HH9A 4W5OA 1P75A 1G8MA 5CGQB 1GZ7A 5LP6B 1P19A 3DVRX 4CG0A 5IEJA 3EXAA 4AZTA 2WQ6A 1KJZA 3L01A 4O4HA 5ECWA 1RP7A 3QI2A 2WD9A 3EXG1 4EW2A 2QU7A 1LPSA 3BB1A 3EFBA 3NXKA 5LQNA 5CLGA 5H81A 3WB2A 4KDEA 4PAMA 1IMJA 1Y63A 1CJSA 1ZGAA 3I4LA 2PLRA 3A14A 4X1KB 4OI1A 1YR3A 5ALEA 5I4KA 5I7AA 3FTFA 1FFWA 4WGGA 2UYHA 2IP2A 5M7EA 1P6QA 1OLXA 2N47A 2CNKA 2OV3A 3EEQA 4WY2A 1Z35A 1H1LA 2G70A 5BOSA 1WU7A 3BMCA 2AE1A 1HM5A 3KTFA 3VKFA 1CY1A 4JJFA 4PFJA 4A9AA 2WJVA 4C7OA 1L5WA 1O9GA 3FUUA 2R47A 3LU1A 4HDCA 5CVDA 3WDSA 3EH1A 4FS3A 4HNHA 1IN7A 1SQ6A 3FDZB 4TT8A 3I2FA 5A3JA 4QLBA 1V8OA 3Q11A 1ORIA 3OMLA 5BSWA 3MAJA 2X9VA 3LXMA 1JEQA 3JYQA 1L7VC 3QENA 2B8TA 1RC1A 5EC8A 3DONA 1JU9A 5C8DA 4HWKA 5U1PA 3ZGVA 1TVKB 1RW4A 2REBA 3GHHA 4G8DA 3MJSA 4K6OA 1Z3CA 2TRSB 4M8IA 4MCHA 4X93A 5FAXA 1USWA 3ODGA 3O8OA 821PA 1XRPA 5A0FA 3UMYA 3QPVA 5IAJA 3VZCA 1Q7BA 2FXIA 2C4MA 1EP2B 2O5VA 4OQLA 1JILA 2GETA 4U2DA 1HSZA 2Q3MA 3OZXA 3ACCA 2JIOA 2YYSA 4GHWA 1HL7A 4OMCA 3ZV3A 2W00A 2FUG1 3GGPA 4HPWA 5BXQC 1XTUA 4BGEA 1EFHA 4PANA 4XX0A 2EZTA 1PF7E 3PSAA 5IP5A 4YPOA 2QD4A 5FPHA 3CUTA 2AT1A 4A6DA 2E7ZA 4RZUA 2HGSA 2D1TA 4CTJA 4CTMA 2FPUA 4C43A 3OO0A 4EYQA 4P34A 4M9ZA 4R69A 5KC8A 1JECA 3OEEA 3X43A 1OBFO 2ZYUX 2RBGA 4W7SA 3B51X 4I7EA 4L22A 2ZAYA 1PJLA 1W2WB 1C3EA 1X1DA 1X7GA 2LDXA 3DG9A 4I4NA 4MARA 1G5TA 2HNAA 2VRWA 2L0XA 3IBTA 3KALA 4DA9A 4D4JA 2I22A 3BZUA 3I3OA 1B8PA 1KFJB 2RBEA 2X4DA 4HUQB 3ADKA 1Z12A 3DAYA 2X42A 1JLLA 1VRCA 2KBFA 2MDTA 4KBFA 1X92A 1QTIA 3I6YA 3KM0A 1ANKA 3DR5A 4H7KA 3PI7A 3F71A 3Q7IA 2GOYA 4ZAVA 1PJSA 1Q3TA 4TWJA 1M83A 2BCEA 3A6HA 1T0IA 3R5TA 3U0BA 2PUAA 2VDUE 5SZHB 4BB0A 3EZ6A 4Q47A 3LZCA 1D5WA 1KVSA 1DKQA 4LMBA 2EZ9A 4I4IA 3IOBA 3RYFA 1TOAA 3FSGD 5SV2A 5B58C 4D8UA 3H1FA 1TADA 4X65B 1KSFX 2P68A 2NWQA 3MTBA 2X8WA 2WRZA 4I50B 1U7TA 2CE7A 2HXYA 4QYIB 4WLOA 3ESXA 3TRFA 4B75A 3R0VA 2G88A 5HMLA 3DBRA 2Z4TA 1DJLA 3IVRA 1ZWLA 4PO8A 3GJQA 1Z25A 2FSHA 4RD3A 4UMVA 2X77A 3QKRA 2VZ9A 2TS1A 5KUTA 3AOGA 3AVPA 1SA0B 1W1IA 1XZLA 2WTEA 3BRWA 3M0EA 3N2EA 2XKAA 1G6Q1 1T5TA 2YH2A 5IT0A 2A92A 3LUCA 4HGZA 2C2ZA 3VI3B 1HX7A 1KK3A 2R8BA 2X1VA 1VMDA 1QKIA 2BKEA 1EHIA 2ISCA 4NG4A 3H1EA 3VNUA 1N2BA 2BFEB 2I3DA 3CTMA 3BJRA 2EFDB 3RSHA 4YP6A 2NZXA 5E7IA 4L8GA 2RK6A 3NAGA 1KI9A 2DKNA 1K98A 4A0QA 3CZMA 3KUXA 4QO7A 2ZS7A 3KKPA 1JI0A 5EUMA 1K75A 2EKQA 1M2HA 2G1UA 2YN4A 3GMTA 3LBYA 4UFOA 4ZCLA 1QV9A 2QM0A 1G3UA 1U2DA 1RCFA 1ZH4A 2C4TA 2PSHA 2VNIA 3LUJA 4JAVC 4JLMA 4OL0A 4UHHA 4XIFA 3AHIA 4CQJA 1T2NA 2UUAB 3SS8A 4XVRA 3BD9A 4U8GA 2EJBA 5D1NA 1FY2A 5DULA 2E4AA 1BU8A 2CNNA 4JI4B 4B73A 2QXYA 4U7TB 5AHOA 3D8NA 3N58A 4RVNA 4OXRA 1Y5RA 2WDZA 1BXKA 2G5CA 1GSAA 4KYVA 2I2DA 4EPRA 4NVRA 3ZHSA 3VSCA 1E3SA 3TW6A 3ZJ5A 3MTEA 1VG1A 5ENZA 2XUQA 4JJ8A 1AT1A 4D0GA 4O2AB 4YECA 1AV7A 3V6LA 5SY4A 4NH4A 1JJFA 4OHXA 4FLMA 4ILEA 5BV8A 3KQYA 3M6MD 3USCS 4KV9A 5EJ9A 2PSJA 1RD4A 1ATIA 1AA9A 2FW9A 2JHGA 2XITA 3R7WB 4Y1FA 1FFSA 2GF0A 3CMMA 2Q2WA 4PRZA 1R9GA 3ZS9A 4JUDX 8MHTA 2ZQYA 3D4OA 4FGWA 5GIOE 4FK8A 2D7DA 2FPOA 1UWCA 3DNFA 2AEJA 3FR7A 5DK6A 2JDIA 1L5QA 1QFZA 2VIIA 2YINC 3L4KA 2HUPA 5FLKA 3PENA 3RSZA 2NIPA 2NQTA 1SB9A 1VCOA 4G5OA 1TCVA 2ZCVA 4CM9D 3GRUA 1S3SA 2ZS8A 4Q4JA 3PDUA 2XR1A 3M9LA 1XQWA 3NH6A 3TR6A 2ERYA 2I3ZA 4H60A 4O3FA 3PKZA 4BP1A 2HDHA 3K0CC 1TA4A 4P35A 1CY6A 1KEVA 5CA0B 1DKLA 1EDZA 3UA3A 3JV7A 3GN1A 1RE1A 1QUEA 1ACJA 3CX3A 5D6OA 3BQ9A 3E9RA 4YJFB 3GZTB 3UUEA 3ZW7A 4F8EA 3KV1A 4KYTA 3MRXA 4WZZA 3ZUGA 5D5HA 2Z9CA 4RH1A 2H4WA 4EELA 2ZAOA 1QVWA 2PU5A 4RSRA 3VR4H 1O6GA 2IXAA 4MWTA 1XCPA 2VP9A 2WKPA 4ZP1A 3UJ3X 4CKZA 3DDHA 4Y9UA 4LQCA 1GYPA 1GV0A 2HRDA 3ZWBA 1UBHS 2G7ZA 1KK0A 5DEIA 3RSOA 5HJ7A 3IPYA 2EP5A 3SHTA 4FVTA 1JQKA 2PD6A 3HUTA 4U5QA 3HCCA 2WD8A 3ESBA 2W6PA 3NS7A 4XZ3A 3P32A 2HPHA 3U3OA 3CBGA 3HG7A 3V4OA 4BCDA 1HETA 1M54A 1JEJA 3FWNA 1VJ0A 2Q45A 1E59A 4WCFC 2JBAA 1J1IA 2ORIA 3KFXA 1YZUA 5B6IA 5JW6A 1F51E 1LW7A 3KOZA 4NP6A 3TSOA 4LRXA 4MVJP 1ZLYA 4K9NA 4DBLC 4IJWA 3ANYB 5LOVA 1BRMA 3IUJA 5I9IA 3I1JA 3AETA 4AS3A 3IUPA 3VU9B 1BZYA 1PJ8A 3ZHXA 5DNUA 4QBKA 2FZEA 2Q29A 4WN9B 3O7WA 3OIFA 5AW5A 3ZU4A 5H3CA 2QW8A 3JWEA 4HT3B 1NQXA 2I4MA 3SF8B 4YCJA 4H3KB 2A0WA 2PMBA 3IAUA 2GZDA 2PJUA 1SVLA 1LTHR 2ZE6A 4KV7A 4WFJA 1VE6A 3FPCA 3WOVA 1M0EA 5C32A 3TIGA 2PGAA 4MUGA 3WYAA 2D2EA 2PS0A 2XAUA 4UM9D 4BVEA 4M0CA 4YCMA 2WWIA 5D3KA 5EGSA 1B42A 3QX3A 2PAAA 1YR9A 3GLRA 3U39A 5HDQA 2W71A 5LL6P 3H84A 3IR5A 3WGKA 4EKDA 3OETA 4L7QA 1CZOA 2J6IA 4IJ5A 1B8NA 2ZROA 4JB2A 3O4FA 2PYIA 3GT4A 3P0EA 1BE6A 5DNCA 1N2HA 2R8PA 4V03A 1R2QA 4PLVA 2GSWA 3GROA 4E94A 5AXBA 4I6EA 1Z2AA 3O84A 1XDDA 4B85A 3E48A 3L18A 2RB4A 5F33A 4X44A 5JYEA 4PEVA 3H99A 1B8UA 2I1WA 3I34X 4MWSA 3NHZA 2XY4A 3Q8XB 3QHPA 4KIJA 4RLSA 2OXIA 3SSOA 1UDWA 3T52A 2ORYA 2A9RA 3ETGA 5LQRA 1W30A 3IDOA 2H52A 2KBEA 3KX2A 3CO0S 2VN8A 4JBHA 3TW8A 3ZTYA 2ZUFA 5JU6A 4UDNA 2H5LA 1QZUA 4P4SA 4RHCA 3ERCA 2AOTA 3NHLA 5FI0B 3H9EO 3P96A 5DGIA 1QOPB 4JB3A 4IGEA 1XTZA 4J1NA 3VX4A 2WU4A 5CEJA 9ATCA 3C3XA 4JMPA 1U90A 2FVYA 2RHBA 5DSXA 4BEBA 4PNEA 3KSBC 2HSWA 1L7NA 5IABA 1YTLA 4XWOA 3W9UA 3QKSA 3T9CA 4B7XA 2RC6A 2YFKA 4RK0A 3LC1O 3T94A 1OXVA 4WESA 5JC1A 3ZOZA 1M2OB 2D1SA 2GXSA 4PZCA 3SF0A 4C22A 2YHUA 1ADFA 4HLCA 4PGGA 4NBTA 1S9HA 2YWFA 1BMDA 5F98A 2FSGA 2W6JA 3CH5A 3N0VA 4LJKA 3AY7A 4R40A 3NMUF 5BR7A 5KCMA 1YOVB 2DR3A 2FUCA 2GBIA 2W5UA 2OFOA 4P2BA 5HBGA 3CIFA 2Q3FA 1GR1A 2H4ZA 4ZZ1A 4M88A 4D8WA 1BVUA 4MP3A 1KVQA 4ZT3A 1JYFA 1RXCA 5DF1A 3FOFC 5F2OA 3CLHA 2G9VA 3WLOA 5K8UA 1ESDA 1X80A 2ZBVA 4ZYXA 1Y7PA 1M1YE 1J4AA 3DFMA 1RVV1 1VFPA 1YRLA 2ZJ4A 3VH3A 5A03A 3UJ9A 3B82A 4JQZA 1PJ3A 2AJCA 2DUMA 3KTOA 4LRYA 4KXLA 1Y9EA 3LWZA 3RUAA 4V2UA 3O0TA 1RQNA 4UHFA 5J2UF 1H65A 1WDTA 2PV7A 3GCZA 3LGSA 5FI1B 1N0HA 3PGVA 3OKAA 2G17A 2W2QA 2I29A 2EIXA 4FIDA 4LRSB 3ESZA 1R6UA 1E7MA 2FHSA 2HGZA 3MTDA 2M1XA 3FW1A 4IQ0A 3ZDEA 5JFTA 2XE8A 2PJZA 2ZTHA 1KSHA 4LBZA 2O57A 4DCNA 1UDAA 2HX1A 5DGDA 3EC1A 3GUYA 3T1QA 2ONYA 3C3MA 3PGMA 2VUSA 4NE9A 2AWOA 3TQIA 4UFPA 1C1XB 3KSUA 1Q7CA 2ECOA 2PIDA 1A8SA 2HMSA 4PYKA 4J2OA 4BFZA 3I61A 1F06A 4XUEA 2PNJA 2G28A 3H8WA 3W4JA 3PGKA 5FUXA 4AI6A 3C1UA 4IRUB 4N76A 2A9KA 1T35A 1NBAA 3M3HA 4G81A 4NBUA 4OUKX 5A1TA 1A9PA 3IV7A 4IR7A 4JP5A 1H0SA 1PL0A 1XMQB 1DTWA 1I4OA 1TQ8A 1ZQ1A 4XD2A 4XVQA 3ZW9A 4DPMA 2G4CA 1CETA 2EBWA 4B4VA 2EAUA 1EINA 4GDMA 3H0EA 2F9FA 3JQGA 1E60A 4PO1A 5FNVA 4PGMA 2FN7A 1SVUA 1T8UA 4DJAA 2B98A 2IEGA 1Y5MA 1NVMB 1U9YA 4I4TB 3OQHA 1JG7A 3B1FA 2OCBA 2QRHA 2GBLC 3L8DA 3LHKA 1PGPA 1KTVA 4LJ7A 5DO9A 2M6LA 3PEFA 5G1NA 3V55A 3WNQA 5LWQA 2ZRGA 1UFVA 2ZVDA 3FJ1A 1WDKA 2W8BA 2WJIA 2VF8A 1MOZA 5HIMA 1RRFA 2Y05A 3U31A 3YASA 3A9UA 3X44A 2ZR8A 2YTZA 3WDKA 1IEXA 5JMWA 2ZBUA 4YRBA 3KQPA 4LKRA 2CFTA 3CMCO 4MJLA 4EG1A 5AKYA 4EA6A 1EJ0A 4CUZA 5KTTA 1HYGA 3PPVA 1TK3A 2IFTA 1LNZA 2IZ6A 4LX0A 4HRVA 3NVKI 1J2JA 1A9ZA 3ND8A 2ZRFA 1NAIA 4EOGA 1GDHA 2UAGA 3RSCA 2GN9A 3W8NA 3Q40A 1IXRC 4UM5A 4DPKA 5AI6A 4U3JA 4KKVA 3V7WA 4DQXA 4KODA 3T4EA 4C3UA 3Q9NA 5AM4A 2HSJA 1TC1A 1S2IA 4L0QA 3L77A 3R6DA 2JVKA 4YPFA 3ZTWA 2FWBA 2P6OA 1ESZA 5DCLA 5A05A 3SBXA 4CF4A 2RHJA 3A1NA 1NVXQ 2OHFA 2Z56A 1C2TA 5E6UA 2NOAA 2PLFA 3UHPA 1IAVA 2GTHA 2ZI6A 2DZDA 3M1YA 5DXJA 1DRVA 2ZDGA 1DC8A 3CTPA 3QF4A 3W1EA 2PA3A 1GG5A 1DEHA 1JFRA 4GNRA 3J7AC 3JZDA 4YMTA 1NXPA 1OTYA 2CJYA 4RV5A 4E1AA 3TZ6A 3GCDA 5I45A 3QI7A 1IG3A 4DFDA 2GM4A 3LUKA 4S2EA 1ETUA 1FNNA 1XJ5A 1Z47A 1JAYA 1ZRMA 2W4QA 2WG1A 3K5IA 4QT0A 3EGOA 4RA9B 2HK7A 4XI9A 3VJMA 1OF1A 1KH3A 3WWPA 1CY0A 4EY7A 3L1VA 3N6RA 1ZGJA 2F1JA 2JHFA 3LC7O 4IQ4A 1A8UA 2DSTA 4EDFA 3DVQX 4Y2SA 4L02A 2HDNB 1SCQA 1R5OA 3P52A 2UYCA 1MQAA 5GONB 2VDOB 3AP2A 4M8LA 4KRFA 3C3AA 4YFYA 4P2GA 3TIIA 3TPZA 1DV1A 2I5PO 4NMHA 4JIMA 4Z7OB 1O96B 1Q12A 4EKNB 1I32A 3STYA 2DEUA 3OM0A 4E4TA 4Q7JB 2W2PA 1DQRA 5KWIA 5HKLA 2X4GA 4KVZA 1CYDA 3FUTA 4P92A 1Z2CA 4JBYA 4TUYB 1ZSNA 2IHKA 4HJRA 1PUJA 1B0PA 1FTWA 2VNKA 3A6EA 3DMFA 1LDYA 2LP4Y 3RPEA 1TTQB 1RAFA 1XD2B 3E3MA 2Z2JA 5FTJA 3V2IA 4WJLA 1LVGA 1NN0A 2IVFA 4R8VA 4A73A 3EEBA 4EJ6A 3V8VA 2PRYA 1GLGA 1HEUA 1V3QE 3SJBA 4CI0B 1GXSA 4JHXA 4DCCA 5KYXA 1MV5A 2AQKA 1YZFA 3C7DB 2CHGA 1JSZA 4WEOA 3K16A 1V9SA 4YMUA 4DB4A 9ABPA 3NJ8A 5FB3A 3L9WA 1HFEL 1LU9A 2RJOA 3JQ7B 3NALA 3PHCA 1XRQA 1IYZA 1ZZEA 1XX6A 4HZGA 2HM7A 3ZLUA 1ZGGA 3TZQA 4FEEA 4QUHA 5EE0A 5B1IA 3EDQA 1EE2A 3G5LA 4TTQA 1DKMA 3OMWA 3INRA 1DJQA 2MJLA 2XGJA 2G5TA 4OHFA 4YAOA 4XDYA 5GP1A 4PVCA 3SR0A 5MFPA 5CYFA 1WW2A 3E1GA 5ED0A 4LMPA 4DSZA 2RFLA 3VC7A 3NNDA 1ZRNA 3SHWA 1DQPA 2MYUA 3I9FA 4AG5A 4Y6RA 1A1VA 3IRVA 1CJKC 2G08A 4PINA 3KVVA 3KD2A 4HYQA 1IBRA 3O4JA 4NPAA 5ALRA 5EQJB 5G1PA 4DV0B 3L7MA 3QU7A 2JIMA 4P7BA 1CNEA 2HQRA 4Z9XA 5BSGA 2ILTA 5IKEA 4KQ2A 3IJPA 4FC7A 3GU3A 5I9MA 1EXMA 2H1HA 1V45E 4DLYA 1Z4NA 3W06A 1U63A 1KEEB 1CUVA 2EQAA 3L0OA 1RWKA 5BVGA 4X85A 1GSHA 3PBKA 4GLFA 5TSDA 1M74A 1TF2A 1U8ZA 2ZJ3A 3E3LA 4AXBA 4EWLA 4C78A 2E9SA 1LH0A 4QNMA 4EGSA 1PJRA 3BMQB 5CFRA 2YUTA 1TVCA 2ENUA 4IDOA 4F5EA 1K4YA 1QORA 5DXFA 3MQFA 4IWYA 3EXIB 1QPBA 1IU9A 3U9SA 1L7MA 4NX2A 1DV2A 4DXHA 4CEIA 1JKJB 2OE2A 3VU8A 5ECDA 2G04A 2WHPA 4FCWA 3U4GA 3UENA 2RHCA 4BNYA 1XCGB 3EGCA 2ZIXB 1I7DA 4ND2A 4PSKA 1BWPA 1X1CA 3H5LA 3HJRA 2Z30A 4RFVA 4MPDA 5JMPA 3UJNA 1U0HC 1Y7LA 1TM2A 2VP6A 3LA6A 3PA6A 1Z4PX 3PEWA 1JH9A 2IHUA 3FYSA 4Q21A 4J49A 3Q7PA 2IUSA 5ELLA 2WB2A 4Q66C 1Y3CE 2DQYA 1Q91A 1ZM2A 3D1JA 2FFJA 5T4HA 3AJDA 2R97A 1EFDN 3C5VA 4BFVA 4BP8A 4QZVA 2GBPA 2WWHA 1U0NA 3CVYA 1C0LA 5GQSA 2B82A 1IY2A 1I3KA 3PF8A 3CZRA 3A70A 4B3TB 2BHLA 2VH5R 4INZA 1NQUA 1Y9DA 4H1VA 4C9BA 2VYCA 1NBME 4YDQA 1XEAA 1YL7A 2C0PA 1U65A 2VF2A 3W1VA 1CY7A 3HB4X 2XXAA 3F3MA 3MILA 3LJKA 4KQ6A 4N0EA 4Q82A 4D43A 4OXIA 3L6BA 1XRRA 3SXJA 4BEVA 1PYDA 4QJBA 5CEEA 2FG5A 4X1YA 2JLUA 4MA0A 4R8RA 2C1XA 3ZQ4A 1CCWA 2PZMA 5B3AA 3QE0A 1GAJA 4FWIB 1ZI9A 1YZNA 1G3MA 3HUUA 2QTGA 3N7TA 3QUAA 4EW1A 5A5FA 2WFMA 4MI6A 4PNZA 4RY9A 4KGVA 2QMUA 1DO8A 4L4RA 4C06A 3L6OO 4LFCB 3SZGA 3OZ7A 2QZPA 1ZUNB 5C51B 3RVJA 5CG2A 2VUIB 4AVYA 1N9GB 2ERXA 4YACA 2LZ0A 3JW8A 3FYTA 4R1PA 5EJAA 2IW3A 3N0XA 4MVWA 3T5BA 4ZVRA 3U7FB 1FX1A 4M98A 1VKZA 4X66B 4FWTA 3OPMA 2HJSA 4EEKA 4L4SA 4EB3A 5HRCA 1EVZA 4HVAA 1REQB 1L4NA 3QUTA 1VPVA 2FDRA 2FP4A 2QRVB 4Y2PA 4F8JA 2CLCX 2QZJA 1WE2A 4MWCA 2OGUA 2KX7A 2CJXA 2WW8A 2ZIWB 2I8LA 5CR9A 4EM6A 2J4DA 2CBXA 4I2NA 4IV5A 2L42A 3CJRA 4LOKA 1E77A 1SD1A 3HVUA 4MZDA 5ALTA 3KOMA 5AJWA 5AP9A 1T10A 3SR3A 3E8XA 3KZMA 2FN4A 2ROQA 3AY3A 4L07A 1XRSB 3IEUA 3SNKA 1RIFA 5AIBA 1AZLA 1R12A 1CQIA 3VVCA 1A8IA 3K1AA 1CS0B 1TT5A 1XPOA 1J7JA 3N6XA 4J0FA 4GI5A 3AF6A 4X5OA 4LK2A 3UO8B 4ND8B 1UH5A 3VDMA 1W8IA 4XPIA 5AQ1A 2OENG 2QJTA 4N39A 5KJFA 4H7HA 3FDFA 3GRZA 4PF1A 4RL4A 4L75A 4A23A 4BLOA 4R8KA 4URFA 2B4AA 3CKMA 4DR2B 2DG2A 3GDHA 1KEZA 4HWSA 3LQFA 3K70D 3AUFA 2O1EA 3K0CA 3GLFB 5LWHA 4LI3X 2O20A 2B1RA 2P2CA 4HMQA 5FH9A 3PDIB 3B60A 3WFJA 4MPTA 2A5DA 3NM6B 4OP1A 5LZ7A 1GNLA 4WSOA 1MPXA 1RTTA 4LYDA 1I5RA 3FUWA 4DR1B 1QOQB 2A1UA 5HZGA 3ZHTA 1N2GA 4IIJF 4JROA 2P9GA 1BS2A 3LFHA 1CTQA 5J2TF 2IUUA 4RE5A 1KEPA 2V1XA 3C8UA 1WOMA 2ZJ7A 4QJ4A 3SHFA 2V6JA 5L6LB 3RTGA 1GUBA 1XWIA 4MRRA 1B15A 1NRIA 1ZQ9A 4DCPA 5A0TA 4E2FA 1AV6A 3UC5A 4EI2A 2O8DA 3DL7A 4WHMA 4IQFA 1DOHA 1ESNA 2O8EB 1I1NA 2QR3A 2NSYA 2C98A 2CMFA 1ZUWA 2GCOA 4OKNA 3WNVA 4D8XA 3HXOA 2G1JA 4N5DA 2VUHB 3O2SB 4FBGA 3KVYA 5JYDA 2VBCA 1JJVA 3IUSA 2D2FA 4RM2A 1ADCA 3GAAA 1IBCA 2CBGA 1ZP6A 2QPOA 3FTQA 1Y6QA 4MINA 2NAPA 4WCFA 1OY1A 3IC5A 3GVCA 1P9NA 2I4NA 5ERGB 1MB3A 2AA3A 4UUPA 3PRJA 1RABA 5DBEX 2CE2X 3IVGA 1UQRA 3FTNA 3H4VA 1FYEA 3KZCA 4RACA 4V02A 3JYOA 2GJ8A 3B89A 5CBPA 3NC1C 1XN4A 4C4YA 1X1BA 2HLDA 3HCFA 2VTKA 2G40A 2XJ9A 3AL0C 1P44A 4AKSA 1Z6PA 4B09A 3SLGA 4MUJA 3RFTA 2AMLA 4FHDA 2WPDD 3M70A 1UWLA 3ISVA 4FYMA 5FWDA 4DMHA 4EMTA 2P0EA 4AT1A 4D9BA 4CDNA 2GA9A 5JZ9A 3AV0B 4FFBA 1IVYA 3DUFB 3Q3CA 1TLLA 1WPQA 1YOBA 2MYNA 4EG3A 4LHEA 3L7AA 1O8CA 2XDAA 3EQ9A 1KI2A 3CUKA 3O93A 2PZBA 4WKNA 2F55A 3D1VA 1N2JA 2QD1A 2FMTA 4Z4QA 3WSTA 1EFVB 2LCQA 1RHKA 3Q1KA 4I1IA 3C3CA 3PLAE 1C3LA 1YS9A 3B3FA 1SFRA 1L8QA 1BN7A 5D1HA 1A9RA 2AYZA 1QCCA 3SPXA 4BKRA 4PX9A 5J4YA 4JI3B 2GZRA 3HBNA 3BWVA 2CFSA 4HZUA 4WLUA 3JARB 3BRSA 4QFMA 3EASA 4J7AA 2NP7A 2C59A 2IXBA 5IXYA 1KPHA 1Q7TA 4DV3B 4OB8A 3KR2A 2AG0A 3X1WA 4DTCA 1Z4JA 4QDXA 4PN7A 3ZYCA 3GLIA 3NBXX 5BMVA 3S1SA 2W6MA 1QIEA 4ZU3A 3WNCA 3NM4A 3ENZA 2ZLBA 4NATA 5KOYA 3RW9A 3KKQA 4RBNA 4BGUA 2GESA 2VP2A 3ND9A 1E89A 3I2JA 4LZNA 3MLBA 2PSEA 3AUAA 3TS1A 3HABA 3ABRB 4MW2A 4C3OB 5K6AA 2K5UA 4FR0A 3II6X 3AWIA 2FWJA 2IYPA 3MWKA 3TPCA 3DLPX 3QVUA 4DJFC 16PKA 1BE8A 3AR6A 1L5FA 3JD2A 4RKYA 1UDCA 5GJCA 1RBZA 2WT8A 2NVUA 1AN9A 3PQFA 3K0FA 3QJGA 3V7FA 4Z7QB 1WS6A 1XFAA 2HA5A 4Y18A 3HGQA 2Z5LA 1VP9A 5KQLA 2XCRB 3ON5A 2IYYA 4W5HA 4J3NA 4M0FA 1CUZA 2HJRA 3AVYA 3RUIA 2LGJA 1BTOA 3E7WA 2G36A 3JR3A 4R7TA 3WBJA 2YDYA 4F7DA 1QK5A 5FOUA 3UANA 3L0IB 4JYCA 2N46A 2NAFA 3DZJA 2J33A 1WCIA 4K9QA 1MRZA 3LUFA 1IONA 1PFQA 1L3IA 1UMCB 1KO5A 3GLKA 4QATA 1NAHA 2P4QA 4XR4A 5LU8A 4MR8A 3D5QA 3F6YA 3LZDA 1KWKA 5EJFA 4YO7A 2O2SA 1KU0A 4U7FA 4W9NC 5I5GA 5C8VA 3S40A 3I09A 5KWEA 3UMJA 3TG8A 2J3JA 2CDBA 2EWVA 3X2SA 4CKXA 1UPCA 1TYAE 1J00A 2DUWA 2JCVA 2OV4A 3IAM1 1D9ZA 3GW8A 1E79A 2LUOA 1LBIA 1GUDA 3REQB 1C29B 2P9CA 3DWIA 3PTAA 3B36A 1E7WA 4TYMA 5IH3A 3REFA 1E3LA 1L5YA 2X0IA 1OLSA 1JDUA 4R2MA 3DEZA 2NZUG 5E9AA 2QRUA 5EHIA 1RWQA 3MWLA 4JYMA 3N1UA 2F9MA 1IJFA 3H5NA 5I9TA 1W5EA 2PV0A 2W11A 4MV0A 1NBHA 3TK1A 1XYGA 4P82A 3MCTA 5DNYB 1VZ2A 3DE0X 1O0CA 1H2BA 2PH1A 3LWNA 4DLNA 1XMVA 2JIBA 5KQGA 3HDTA 3JZAA 2GBLA 7REQB 3FNEA 1SK9A 2Q2NA 1X15A 4MA4A 5FBKA 5LP1A 5AK5A 5CD9A 3C4JA 3R9XB 5LQMA 4AUMA 1OAKA 4MVJE 4PWYA 4E31A 4PXYA 4Q48A 1NYRA 4YTEA 1XZPA 4Q7EA 2WSBA 1EFRA 1ODTC 1UBMS 4W8GA 3TB4A 2NUPB 3Q10A 1SQ0A 2W58A 1BHO1 2ZUEA 5JI3E 3HPQA 3RSGA 1KVUA 1NUPA 2OVFA 2RGEA 2E6KA 3HYRA 3OPYA 4ZA2A 5KSZA 2W8ZA 1W29A 4KLRA 5G3YA 2VSFA 4BASA 4DT1A 5J4HA 4D0NA 2H0AA 4WECA 1LV7A 2PSFA 4PYLA 1NXOA 4N9QA 4BNMA 1E9BA 2I80A 5JS6A 1LLQA 5JHHB 3DGEC 4XCXA 4S12A 1CUFA 1GQRA 2VWGA 7YASA 2AUTA 1IRIA 1ZOPA 4HB3A 3TL2A 4B81A 1SBNE 3Q6NA 2WUDA 2EJCA 4J29A 1KTIA 1P9RA 1GPH1 2WD7A 3ET4A 3HCNA 5K0CA 2QN3A 4L5IA 1ZCAA 1O6ZA 4FHCA 3TLKA 1BS1A 1TC2A 4IXWA 4UHKA 5L8VA 1IB0A 1O4VA 1XQ6A 2ZBEA 5FWAA 1JEYB 2CHQA 1V5WA 3DOIA 1IUOA 1V47A 2GS9A 3BKXA 2HHCA 1VPEA 2HY7A 1UZLA 1IL0A 1G2QA 1JT9A 1Q95A 2PVPA 1NQOA 2Q2VA 2YNMC 3OZFA 4Q4AA 5GAJA 4EKIA 3GAMA 4DLZA 2XQFA 2P9TA 4U1RA 3F7MA 4WCDA 3JAMA 1K4MA 2VSQA 4JYZA 1VC2A 2IHVA 2LD4A 2VOEA 3AR2A 3ILHA 5NLLA 1RS0A 5FEUA 2FPSA 3C70A 2GJAA 3ML1A 3QQPA 4BAGA 4X8MA 3C6XA 1U3WA 2I1VB 3CLTC 1N9KA 2P4HX 4JYAB 1QP8A 4MS3B 4LXGA 2P9YA 3C15C 2FX5A 1QIGA 1Z62A 3CWZA 2BFNA 1RYNA 3I2YX 3NJ4A 4LPSA 1E1QA 2QZ9A 3CCCA 3KYCA 4PR0A 4XEUA 1IWBB 2H5IA 3QTLA 1DBWA 3M1LA 1YR1A 4HPJB 3D2AA 2VDRB 1OXXK 1S02A 3DHNA 5JNUA 5IDXA 4CEHB 3IQIX 2UYGA 3HFJA 1J0AA 2IHZA 3GP5A 4LYFA 4A8TA 4IS2A 4JJ4A 5C1BA 2B92A 3HA7A 2IZ1A 2Q62A 3LT4A 2VHZA 5C18A 1ZJYA 2PGOA 3IURA 4IG4A 3FB1A 3ZLJA 3A4LA 3QXHA 2H4XA 1LPNA 3U4QB 3KXKA 3O4IA 3UKJA 1NVTA 3W5CA 4K6GA 4CEJA 2H1IA 3QX7A 1IBSA 3D6UA 3KPVA 4P36A 1AUXA 3K8OE 3RAJA 1KMHA 3BQNB 4I14A 5EIXA 1D8TA 1Z06A 3LH5A 2WG0A 3G8YA 4R1MA 5EWMA 3U3KA 3QMWA 5GVRA 3PXBA 4XVCA 4C88A 3QFCA 4FHGA 3NXSA 2FSFA 2RGUA 2JASA 3H4TA 1DCFA 1NIJA 1ISPA 4DQLA 5TT0A 5EERA 5J4LA 4DCVA 4ZHSA 4HX2A 1UP7A 3PGLA 3QITA 3L7NA 3UAGA 4ZOBA 2BGIA 2OFWA 3L8YA 3ICWA 3ZWWA 5DRYA 5IN5A 1RRMA 1ZM7A 2NPIA 4G8CA 2IV7A 3UK1A 1CQJB 4XW2A 1D6MA 1SUWA 1FP1D 3E3NA 4XUGB 4RTOA 3FTEA 4H27A 2IYXA 4FONA 2YHBA 2JG3A 4MW1A 5ULLA 2ZAMA 4CRWB 1NI5A 1O9BA 3NP9A 1EDDA 1SXJD 2YASA 3AJAA 1L4LA 2J32A 4FP9A 2CV2A 2WTAA 1H9BA 4GMFA 1H8HA 4RSHA 3ROGA 1Q77A 1FXUA 4MXDA 1BDHA 3RU9A 3MMXA 1NHWA 4PFQA 4Q3LA 2HLNA 4RABA 5C1PA 1Y8RA 5SZKB 3OWXA 2PRKA 1IMOA 2A8YA 1PS0A 2QTWB 1E62A 3NTQA 4XB1A 5T4EA 4D5EA 2TMYA 4BTVA 1P1BA 1EP1B 3RF7A 4QXQA 1K3UB 2F8TA 5IMBA 2JFFA 2VQ6A 3HMKA 4JEMA 1DBQA 5EIBC 2WR8A 4OJKA 1JLMA 3UM9A 4DANA 1QX4A 4ZRNA 4EA7A 1OYYA 2G82A 3N7AA 4MVJF 5FBQB 3PNPA 3TOZA 5LD2C 3D3WB 2MINB 1Z15A 3MCAA 5JO0A 3WA6A 1XEWY 5LA6F 1QDEA 2OILA 5CH3A 2H29A 4RTJA 3BJZA 1VMEA 3M7IA 1CVIA 4Z1OA 4L5CA 1H2XA 3CNLA 5B36A 4CIBA 5EMHA 4BRSA 4IIJB 5G0VA 3LPMA 5TQVA 3U3RA 1R88A 3PD0A 4KXMA 3L92A 3L84A 5IVDA 4FZVA 5CD1A 2JRLA 2VAPA 3I0MA 2YRWA 2IVZA 2NV2B 3AR5A 2C9OA 2VZ8A 3OU7A 4F4JA 3O9ZA 4NBKA 4EY3A 3T41A 4TSFA 1DBPA 3K5PA 4X20B 5BUSA 1XL0A 2ZYGA 4K5QA 4EGAA 3A9RA 1R8YA 1FFDA 4B46A 2E4VA 3NHMA 3QLTA 2FSPA 3LUDA 4R7GA 4IUDS 1ULBA 1JXOA 3AB3A 4KNWA 3UNXA 1GO2A 3WJAA 1SURA 4BMPB 1XMOB 1N4DA 2WYHA 1UBEA 2JKZA 2VDWB 4TV9F 1OH7A 2HA3A 3P9SA 4WK0B 1YIAA 3ZIAA 3E84A 4BYGA 3S2ZA 4EA9A 3FFAA 2WZBA 4R0NA 1P4SA 4J4HA 2FCAA 4ER5A 1KFEB 5G53C 1KWGA 4BAZA 1UBRS 4TVSA 1GARA 4DLVA 4YPVA 1K88A 1H1DA 3AM5A 4KO3S 2VSNA 3BIWA 1LVHA 2QMZA 3UXYA 4YAWA 1MN6A 1X8LA 4RA6B 2JEYA 2VCYA 1LK7A 3DOEA 2EZ4A 4MQLA 1T8WA 3D6NB 4DBZA 5AW6A 3DGFC 2OOSA 1YA8A 2B4TO 1SK8A 3PDWA 4JQSA 3WFIA 2EKBA 1ZU4A 3RSQA 2O6LA 3N74A 4E03A 1FFXA 3PUXA 4PU0A 1ISFA 5EAIA 2FMHA 3DBIA 3OEED 1PZEA 1H05A 3G7NA 2FRVA 1TQ2A 2CCJA 4LZWA 3NEPX 5F4ZA 2E4UA 2PH7A 4EVRA 1A9XA 5KX5A 4TWAA 3OSUA 3O5AA 5CXQA 1WSWA 5EVJA 1T3HA 3FWKA 3GUHA 5IFKA 4LC0A 4EAAA 5JAMA 2CT8A 1M75A 4QJIA 2Q4BA 4ZDKA 4P31A 5FTWA 1V7PC 1UJBA 3T3IA 4CPDA 1YJBA 3A9CA 1YK0A 1DINA 3N0WA 3WVNA 1J2TA 5TE9A 2QUBA 2PBLA 3WLFA 1J0CA 4M6WA 2I6FA 1M6EX 4ON9A 5AVWA 5GJWC 2WFLB 3ESRA 3QVKA 4YJDA 1NW5A 5K4HA 3WO1A 2FETA 4FGSA 4PO3X 1ZL0A 3RG2A 3ORFA 4JLBA 4Z3OA 2WZCA 3DFFA 1QG4A 4KN5A 3S2UA 1A5SB 4JU9A 3WLKX 3WMFA 3P0FA 3WYDA 2FYTA 2GF2A 3SVTA 1JTVA 4YJKA 5CAEA 2J9YB 5L3SA 1SEPA 1QWSA 1FBTA 4B7AA 5B55A 2VQ3A 5IYZA 3R9WA 2XTZA 1T2VA 4P7KA 4XM1A 3DDCA 1ZINA 2G09A 3BRWD 1USUA 4U6QA 3VPSA 2GHRA 2QTMA 5AKHA 5FUBA 5HKOA 1GU1A 2DHDA 4CV2A 2ZM5A 1NG9A 3GJ4A 3DVAB 4NJEA 1JB9A 3KZNA 1QIIA 4L16A 2V5AA 5H9WA 4QICA 1X1QA 4V2IA 2CHFA 5EKXA 3RU7A 2FPMA 3W2HA 3CHYA 4ECAA 1QR6A 1TM7E 1YZQA 3IEIA 5JCXA 4XIIA 3GOQA 1COZA 1EBUA 3NHBA 4AQYB 1PW7A 1N2OA 5K0NA 3WGLA 4KNVA 3O94A 2WB4A 3KSMA 4Z9AA 4H77A 1O97D 3V2HA 3VOTA 2WF5A 3EG9A 4C5BA 3I73A 3KJGA 2UKDA 4N3CA 2R6JA 3VQTA 3HLYA 4HGRA 5JPCA 3DTYA 3LKBA 1ADJA 4NBVA 2ADFA 5K8VA 3IP5A 1QQ5A 3JYHA 1KERA 4TKUB 4KE8A 2BKAA 4OP2A 2B7BA 3UCEA 2A78A 4LJ5A 5IULC 3N75A 3S5JA 2H1FA 1KVRA 5JBQA 2O14A 2AQHA 4RIEA 3U1BA 1ECGA 2RJ3A 4TYWA 3NTRA 4GKJB 1QWOA 4HQKA 1UZUA 1H5UA 3HNOA 5FTMA 4IOKA 4YRAA 2QZZA 4ROTA 5GINE 1E2EA 3BA1A 4CCYB 4LCJA 1V6CA 2FQ1A 5FNZA 4BMNA 1VKJA 4CM8B 1ETHA 4LJRA 2ZB8A 1R0ZA 1WBJB 4BFTA 2A9OA 5I5EA 4RH3A 1BX3A 1V1RB 5HS6A 3RD5A 4A10A 4PYMA 3B9RA 5I7SA 2VKQA 1Q22A 4EAQA 1XN1A 4CFYA 3AJEA 3MQ4A 1MF7A 4MLDA 4AIRA 2QQ5A 4C6TA 2FSIA 4UKDA 3UVEA 3CW9A 1KJWA 1VKOA 8AT1A 5JCZA 3G6KA 3EZLA 1JEDA 3GJXC 4L57A 4XWTA 2FGKA 3EVTA 1D8AA 1HOXA 1GTMA 1V8FA 3Q0IA 3OT1A 3RRNA 2B99A 4RPLA 3NAQA 3LBHA 2E48A 2EYQA 3PCXA 3GT7A 5FTLA 4QVKA 3F9CA 4JC5A 3MHPA 2YKGA 3AH8A 3UXEA 3WIOA 5HGXA 4RQTA 3HCRA 5BW4A 1P2GA 1MEEA 1QVAA 3Q0EA 2AUNA 3AILA 3RYIB 2P7HA 2NUBA 4R1OA 5JNSA 3THYA 1JHMA 3SQDA 2TMKA 3FI9A 3O4RA 2P4EA 4QBIA 3ROMA 3WK7A 1B43A 1Y8QA 2O0MA 1QR2A 4WXPA 1OBOA 2P65A 1EGMB 2JAHA 5EQFA 5DTJA 4K0KB 1OXTA 2ZIVB 1CUHA 3K9WA 4KITB 1PEAA 1TM5E 2DERA 3O8QA 4DAOA 3PL5A 3BM5A 4TPKA 1ZJJA 4DEYA 3UMBA 5H8WA 3UT0A 2YJTD 2IYSA 3W8DA 1PK7A 3DV9A 1I5EA 2IXEA 1E2KA 2HBZA 2IEAA 2Z1NA 3B6JA 3LC2O 4TS4A 1MDBA 3GVHA 1N7GA 4W6QA 4GEGA 3ASVA 1NXVA 3H11B 1PJ4A 4WZ6A 1L5ZA 3UK2A 2X8JA 1X7DA 2WAAA 4OFBA 3R7DA 1DFHA 4EFDA 3TDMA 1S5PA 3PYMA 4RZXA 5DZSA 3AVVA 1CZUA 3P9PA 3LXUX 3HE3A 2BSXA 5BQFA 1WZNA 1JPNA 4DV2B 3AYXB 1KXZA 4G89A 2ANBA 2HQ1A 2ZRLA 4Q3DA 3VYVA 3IL2A 1XDSA 4N12A 3KZKA 3TFWA 2C5EA 3OLVA 4YJGA 1Y6GA 1FF9A 1R8SA 4NDZA 4TYPA 5BWMA 3H8VA 1MIHA 3F6BX 4P0TA 3AI1A 4RVSA 2NPOA 4A6PA 2RK3A 4GLOA 3BREA 3OJCA 3C8MA 1T34A 1VHDA 4ACAA 3L7KA 1FCJA 1GAEO 2LPMA 1TJ5A 5EGNA 1ZSYA 1DOZA 5CITA 1JKIA 1Z29A 4GOJA 1EFPB 4W9NA 1W75A 2PUGA 1GGNA 3B3JA 1BH6A 1WCYA 1YRQA 3C6QA 4K87A 3KZ1E 4QKQA 4EHBA 3WYFA 1CRZA 1CUCA 4Q1VA 4ND4A 5JISA 1MAVA 2H2DA 2VAXA 3B2NA 3M5DA 1FNSA 3LVRE 1PHPA 4HN4B 2O3SA 2QUKA 5D6NA 1C9EA 4LXQA 2FQQA 2BFCA 4KO1S 2JPDA 1I8TA 1VGVA 5DOZA 3W79A 4ESVA 4FDAA 4KWTA 1E1RA 5K03A 3K7EA 2GZHA 3LC0A 5BN1A 3O8NA 1UOOA 2F9LA 2HZBA 4UUQA 2RKWA 4L4YA 1QF7A 2C2WA 4I81A 2JD1A 3NR2A 4RZHA 3GI1A 1OKKA 3DBHA 1CR2A 3SKYA 2J8ZA 4IIUA 1CUJA 1UKAA 3BXXA 2NO5A 1E7QA 3GEBA 2Q5QA 4MUHA 1DAIA 4E4YA 4DIOA 1GR0A 3VPXA 2FPIB 2JGRA 4PLTA 1KL7A 2PXHA 2DFTA 2ZRKA 5FKJA 1XTJA 2JVIA 4C2BA 5K9ZA 2NUTB 4K2HA 4B3RB 2EQ5A 2X58A 1OX4B 4NBNA 4QHTA 3MS4A 4QOGA 3VTFA 3W5JA 2FEMA 5IARA 5ICCA 3GHYA 3EC7A 3T7TA 2E18A 3P26A 1LXCA 1PT5A 3FOWA 1ENZA 3MQ2A 2JD0A 2WZQA 1P81A 2ECQA 2W6JD 1SPBS 3VYTB 2Z2YA 4US0R 1NYLA 3REOA 1OH6A 1A9XB 3PE6A 3DLHA 1OAOC 4R2LA 3HY6A 4FS8A 4OF4A 1ZXBA 2GDZA 2VF4X 2VYFA 3QFRA 4QC2A 5EKUA 2HMAA 4EUHA 1XXHB 4ZIRB 9LDBA 4YP5A 4EHFA 3BMOB 3W9SA 4RVDA 4NENA 4DCUA 1ODSA 1XP8A 3JD0A 4Q24A 4AULA 4EB6B 1AMUA 3L6CA 5IDYA 3TUZC 4LHXA 3IOEA 3BXPA 4NYIR 1L7QA 1NE7A 5JTTA 1BKDR 1YBMA 2ATEA 3LNTA 3HBLA 4ZEWA 1OLUB 3CRMA 4JI8B 2OAEA 1QRDA 4Q01A 2C95A 5K45A 3STWA 4AKGA 3OKCA 1E8MA 1V4NA 1WIWA 3M1IA 4N82A 3VO1A 7ADHA 2G9NA 4P0QB 2EJVA 3AYZB 1S2MA 4Q1FA 4ZU6X 3ROXA 2EWWA 1RP1A 4P54A 4KG7A 1ECFA 4Q12A 3CV3A 4G5GA 3B1KA 4F2DA 4IHQA 3QELA 4KP7A 3VBEA 2D59A 2FNAA 2MOKA 3EEFA 5FPQA 2XEXA 5LXTA 3JQBC 1T1JA 2YNMA 3LGAA 1NDUA 1OTHA 4RADA 4YBZA 3DMRA 4DR7B 4HAUA 1D1PA 3RIGA 2BFFA 2DU8A 4BIIA 1WHSB 3LBAA 4G09A 4ND5A 4YYZA 3PZBA 1B0UA 2X2EA 1GTVA 3Q8MA 1F6WA 4M8NE 5DHPA 2I4IA 1PLJA 3NKFA 4M9UA 3R9KA 4WINA 2FEWB 4P3PA 6Q21A 4ID9A 1ZAYA 4GI7A 1FQWA 3PZRA 3GXOA 1W5AA 2DUUA 2OCYC 1LRLA 1JDBB 4JLAA 2A5JA 1OGYA 1Y5NA 3Q72A 4ZJZA 3G8BA 5CP8A 4TV9B 5IJZA 2EWMA 1DCTA 4KQ9A 1ZJ6A 5AKZA 3QU5A 4OHUA 4W99A 5DHFA 1OIVA 4JL5A 4TS3A 2CNWA 1MHTA 1E63A 3PA8A 1TFUA 1I3NA 3PD1A 3H0KA 2IT1A 2Z98A 1T9GS 1YDMA 1ULUA 3SQNA 1OHHD 1N2CB 2V97A 1H2AS 3SIPA 1IJKA 2WYUA 1TEHA 3B9BA 4RH0A 3QFHA 2RB5A 3GD7A 3EGDA 1IZYA 1CQPA 4V0QA 5DVZA 3SE7A 4FZRA 3U19A 2POCA 1WDLA 3AESA 5ABPA 4OBWA 1T4CA 3S27A 5F12A 4B3SB 1XF1A 3DAFA 2OV2A 3O31A 2BLNA 2W98A 3BFXA 1OLOA 3C48A 2KI5A 3T5CA 3AXTA 1KHHA 4A0FA 4DWWA 3DZCA 1K66A 1Y0BA 2P3SA 4TRJA 2VBFA 1Q1GA 3KUKA 2REQA 5C53B 4UHCA 1XRMA 2ZE8A 4HEJA 4OY3A 4BBAA 2COKA 2ZIZA 1ONPA 3W3AA 4O4JA 2PUWA 2C2BA 2IPNA 3COZA 1E7YA 5BQ3A 2IBTA 2TSYB 2G5PA 4J4BA 1OI3A 4ZODA 4EHHA 1USGA 2QL5A 3GLFE 4JVOA 1RQLA 2NXNA 4K0RA 3TNJA 1DG9A 3F4BA 2E0IA 5HPYB 5A6VA 1RHQA 2XUIA 3PFBA 4Q3AA 3GFQA 5I6DA 1BXGB 3HBFA 3UGQA 2AFIA 1RKBA 3UAWA 4CLOB 2YX1A 3UA4A 3UUFA 2Z6AA 4EHDA 2CWWA 4QDOA 5JXGA 2G25A 1C2YA 1C4KA 3SJZA 4KQJA 2Y1CA 1OUMA 2BGUA 2HN9A 4KDRA 1NMZA 2C3PA 1J5EB 4NH0A 4B43A 5IEBA 2MR6A 1T6XA 1OZAA 1SIWA 2H16A 1WXQA 2L82A 3ORSA 3OUZA 2A88A 4WH0A 2FLVA 1VKNA 1LGYA 2NTYC 3O3OB 3HGTA 3WHKA 4DQDA 4PGAA 2DP4E 3RRFA 4J0CA 3D0RA 3ICOA 3TR5A 5I7EA 4P84A 4ESEA 2SKDA 5I01A 1RPAA 1UBNA 4BDTA 4MGHA 1ZK2A 2JIRA 1RT9A 2VHJA 1C14A 1FUIA 1HKUA 2PZAA 3FNHA 3L41A 3LG2A 4PYRA 5H59A 1G9XA 3K4HA 4YRTA 1SCBA 4S0ZA 5BNIA 1R0SA 2WP0A 4EUKA 3C1OA 3U48A 1A9SA 4CFSA 2XB2A 3UHOA 2HCRA 1Y6RA 4B87A 2A5YB 2EFGA 2F90A 1CJBA 1KMNA 1PYOA 3QYJA 3ZBUA 2W2KA 3ETDA 1G6HA 3NFRA 5C9ZA 1W1UA 3QBVA 1BA3A 4W5RA 4YMSA 4JVLA 4P86A 1E2NA 1O9HA 1XCLA 1WDWB 2AOUB 3TRDA 1ESEA 4H9GA 3SS9X 3HR8A 4G86A 1D2MA 2FWIA 1NN5A 3D81A 2XF2A 4M8KA 3WQQA 2NADA 4TGLA 1EEHA 1HK7A 1PX2A 2XWJI 4Z86A 5EPUA 4HDQB 4KLCA 3VOAA 4XJSA 3NV7A 1WQ1R 4F1KA 2BKLA 5DTRA 4I0WB 2FN9A 4LSWA 4O1MA 4K7JA 1HNZB 3GY0A 1M2KA 1UM9A 4FIZA 4AN1A 2H5EA 3CN7A 1UXKA 421PA 3K53A 5DW3A 4COKA 1YDFA 2ZJ2A 5IK2A 2VJCA 4O4IF 1HT3A 4GMGA 4NCIA 4Z4HA 3RC7A 2RGRA 1I0IA 1U2QA 1HTTA 2I7XA 1HDZA 4DRZA 2X5XA 3W1WA 3U7HB 1WXGA 5BN4A 1P5FA 1SHUX 3OM9A 1I7QB 3L93A 4TL7A 5K4GA 4NK4A 1U7OA 3AEQA 2RGXA 3GPDG 2RMKA 3OG9A 5GGXA 3R7NA 1G0OA 4R6WA 4CMIA 4BP3A 5AM3A 1L9XA 4L5JA 2C4WA 3Q7QA 4Y6PA 1R4NB 5KTRA 2ZG6A 4MULA 3MOIA 4BO8A 2V98A 3F8SA 3E3OA 5JAHA 3NKLA 4NCXA 4BQEA 1GFIA 5ENDA 5KKNB 1G21A 3FAZA 4C4OA 1KFCB 2W93A 2YC4C 3BTVA 2LKDA 2PWYA 4QLOA 5D3QA 4B84A 3RYCA 2ODWA 1YJ5A 2JJQA 1VE3A 1ABEA 5I9LA 1D2EA 4CIWA 4ARCA 4FN4A 4B8YA 4IIGA 4QAJA 2CFRA 3ZDDA 1Q0TA 1I0ZA 5JNLA 3A1FA 3GRKA 3CKKA 4UJ5A 3KQWA 1UBOS 3QMVA 4V38A 2XCOA 4ZZ0A 3F6CA 1CVLA 1CIJA 1FX0A 4QPNA 3DC2A 1WLYA 3ASYA 4XGRA 5KO2A 3K9LA 3QP9A 4QOSA 3D4NA 4N3AA 5L3VA 2QVGA 2C7OA 1EWKA 3WLLA 2H2IA 4J2HA 4X91A 1NJSA 3D7KA 2LXNA 3ADBA 1D4AA 3TI7A 1K6JA 2CFIA 5HMMA 3O3NB 4HGYA 5M5BA 3UOGA 4DR5B 2QBYB 5AM1A 1DG1G 3JQ9A 3LF1A 5BURA 1JZSA 4UE3S 1H6CA 3UFXB 1E3JA 3TZLA 2C54A 1O87A 1Z5OA 4XLTA 3TNDA 2LRHA 5JBNA 3VDNB 4F3TA 4KC0A 3ND6A 1CEQA 1JMYA 2JFWA 1YRWA 1J0EA 2YHIB 2O2ZA 3LIPA 4W1PA 5B6JA 2I9PA 3U44A 4G0MA 2PDAA 3EFEA 2PZLA 2R8YA 3LDHA 4FMDF 8OHMA 3CVVA 1N92A 2BEKA 4G9EA 5KDOA 3K70B 2P91A 3EZ9A 3LOPA 1F4LA 3E8MA 3Q87B 1XCOA 4QX6A 4MLPA 4KGXA 2PUJA 1RYZA 5TEVA 2ZDQA 4YV7A 4ND7A 2WYOA 1I0LA 2D74A 3V3KA 5DN6A 5KI6A 2R7KA 5ITZB 4HQ0A 2WQ7A 2O7VA 1YVRA 2Q4TA 5D3MB 5HUHA 2CB9A 4URYR 2QSZA 4FU0A 1J25A 4MUAA 4JA2A 3R5HA 4F3RA 4YK7A 4LJ4A 1M76A 1W6RA 3LW8A 2ABWA 2AKYA 3SLRA 3P9RA 4HXGA 4MI9A 4I3HA 3VZDA 2JEZA 1GPDG 4P4TA 5GM2A 4LF7B 3VOBA 1NC3A 1KI3A 1YH3A 2Q6IA 3IGFA 1CRLA 2NVWA 2ZPTX 3EZYA 3NBUA 2YWXA 4X92A 1CQXA 1RYFA 4D46A 5K3CA 1KP2A 3OLZA 5KOHB 5J5CA 3KXLA 1EGVB 2Z4RA 5LQJA 4C20A 5HF9A 2VJDA 1R9JA 1PVDA 1E3IA 1L4YA 2J7PD 2JCYA 3AJ8A 4AW9A 5JAUA 2HF9A 1RDFA 3PRKE 3T4PA 3CX8A 1TXGA 5L6MB 3A37A 4F6CA 4LK3A 1FNMA 1SVWA 3AY0A 3DL4A 3JATA 3KCNA 2ZTSA 3RJZA 1P4RA 4XWYA 1Q1NA 3TTWA 3GFOA 1YS7A 3OOYA 3NYQA 5E0KB 3EBOA 5HZMA 1VMKA 3WADA 5L7WA 1FXSA 3QE9Y 2R44A