4NAVA

Crystal structure of hypothetical protein xcc2798 from xanthomonas campestris, target efi-508608
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
181
structure length
181
Chain Sequence
PYSPLQDLPADLIDRAARVRLACFDVDGTLTDGRLYYDHAGNESKAFNVLDGQGLKQLEHAGIHVALITARASLSAEKRGQDLGLHVQIGVKNKRLAVLALCQEHGLSLDQVLFMGDDLPDLPALLAVGLPVAPANAHPWIAERVQWHTRARGGEGAAREVCDVVLAAQGQVDSIIARFSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical protein XCC2798 from Xanthomonas campestris, Target EFI-508608
rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Hydrolase
molecule keywords HYPOTHETICAL PROTEIN XCC279
total genus 57
structure length 181
sequence length 181
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4navA00
1WVIA 3A1DA 4FE3A 2IOHA 5AKYA 3RFUA 3EF1A 4UM7A 2YY6A 1SWVA 4NV0A 3L1VA 3OCWA 1VFPA 2W43A 3QUTA 3OPXA 2B8EA 1QH9A 3N8GA 2I34A 5AI6A 3N07A 2YMMA 1Z4MA 3QUBA 2RAVA 2HOQA 5IT4A 4UAUA 3AR8A 5ALVA 4C4TA 2P27A 4OD0A 4UW9A 2HF2A 1XPJA 2ZBEA 3A3YA 5ALFA 1TE2A 4BNDA 4L57A 2ZOSA 1VJ5A 2B1RA 2I54A 2HO4A 1KYTA 5ALRA 1Z88A 4Y2YA 3QXGA 1TJ5A 4HAIA 3AR3A 3AR6A 3L0BA 1WPGA 2PR7A 1JUDA 2I55A 2BY4A 3J7TA 3IJ5A 4BX0A 4E88A 3FPSA 2YMPA 2GHQA 3WGVA 4EENA 3SHQA 4O8CA 1RKVA 2HX1A 3WK9A 1TA0A 1RKQA 2CFSA 3W5AA 3W5CA 3DDHA 2B82A 5AKKA 4KNWA 2DQSA 4G9BA 1Y8AA 1CR6A 3RF6A 3MC1A 2FPSA 2HF7A 3WKCA 5AKZA 2YJ5A 4BYGA 4QJBA 5AK6A 3UM9A 5AVVA 2BDEA 3EWIA 2ODAA 1RKUA 2WF5A 4Y2PA 3AR9A 3ET4A 5IT0A 5AW7A 5FP0A 5ALKA 5AVZA 2P11A 5AM3A 2P69A 4L6AA 3QU5A 2EAUA 1WZCA 2X4DA 2JAUA 4CF5A 4CF4A 4Y2UA 2C88A 4YCMA 2FUEA 3I6BA 3S6JA 4FYPA 3ZTWA 3QNMA 4L6CA 2I33A 4BBJA 3OCYA 5AVUA 4GIBA 1QQ5A 1Z4OA 2B8JA 2ZG6A 1L6RA 5E0OA 5ALNA 5ALPA 3IRUA 5ALYA 1RLOA 2MSNA 3PCTA 4CF3A 1PW5A 3E81A 4KX3A 3NUQA 5ALHA 5IS2A 4DWOA 4DW8A 2I7DA 2HSZA 4FFDA 5AW8A 1Z5GA 1RQLA 4HGPA 2FPWA 5ALDA 3U7GA 1RLTA 2BDUA 2WF6A 1Z4JA 5AVTA 3UMCA 3KBBA 3PGVA 3ONNA 2B1QA 5AKIA 2O9JA 4UM5A 3OCVA 1LTQA 3NAMA 1NRWA 2QLTA 3U7HB 5ALUA 5AICA 3QYPA 3WGUA 2G07A 1U02A 4EX7A 1AQ6A 5T41A 2OYCA 3HLTA 3WKDA 4KYTA 2YN4A 3L8GA 3HYCA 3L8EA 3ZI4A 2R8EA 2FI1A 5AI5A 3DAOA 3U26A 2WFAA 5AI8A 5AW3A 1L7NA 4J2TA 1N9KA 3EF0A 4XE5A 3NANA 4QQFA 3DNPA 5ALOA 3PGLA 2G80A 4OCZA 4C4SA 3W5DA 2HEGA 3FM9A 2Q4RA 3MMZA 4YGYA 3FGOA 4EZEA 4UASA 3IB6A 2EATA 1U2SA 3ZUPA 2FDRA 4I9GA 3QU9A 4NWIA 2GHTA 2ZBDA 1X42A 2IA5A 3WKBA 4KN8A 4NFLA 1TJ4A 2VKQA 3N28A 3ESRA 5AW4A 2FPXA 3VAYA 1YNSA 4IG4A 1T9ZA 4KNVA 2C8KA 1L8OA 4Y2SA 3QX7A 4IFTA 5ALLA 1QQ6A 3ESQA 3NIWA 1FEZA 1NF2A 1T5TA 3TLMA 4MWOA 4HGNA 5ALGA 4PNHA 3ZTYA 5A3QA 1ZS9A 2GO7A 4ZEVA 4XOUA 5AW1A 1ZOLA 3OTQA 2P9JA 4XQ0A 2HHLA 4Y2XA 2FUCA 2CFTA 4UMVA 1U2TA 5AI4A 1SU4A 3UMBA 2JARA 5AK3A 3ED5A 4HGQA 5ALQA 3M9LA 5A3SA 3WK4A 4OHFA 3N1UA 3BWVA 3QGMA 5A3RA 4CNQA 5AVRA 2NO5A 4UARA 1Q91A 2YJ6A 4BKMA 1QQ7A 1YMQA 3L0CA 2C4NA 4BX2A 4EEKA 1XP5A 3DV9A 5ALXA 1J97A 2OM6A 1Z4NA 2G0AA 3A1EA 2R8XA 2YJ4A 4Y2TA 3U7EB 1RMQA 5ALWA 3WKEA 4Y2JA 3I76A 1IWOA 2AUTA 5ALJA 2YFYA 2AGVA 3AR4A 3N5KA 5AVWA 4Y2RA 1ZD4A 2JGAA 3UMGA 2HDOA 3E58A 4RETA 4ZEWA 3WK6A 1N8NA 1U7PA 1Z4IA 3A1CA 3B9RA 4HGOA 5AKHA 1L7PA 4JDPA 1XVIA 5ALSA 4CE6A 1YDFA 2HI0A 1O03A 1SWWA 2IOFA 4NAVA 5ALZA 3EPRA 3ZX4A 2W4MA 1TJ3A 1J8DA 2YBDA 2B30A 4UAVA 3ZU6A 2RARA 2PQ0A 3M1YA 2EARA 1S8OA 2IYEA 2OBBA 3MPOA 2OA0A 4JB3A 4NABA 3U13A 1RMYA 3B8EA 5AK4A 4OFZA 3FVVA 1T5SA 2CFRA 3D6JA 1ZRMA 2YJ3A 2WM8A 5AKJA 5AIBA 4BX3A 2WF9A 4UU1A 3WK8A 3SKXA 3E84A 5ALIA 1Q92A 2Q5EA 3I28A 3W5BA 1RPZA 3ZVLA 4HGRA 4J03A 1YV9A 4I9FA 2FPUA 3FZQA 3KZXA 3L8HA 3SMVA 1Z4PX 5AW0A 1NNLA 1CQZA 5AKXA 4C4RA 3QLEA 2WF8A 3OCUA 3QU2A 2JAWA 3MN1A 2FPRA 2YMLA 2CN1A 4AS2A 4F72A 2I6XA 3NASA 4YCNA 1RLMA 3AR5A 3QUQA 4UATA 3F9RA 3I1YA 2AH5A 4UMFA 1O08A 3OCXA 1VJRA 3NALA 1Z4LA 3ZWKA 4F71A 2GMWA 1Z5UA 2G06A 2D2VA 2G09A 2HCFA 1EK2A 4HYTA 4YH1A 1RMTA 3PDWA 5AW6A 3CNHA 4B6JA 3R4CA 2QYHA 4BNDB 3E8MA 4Y2VA 3SD7A 3L7YA 5AVYA 2R8YA 3WK7A 3FPBA 4H1WA 3BA6A 3U7FB 1L7OA 4ZEXA 1ZD3A 3ZVMA 3SKYA 1U7OA 2G08A 2MU1A 3AR7A 1Z4KA 5AKGA 1Z4QA 4DFDA 2R8ZA 3KD3A 5AVSA 3ZVNA 3NRJA 3OCZA 1RDFA 3SLRA 3KC2A 3QU4A 5AKLA 5ALTA 2YMQA 2O2XA 4KX5A 3SF0A 5AW5A 4XPZA 5AM2A 1RC8A 3U19A 4YCLA 1ZD5A 4AS3A 4BEVA 4EELA 1S2OA 2RBKA 4RESA 1K1EA 3GYGA 3WKAA 3QUCA 5AI9A 5JJBA 5AI0A 2WF7A 3B9BA 4GXTA 2IOFK 3WK5A 2PKEA 5ALMA 5AM1A 1L7MA 2WHEA 1LVHA 5ALEA 4UMDA 4AP9A 4MUMA 5AKEA 2ZXEA 5AIAA 1QYIA 1MH9A 3ZX5A 3R9KA 5AW9A 2B0CA 2RB5A 3K1ZA 5AVQA 2C9MA 2G1AA 3R09A 2NYVA 5AM0A 2C8LA 2NO4A 3CZ4A 1RRCA 3L5KA 1ZRNA 2JAOA 4G63A 3P96A 4YIKA 4DCCA 3KDPA 3AR2A 3ZW7A 1EK1A 3QU7A 5AHXA 5AK5A 4EX6A 2GFHA 5AM4A 4YIHA 2ZBFA 2Q4TA 3L0YA 3ZWDA 2W11A 1WR8A 1YS9A 3KOOA 5AM5A 4UMEA 3ET5A 3L1UA 4Y3UA 1RQNA 1L8LA 5AW2A 4Y2QA 2AMYA 5AESA 3L8FA 4UU0A 5AVXA 1ZJJA 1ZD2P 4BEWA 1YJ5A 2FEAA 1F5SA 2ZBGA
chains in the Genus database with same CATH superfamily
2Z2ZA 2XUHA 1P31A 1J8VA 4MH0R 4O4JB 4P4UA 4E7OA 2WTMA 2PLWA 2OZLA 3RYCB 4LNAA 1C0EA 1J2EA 4NV0A 5EP1A 5BVHB 1PUXA 1SKQA 2Y1FA 4WKCA 5IASA 1XZJA 3H17A 4K6CA 1P1JA 3IYLW 1C9MA 1E5LA 2J85A 1AD2A 1X0VA 2B36A 3LWNA 1NWHA 3PFFA 2GJKA 3RYFB 2QY6A 1NM5C 1XQXA 4JT4A 1Q17A 1MO2A 1LSOA 5IT4A 1XC7A 3MT7A 3NTUA 1IQPA 3A28A 3GRCA 2I62A 4BL5A 3AUXA 3IEMA 1E2MA 5HBRA 4XWWA 2F3UA 3GJ6A 3TXYA 1EVYA 1Z9BA 2W2VA 3IBCA 3I8XA 3KETA 4N3GA 3IE2A 3C3AA 3FUCA 2YWDA 3FNGA 4QNRA 2QE7D 1A2BA 1GSOA 1OZGA 2CUZA 1LPOA 1XDSA 3LBYA 2GPYA 4Z54A 3ETGA 4LPSA 5CVEA 3KEMA 2QYOA 1Z34A 4MKRA 2BJWA 1QCDA 3MJRA 1R6VA 4MIYA 2Z9DA 3G49A 4O63O 3AHCA 4EJSA 4DA0A 1SUDA 3S8YA 4ZMBA 1T3TA 4M1MA 1T8UA 1XCGB 4KO4S 4XTRA 2AYYA 4P36A 1Y3HA 3OZSA 1PR4A 4U2EA 4NULA 5IEBA 3WRWA 4ZALA 5G1PA 3OPMA 4OGKA 3F1KA 3L79A 1UPBA 3DD5A 5LD2C 2BT4A 2DFVA 4BLTA 1Y81A 4D3YA 1M2EA 3E4CA 2QBYA 3DEKA 1Z6QA 3ONEA 4E88A 5DOVA 1E9DA 2VHUA 2ZTLA 3DMTA 3GRZA 3I92A 5D00A 4WBNA 5FUWA 3LH5A 1DAOA 3SHVA 2KLHA 4FOPA 1LB1B 2QRVA 4NJEB 4HWOA 4PXSA 3ZC3A 2XCQA 4F85A 1HFEL 3Q7EA 3M5CA 4JBGA 4QJIA 1A1VA 4ND8B 3AL2A 4WFJA 3IEVA 1EX9A 1MX3A 5E3IA 1TB4A 1WCIA 3MOGA 1ZN8A 2QU7A 2JVKA 1IJBA 1UH5A 1DCMA 1JLMA 5DLPA 1KH2A 1SEVA 3QPUA 3A9CA 1P9LA 4NMLA 2IXBA 4C7KA 1T6NA 4DM7A 3K96A 3WKCA 3CTPA 3W05A 1YZ3A 2WYVA 3AETA 1ULAA 1NUPA 5F5NA 3F90A 3GLUA 4F5YA 4R2XA 4IL5A 2B61A 3B8HA 3FETA 4FLMA 1WY7A 2BGGA 1G8MA 3A3OA 2C0QA 4MZXA 4EEXA 1XKLA 2A9FA 4WNCA 4I55B 1SU7A 4INZA 4XGRA 3BWMA 2TSYB 3EY4A 1MX5A 4G1FA 4HSEA 2CHFA 5T4BA 3G2LA 3WXMA 4RQAA 4CHGA 4EG6A 4BVLA 5AM3A 1GYPA 2J32A 5KTNA 4PHTA 2VOEA 4JAVC 1WXQA 4FONA 3AF4A 4G0YA 4RD3A 5E9WA 3T5DA 4Z7JA 4HDRA 4LXHA 3TW4A 5CITA 5KBYA 3GRRA 2HMTA 1KZ9A 1SCDA 1XSEA 2Y05A 5CCEA 1I4TD 4RYDA 2ISSD 3HS3A 4HNRA 2IXAA 3PS9A 1R66A 2PKYX 4B8WA 2YNMA 1D2NA 1JDZA 5KNBA 1YR7A 4RWEA 4CG2A 2CXOA 1N5IA 1WXHA 3N6RA 4JR2A 5DGTA 1XZCA 1IHUA 3O2QB 5F2EA 3RB8A 2XVMA 2FN7A 1QFSA 3C3EA 3LOUA 4UNSA 4ZODA 5FQNA 4RGYA 4U2FA 2BF4A 5G1OA 3JAWA 4YRKA 1UR5A 3O82A 1SVOA 1I32A 1DRWA 4BXOB 4LJ4A 1RLOA 1C29B 2QW0X 2YV3A 3ORQA 2ODPA 1UQUA 1DC6A 1I1NA 4YJHA 1VLJA 3SDZA 4ZC8A 1O0BA 3FVQA 4YJGA 3UOGA 2QD3A 3H5LA 2NTVA 4F7DA 2IP1A 1JXQA 2ADOA 3CXUA 2P9YA 4BC0A 4BXOA 4Q0MA 4JUIA 1RI4A 4RVOA 4ARAA 2PAFA 3R6GA 2Q2QA 2KLBA 4IW3B 4IJ5A 1S4MA 2C94A 3SHWA 4TVOA 3ZD7A 1LDGA 1U8UA 2IUSA 3LW7A 2QLTA 1YIAA 5IAEA 3ANNA 1RP1A 2FTKE 2PFGA 4PSCA 1U98A 4GO1A 4O4LF 5FCDA 2RG1A 5HFJA 3OF2A 2QMHA 1BHSA 3PJFA 3BILA 4FEYA 1TW2A 4IIUA 1DG9A 2HL6A 5BOSB 3FWKA 4HWTA 4O2RA 1XTKA 5LN1A 1I1OA 1AS2A 1Z2CA 4LOKA 1T36A 5HILA 1IBLB 4KIGA 4R2WA 3RUDA 3IURA 2R8EA 3QY0A 3RVPA 1JHZA 4ACAA 2E18A 3BB1A 4WZZA 4BMYA 5IM4A 1FLVA 2H4HA 3OFNA 4OA8A 4IGAA 4M7PA 4QVKA 3D3KA 4XIIA 1IOZA 2IE8A 5DN6A 4BO1A 3B6ZA 4K9LA 4WK4B 1X80A 1SXGA 4HNVA 3EHDA 1W9HA 1Z18A 2LE0A 5CLIA 1E61A 4YEDA 2JZNA 3UXMA 4BO0A 3DNPA 4DE5A 1GTVA 5KYNA 2DR2A 5LMUB 1JSLA 3GGGA 1FDUA 1NV9A 3NDRA 3G2OA 5LZ7A 1FW6A 4LZAA 3T41A 2GARA 2P0EA 5IYZA 1Y7TA 1OH8A 1EM8A 1TUBA 3IUPA 4YYEA 2PVSA 1JQBA 5HF5A 4EL5A 5L3QA 5B1HA 3CRW1 1ICIA 4HO1X 4CLDA 3DT9A 2HA6A 2ZYTX 5F73A 2HR1A 5LYJB 4L0MA 4DAOA 1X42A 3LQ1A 1U2PA 2XT0A 4QYMA 1AKRA 2TMDA 3GDOA 4I1UA 3H19A 1CUCA 3P2KA 2JFPA 2V1XA 3CJQA 3K9HA 3B3GA 2MYNA 1W88B 2FRVA 3QNUA 2OD9A 2OHJA 3IP5A 4BO7A 2XSZA 3F5FA 3L40A 1ULUA 2R7AA 3BREA 3CUVA 4GE3A 4XCVA 1EDOA 3EFOA 2O19A 3V2IA 2IEIA 1N2ZA 3AERB 1GHTA 5KC8A 1IHPA 2O59A 3HM9A 4R3WA 1H2AS 3LDHA 2Q29A 2YXPX 3B6IA 4N0MA 2C9DA 2Z2XA 1PZHA 1ZS9A 3VO2A 5FA6A 4OUKX 4YXWD 2JIZA 2VXBA 4ZYXA 4H0CA 4XOUA 4AZSA 3CTMA 3IP9A 3EFOB 2XTZA 5B1IA 5K1ZA 4W9NC 3V4LA 1T9CA 3WY9A 1VHTA 3CUWA 1R10A 5A4IS 2W42A 2ZJBA 4F60A 4B74A 1RXIA 3OJEA 4YAGA 3HJNA 2ARKA 4TVBA 4XAQA 3HKBA 4AD8A 4BGDA 1HG1A 4DLLA 5GM1A 3KZCA 4CNQA 2NO5A 4G86A 5IBRA 3LD9A 2C4VA 2VNSA 4V0OA 5DMHA 2I91A 2DFLA 1B43A 1XDWA 3P9IA 2OV2A 1WOMA 3DGFC 4DLRA 2X9NA 4TYWA 2YRFA 1IWPB 1CUEA 4MV0A 3RIEA 3WI7A 4KFTA 1N9GA 3IKLA 5LBUA 2Y76A 1SVKA 4CMEA 3PXBA 4ESHA 3HVHA 4EHDA 4OQMA 4E7PA 4U6NA 2BN4A 2X8JA 1P1FA 3VU9A 2CT8A 3DH0A 5DEOA 2PA3A 1NVTA 1SZDA 4MUFA 4CKEB 3L6OO 3PF8A 1FRZA 2AOTB 4GLJA 4OQYA 5EEHA 3KLBA 4JYAB 2IODA 3HUDA 3NYQA 2PFKA 2FQXA 4PS1A 4Y2JA 3QI2A 2R66A 1QVZA 1XNJA 2WWRA 4MW9A 4F97A 4KXWA 1SKYB 2LKDA 3CCFA 1LDYA 1N2CA 1NKSA 3QXHA 3BHJA 3UW1A 3H3JA 3JYNA 4TTSA 5BWMA 1IBKB 3I2HA 2KB0A 4AJ2A 2VWGA 3H13A 4IXMA 4MW4A 5D8DA 1JE0A 2GZ1A 5L3SB 4CQNA 2Z4SA 1VKRA 3IPRA 2CCGA 2FRXA 3B9RA 2XKKA 3ZVRA 5JECA 2NV2B 4N1AA 4NXNB 5IHPA 1R8YA 1SUWA 1DV2A 1J9GA 1KTIA 1UMDB 1HQCA 2C9ZA 3G0CA 1L4MA 3QVTA 4G01B 2AZXA 5BSUA 3ER9A 1QO0A 2WJJA 4MDHA 3ZCSA 4G5RA 1A5SB 3F0TA 1KDYA 1RR6A 1B8VA 1NN1A 5ALZA 5F5XA 1KYIA 1MQSA 1IVNA 1QK5A 3K09A 1EUYA 1KO7A 4G85A 3H65A 4M86A 3FCXA 4PCVA 3RYFA 4JQOA 1A2OA 2Z5LA 2Y2UA 2X19A 4G56A 3V34A 2ZWAA 3RH0A 3VH1A 4LYHA 4XEHA 3EMBA 1IEWA 3V6MA 3VDRA 2W2OA 2GLTA 4JXXA 3CGWA 1NQOA 4PLTA 3GVPA 2PSSA 1DV1A 1N8KA 1QVWA 5FUXA 3U13A 1NOKA 1MD9A 1G5RA 2A67A 4YHHB 2ZUSA 3CN9A 3F5MA 4QQKA 3ANSA 1UBEA 1V48A 1O9GA 3DJFA 1IAVA 3W7BA 3CBQA 1GSIA 3IUYA 4L5CA 3S2ZA 2H4XA 3B6JA 1LF0A 2P1RA 3LA6A 4AULA 3IKJA 4FDVA 3UG7A 2R8RA 2FUG1 1JEDA 4OHVA 1XTSA 4DSAA 4Y7CA 3QXJA 4B6EA 1UK9A 1CEYA 3NHLA 2EV9A 4PNZA 2ODNA 3QJYA 5FIUA 3TNDA 3DTNA 4PGAA 4D79A 1IE3A 1CRZA 1HV8A 4AY2A 1KKMA 3WC4A 5CDTA 4N49A 4W7IA 3JARB 1E2PA 1MRZA 2HQ1A 3FKSD 3IC5A 3MN1A 4D2IA 5L3VA 1WMFA 1SBZA 3A1SA 3GI1A 5SZIA 5A62A 1KVSA 4FEGA 2IZ6A 2ZBRA 3OOEA 3UCXA 3UJCA 1L4NA 1AK9A 1DEHA 1YA8A 2A5JA 1T1SA 4A0FA 1XV5A 521PA 2JCXA 4QZVA 2R4TA 1YGYA 1ISMA 2CHEA 2KYRA 2RFLA 3SSOA 3VYWA 2AFRA 3C3PA 4PRLA 4QUEA 5G2OA 3DOCA 1VJRA 1XNRB 2QU8A 3CW8X 2QORA 3IQIX 4K81B 3UOWA 1MEEA 4RO0A 8OHMA 4L9SA 4O0LA 1Q7BA 1ENZA 1K68A 1W0CA 2ZIXB 4R9RA 4V38A 4DF3A 5JD3A 4EJ2A 1N36B 3DL2A 4M1SA 1KWGA 2PQ2A 1QHNA 3L7YA 1EUDB 1FIUA 2IY8A 1JMYA 4PO9A 3T7IA 2EKLA 3JZMA 3UAGA 2VYVD 3AYZB 5D51S 5A0FA 3K0HA 1FYDA 1K97A 4FZ5A 2OXCA 5JSZA 5C18A 3CX4A 3V1NA 2WQ6A 3CZPA 5FT9A 4EUEA 3WP0A 1J07A 5C81A 4OB6A 3K2IA 4AL4A 1WDKA 1Z16A 3CUKA 3HJTA 4YT2A 1H22A 4EQZA 1Y37A 4CKCA 1ESEA 1V16A 4K9QA 2X0KA 3SMQA 3ORFA 1Y1PA 3TNLA 3TTWA 1TO6A 2RHRA 1EK6A 2F8TA 4ERNA 1EKXA 5K51A 1XROA 3ICQB 5JSZB 5HZMA 2QBYB 1KOFA 3I30X 1PKEA 4QM6A 1WHSA 2PX6A 2UUOA 1E6WA 5DTJA 2A78A 4M22A 2Q4OA 1DTEA 4HLUA 1GYRA 3K0BA 5CFRA 1E2QA 1RWBA 3CY6A 4NBTA 4I1OA 4DV0B 1ZO8A 1XCJA 3RLFA 2HPHA 3D59A 1AZTA 5CT8A 4CUJA 3OU7A 4KPYA 1MNQA 2BMFA 1RYMA 3M9XA 1UFVA 4TOIA 4WZAB 5HM6A 5KB3A 1AJEA 2GJ9A 5FBRB 3TJRA 4G5FA 1KI2A 3UT5B 1YS6A 3UMJA 2Z58A 1DKPA 2FWAA 3RYHA 1XRNA 3QYJA 2ZKLA 3PGJA 5BUZA 2GKOA 3UYLA 4FFSA 4IMJB 5KTMA 1E3MA 5G41A 1TFUA 3OLVA 3M6IA 3P5SA 4FX2A 3ZN2A 4RFVA 3EZNA 5I7WA 1PT7A 5JCJA 4KMSA 5H16A 2N0SA 3Q5DA 2I99A 3ZHSA 4KQMA 1QQBA 5H4GA 1B8NA 5CTJA 4LTDA 1OLXA 4MSUA 1X1RA 4QWMA 2OBFA 1MAVA 5EWLA 5CAEA 4POAA 3WWEA 3V2HA 1YRQA 1F8GA 1H23A 5KKAA 4BZQA 1S2MA 4X6LA 3OZFA 4ZTUB 5HGXA 3KR0A 4MB0A 1A4XA 2VJMA 2C98A 2ADMA 1TK2A 3BMCA 3R09A 5C1DA 4DR2B 5D3MA 1Y48E 4NG4A 3K32A 4RORA 3GQBB 5M5BA 4H1HA 3L5KA 1HDOA 1UM8A 2YS6A 1BCRB 2MINA 2ONCA 2RBGA 5FWDA 5ERXA 3QUAA 1TX4B 3E61A 4UEOA 3WV4A 3FWHA 3V7FA 4MB6A 1HLGA 3PEEA 1T5OA 4FMCF 2VXCA 1B2LA 4NOJA 1N0VC 5BSMA 1RCUA 4B2IA 1DDOA 1HDZA 2EFHB 3KE9A 4BEJA 1LU9A 3AOEA 3VBEA 2C9OA 1EIZA 5L7TA 3BWXA 3ONDA 1SUPA 1XB2A 2QJRA 1DAKA 3P9ZA 5ETJA 3HL4A 5EL0A 2IEGA 1CNMA 2W48A 2WWYA 3GLQA 3M3HA 5JADA 2OCLA 5KSYA 3DFIA 4YRCA 1WWKA 1IB0A 1J21A 4TYNA 3NS7A 4K46A 1TCCA 3AHGA 3C1UA 4KLZA 1RQNA 4R5MA 2O8DB 1G2OA 2I2AA 2FH5B 2QXYA 2ZJ1A 2ZUBA 2B5VA 4QTZA 5TQVA 3CRMA 4LRWA 3TZLA 3GPDG 4O4LB 4TMKA 4ZQCB 3OTOB 3SQDA 1SK9A 1JHQA 1GL3A 4OP1A 3L8YA 2WZDA 3LCUA 2AC2A 1SCAA 2F00A 2QPTA 4N3CA 1UDRA 2HPZA 5AUNB 3BJEA 3S29A 3UGQA 1MT3A 1Y6QA 2WDPA 3GLHB 4JJFA 1ST2A 1R0CA 1PYGA 2H7YA 1JEOA 4YFVA 1OGJA 2ZZNA 4BAGA 2W43A 3NHPA 4PYOA 3VJLA 4BQOA 3PYXA 1CKEA 3FYUA 1W48A 2H57A 1ISFA 2RHWA 5AI6A 3D1LA 3OF5A 1X92A 3V3KA 4MRVA 4I2VA 1U2ZA 4BO6A 4Y0NA 4DIEA 1OF1A 4C1BA 1YE5A 2VWPA 4Z1MA 5ITSA 2C3OA 5TXGA 1XELA 4ZYLA 3EWSA 3B3QA 3THYB 4MYSA 4YPFA 4GX5A 4POOA 1IY2A 4KQGA 2A1UA 2JK1A 3ERCA 4IIYA 1MAWA 2XVZA 4A8JC 1TE2A 4A15A 2DETA 1XL1A 2H85A 3INNA 3D6TB 1QYXA 4B4VA 4NZOA 4YRTA 4EVRA 4PYRA 4BBZA 2XEXA 3PVCA 3ETCA 4ZQGA 4R68A 4M36A 1GQSA 4TKMA 1NZDA 1U0FA 4KXNA 1H2ZA 4RF3A 2XF8A 2L82A 5LUBA 4JI1B 1H9CA 2W93A 4OMFG 3PD7A 3QE4A 2FVYA 3UJBA 2VYVA 1TM3E 1F51E 1K08A 3EUEA 1NVGA 1E4VA 1YR3A 1T5HX 2G0NA 2I22A 1N0WA 3H5TA 4QPZA 2A9JA 3IJ5A 2ST1A 1RRMA 1G8AA 3IDZA 1KVRA 4NNPA 5BNFA 4KQJA 1RYBA 1Z0ZA 1JI0A 1YHYA 1O94D 2D5IA 3SHQA 1DIBA 4TSFA 3RG8A 1HSOA 3A4IA 3W4JA 2AKYA 1LF5A 1ETUA 4YV0A 1BDIA 1I8TA 5CDFA 1EJ6A 3KL4A 4LRSB 3PX7A 3N2KB 2DT8A 1TVEA 5LJIA 1IY8A 5IC5A 1F2UA 1PVDA 3Q0IA 2HA4A 4MVJD 4F93B 1PFKA 4B17A 2HPAA 3AEUA 3MWEB 2BKUA 4K26A 5AKKA 1X13A 4JUAA 3H5OA 5AOCA 2PD3A 1ZEJA 5IT9A 1CR6A 4Q16A 2EVWX 1OWPA 2YW9A 4OU4A 3MC1A 4D8UA 6REQA 4FZ3A 2CNWA 5CLQA 3TSYA 1LDNA 1P33A 5FFMA 3ABZA 5FWXB 1AQNA 1KQNA 3JD2A 1ZOIA 4CQLA 4E09A 3JR7A 1N2SA 4QC2A 1ZH6A 2ODAA 3QXCA 4LRYA 3EGVA 2XCOA 3NKLA 4I0WB 1WXWA 1G8FA 4UHCA 3R1IA 4FNOA 5TEWA 4AJHA 2OESA 4GS5A 5FAXA 1ZHHA 3T9FA 1EP1B 1D6MA 1Q0RA 2HDWA 4CEHB 1VMAA 4HKTA 5CVCA 1WSBA 4I3HA 3M82A 3ODPA 1DARA 1XVTA 4QBIA 3ZDBA 3E3MA 3ZW9A 3CVOA 4Y2UA 3T1NA 3FTDA 4JFAA 1GD1O 4YALA 1O6CA 5LB4A 1E7YA 1CE8A 2J4DA 2OBMA 2NYAA 2WJ3A 4RCZA 3DV0B 4TL8A 1L3CA 3HB1A 3DWIA 3RAFC 1T1JA 1YI8A 2G5TA 3RJTA 3VOBA 1IUNA 5IUNC 1ABEA 1NE2A 2NZYA 3AILA 3W8FA 4E4RA 4M0LA 1W85A 1BFDA 1I3OA 1EGMB 3K9BA 3BUSA 3I01A 3JQGB 3KKPA 1ZNYA 2IZ7A 4RVFA 1R6DA 4MGIR 2FMUA 5L8VA 2A0FA 1XZPA 4J90A 1RYDA 5ALYA 4PG8A 1FNSA 4CF3A 3AZOA 2WG2A 1KZ4A 3A8TA 4AC9A 2DUUA 1Z22A 2AVDA 1IRIA 2IBMA 1Y4ZA 3NUZA 2PT7A 1VJTA 1HE1C 3DEFA 5EE1A 4ALKA 5LA6F 3CE9A 2DFPA 5A4DA 3I1FA 1ZVKA 5C32A 3ROXA 3BB4A 5CP8A 1EVQA 3C5EA 1EZ1A 3PUZA 2D7JA 1FFSA 4WCFB 4ZARA 2ATXA 4ER3A 3WL8A 4BE9A 1Q84A 4KR6A 4S2EA 2B1QA 1UT8A 5JH7F 2Q6KA 1UMDA 1RHMA 3U4QA 4AJOA 3Q7TA 4NYJR 4QUIA 5DZSA 1M76A 1Y6GA 2XMGA 1Z2EA 3H86A 4I9UA 1MMFB 3T4XA 3HVRA 2B4QA 4TRMA 3R6LA 4ZT2A 2BHTA 1BDJA 4YAIA 3R7NA 3FCCA 3TR6A 4KWCA 2GK3A 2YWHA 2FN3A 1OYVA 3V8BA 1B14A 1KMCA 1OPRA 2EP8A 4LDZA 4MLCA 4PHFA 4RY9A 4RH3A 1U3FA 5C8VA 2FEKA 2IXFA 2PWZA 2HBYA 2LIVA 2PZBA 4C43A 2ECKA 1JT9A 5J3JA 4WN9B 4ZD6A 3F74A 1BW9B 4P7KA 1N34B 1M6WA 1V9LA 2OG2A 3OTWA 5A9RA 2CXRA 1KF0A 2EFCB 2J6CA 5F33A 1J1ZA 3R0VA 4E1VA 1VE7A 2CVZA 5IJXA 1JN0A 1OA0A 4QG3A 1ZD9A 1NXTA 3EVBA 4QQFA 5ADHA 3PGA1 4YP9A 3OPVA 3PGLA 3DQQA 5ICFA 5CA0B 1TF5A 3W8DA 2X15A 4B40A 2VIIA 3A25A 3HN7A 2FQWA 4CM4A 4YRDA 3F5SA 1TM1E 2AN5A 3LP8A 1Y1LA 2C92A 2XUJA 3DBOB 1JMVA 4Q4DA 4EZEA 3AMVA 5B4TA 1NX6A 4U2BA 3MCVA 2BKEA 5JCJD 4OXKA 2GK4A 3C3BA 4H1UA 2V6MA 4C3OB 2Q5CA 2I2BA 3HFGA 4ZEMA 2DPXA 3KQTA 2C1XA 1RFLA 2I3GA 3ENKA 1KJQA 1AXGA 4U8GA 2LBPA 3IEPA 1M6NA 4TXHA 1W25A 4MUAA 1OZFA 2OFFA 2HQOA 3GCXA 3VYTB 2GJAA 2Z30A 5EAIA 1QIKA 5I9LA 2JGLA 3C8UA 3ZXIA 4B45A 1H8HD 3IDQA 3Q8XB 4ZREA 1XZAA 4L4UA 4OXXA 2WD9A 2VDLB 4IG4A 3UAOA 3F6SA 2EBUA 3MCAA 3DHYA 3DL7A 4FIDA 2HHAA 5KYWA 1JH9A 2DYKA 4MV9A 2AG6A 1P29A 2QMUA 2ECPA 4JI4B 4WUVA 3OOYA 4H7FA 2GT1A 2WINI 3ZE9A 1RAGA 2N47A 1FJXA 3KRTA 5CT6A 1DBVO 1FE8A 5HHTA 2OENG 1R6AA 1FJHA 5D87A 1US8B 1I80A 1U5AA 4FOLA 4M1WA 1RI2A 1YQGA 2P5UA 4D3XA 5IJ0B 1A04A 4HLCA 4N41A 5B58T 3NBKA 1E1LA 1AXEA 3I04A 2J9FA 3U4CA 4DQLA 1XRLA 1JKJB 4G4SO 2I6SA 2IHKA 1UJ2A 3B9QA 4HNAA 4UPEA 2FZWA 3T54A 4YPOA 1RRKA 3N1UA 4Q1VA 4AJ4A 5LXTA 3GF4A 5G3ZA 4YJFA 1Q91A 2C54A 2WFLB 3HP7A 4BUZA 3CLSC 2XZLA 1JG2A 2NZVG 3NR2A 3RHZA 3NOOA 3DHNA 3HM2A 3PQ5A 3R3ZA 1FQKA 1SC4A 2VHYA 1EESA 1C1XA 2P1ZA 4XPIA 3OKCA 3L7LA 1KBZA 3EZ9A 4KI7A 1ZL2A 5JI3E 3L4KA 2UXDB 4Q3DA 1MVLA 4CCYB 1FL9A 3DG9A 3TVYA 2PQMA 4UQPA 3REGA 2O2CA 2FYTA 4HEHA 4FS8A 3G82C 1L5NA 5DIZA 5FB3A 1OH7A 3G89A 3ESYA 5FOTA 5JD4A 2BYTA 4JR0A 5C3UA 1II0A 4TWBA 1IWOA 4Z99A 4IPTA 5AHOA 1QUEA 4FIZA 3ZWAA 1TIKA 3G3EA 1YC2A 2CEKA 2GBCA 2PMDA 3H8WA 1N6IA 2X2FA 5G0WA 1K7XB 1JR4A 2Z5FA 1MEJA 3E58A 4R5HA 4AZ0B 4BFLA 4EFMA 1L8AA 3IT0A 5C51B 2ATCA 5EXSA 5FWYB 5CLLA 3MINA 5AKHA 5FWAA 2PXHA 3ZZMA 1UC9A 3IUEA 2GZAA 4BN5A 1VL0A 3E82A 1T4MA 3QWBA 4CE6A 4EMUA 2FN4A 1UBCA 4MS1B 1DPFA 3HN2A 5LBIA 4BZXA 4LF4B 4MUHA 3T1HB 1I3NA 1GU7A 3FR8A 5IKEA 2FLWA 1JE1A 4ZAXA 2XVYA 2C61A 2OSVA 3C5WP 3G7UA 3LE8A 1YMVA 2B20A 2BGIA 2JATA 4PV7A 4QTYA 3IL2A 1JH8A 1JJVA 5DGIA 3QHPA 2FPKA 4FFPA 4YT4A 3JQ8B 2A4KA 4PFSA 3ZXXA 4BO2A 1RQ7A 3RUCA 3RS0A 2JH3A 2CD9A 5FPPA 4U1RA 1OB2A 1T0PA 4Q37A 4LJ9A 2H7VA 3DAFA 3EQZA 3D5TA 4LY0A 4WJLA 2R44A 4BJHB 4F5EA 4OFZA 2NUTA 5IG2A 1THMA 4YASA 4REOA 5EN4A 3M3DA 1H05A 3N76A 4UULA 4QELA 3OP4A 1P8JA 1HORA 1ZJ6A 2DLNA 2J5KA 1GGJA 2F3TA 2AOTA 5CM2Z 2IWHA 4CKEA 3GNLA 2NVWA 3D8TA 5JMPA 5JCOA 1EAMA 1SPBS 4HT3B 4FZRA 1HEIA 1VRCA 2A57A 2JJ2D 1FY2A 1OWNA 2NU7A 4XX0B 2EJCA 3EGEA 1QRUA 3F7NA 2V9CA 1MH1A 3M6LA 3LDAA 5EXDA 4AMVA 4E13A 2NUAA 3LAWA 4UU8A 1T9HA 5DCWA 2CDNA 4YUYA 3TIVA 3SPXA 2EJVA 3K72B 1A8QA 1N57A 4GL4A 3ZV5A 1VKNA 4L5AA 1KDZA 3U9SA 3BIWA 3QYAA 4Y6GB 1ENOA 2DWOA 4YCNA 3OPYA 4WLUA 3MNFA 1JIKA 4LXXA 5TIIA 3S40A 4EA7A 1UXOA 1U7XA 3HB4X 1M73E 3L8CA 3I9V6 2W58A 5LLSA 4CIDA 3GZNB 1RWPA 4F8EA 1DBIA 1HDGO 2V03A 1R5BA 3LL4A 4IGKA 3RWMB 4EI7A 1C9KA 1VSTA 1Z8FA 1BNCA 4IF6A 4F71A 4Q1AA 1FNDA 1GTG1 3K0AB 3KYBA 1MGPA 1W4BA 4PO3X 2Y4NA 4LEIA 4Y9UA 4ZVVA 3H9GA 4YH1A 1T9BA 1Z8HA 5JALA 1KFCB 5FEMA 1W34A 4L78A 2RGWA 3PDUA 3PQCA 5DT2A 2A9PA 1C30A 1NWCA 3FFWA 4ZP1A 5IN5A 2PR2A 4EB8A 1XMPA 1O97D 3ZHOA 4NAHA 1AO0A 1CYDA 2FW1A 4NEHB 1UMBA 4EK9A 2J3JA 5IN4A 1LBEA 3SD7A 2OB1A 4WOBA 4ZCIA 3PDHA 4C7MA 3DYBA 2QV7A 3GRFA 3S5UA 1ND6A 3G23A 4PX3A 3G0BA 3TSOA 5CD9A 1GSAA 3ZHQA 1TM7E 3N87A 3R5KA 2O4UX 3C3XA 3GQVA 3P0RA 1Q0UA 1JNXX 1ZD3A 2VJLA 1DKRA 2R60A 3BXPA 3M5PA 3RTAA 1K5GA 3BXGA 1OI3A 4DY6A 3HXOA 1GCGA 1S6YA 3Q9NA 5KQLA 3LVRE 3E9MA 1PQUA 4ZIRA 1Z4KA 2BMVA 3A4VA 3OQBA 4GWGA 4IIEA 4HEA6 4QGFA 1OJ7A 3AJDA 1Y5RA 3NRJA 6PFKA 4TTTS 4ROSA 1W1WA 4K3VA 2AFIA 4D44A 3ZJTA 3PJEA 3WLTA 2XF2A 4D4JA 1MB3A 4BQFA 3KVNA 5AXBA 1P2SA 3FCSB 1PE0A 2JEYA 2XWPA 1A9XB 2YKGA 1BH6A 4YMSA 1MB4A 1C8BA 4RIGA 1PRYA 5CEEA 1G66A 1D3AA 3SXJA 1ISRA 2YHIB 2ESRA 4ND1A 4NRDA 3ULKA 2J0UA 2J7PD 5IKMA 3CZAA 3JQAB 3KUKA 4AZ3B 4GDMA 1GGEA 4BWGA 1W4CA 4IQ4A 1SHLA 2R8BA 1FRFS 3EQ2A 4JQSA 4D3FA 3VR3D 3NDBB 3FI0A 4XJXA 3WYCA 3UENA 4CMBA 5ENZA 5AI9A 3VPDA 2WQ7A 1TLLA 1C0PA 1I7PA 4BFXA 1T25A 5MN5A 2IY9A 1YBFA 1ZJ4A 2WF7A 1QIGA 3GLFB 1E1QA 1G6KA 4JP2A 3P9YA 2VK2A 4YREA 4JITA 5ESDA 1IXKA 4P2BA 2P9ZA 3GJZA 2GAAA 3MTAA 4H3VA 1W5AA 2NAPA 1Z56C 4ZV9A 2EWVA 2G5GX 3ZI7A 3WAJA 4RF2A 5BN1A 3BT7A 1QYIA 3SS8A 3K16A 2E5FA 2ZBVA 2ABWA 1R4MB 2GVZC 3R5FA 5E1MA 3RQSA 2EJTA 3TTYA 2VDNB 5KHLB 1W46A 2XCIA 4Q02A 1D4AA 3A4MA 1K86A 2CK3D 4TVSA 2JIQA 1K2WA 1W5EA 4MIEA 4ZT4A 5IJ9A 1UPXA 2C8LA 3SM9A 4NZMA 1TQHA 5E6SB 4AIIA 4BCBA 4CKXA 1E2JA 4B3TB 2WP8J 2FSPA 2B1IA 2ZI3A 2DQKA 3KUUA 1B6GA 2FPIA 3CNLA 3G2MA 3G2IA 1KAGA 2AB0A 2WKPA 3BZUA 3PC8C 3QU7A 3B70A 1E6LA 4EX6A 2GFHA 4J4BA 1PJ3A 3USZA 3L0YA 3EIEA 4G8BA 1FOEB 1G3IA 1SQ5A 2GBGA 3QI7A 1BWPA 4LXIA 4TS4A 4ASUA 1RCTE 3GJYA 1A98A 3VISA 4ZA2A 2IVZA 4NBVA 2WM9B 1NNI1 2C29D 2AMYA 4JBWA 4FD2A 1Y1SA 5TS3A 3H4MA 1I51A 1ATIA 4LWPA 5EJ9A 1ZD2P 5HS6A 4NOKA 4BQIA 4BEWA 1I14A 1P4HA 1E32A 1AMOA 1YF3A 4EB3A 4LF8B 4OI0A 3OZWA 3W6OA 3OTHA 5EIEA 2AXEA 1DJMA 2QTMA 2MTBA 4HZUB 4J0GA 5J59A 5BY2A 2BH2A 3TW0A 3FVRA 2H1HA 3BWBA 1TL7C 2GTPA 4LZPA 3BG5A 3VC1A 4WA8A 3VO9A 1Z7GA 2I4TA 4XWAA 4OREX 2HRRA 5KYTA 2VJMB 4S2UA 1G8GA 3AEKA 4WE3A 1V5EA 1XFDA 2A58A 2XE6A 2P27A 2FSSA 1RADA 1DL5A 2D5AA 2RONA 3MQ2A 1HLPA 1CS0B 4TN5A 4BIMA 1FS6A 1QRRA 2J46A 3B9PA 2NP7A 3NEPX 1XD9A 1I0IA 5DCYA 3A3YA 5DO9A 3AFOA 1VJGA 1P77A 5K45A 1NOJA 1SO8A 3H6HA 5DM0A 4KPFC 3FFTA 2FP4B 4KDFA 5T7BA 1QH1A 2J6BA 3H83A 4LTMA 3U4DA 1HUQA 1P73A 3IUBA 3LVFO 5ALRA 3A6LA 1SCJA 1VYTA 3TW6A 4MVJP 2ZIUB 3HJUA 2V6GA 2VEOA 3OBIA 3H5IA 1NJ8A 3SZRA 1WPGA 1FXUA 2DHRA 4FD3A 1S0UA 2WIDA 4XSVA 5KDLA 3R7FA 4DT1A 3VYUB 5K8VA 2V4ZA 3P4XA 3PHHA 1NP6A 5LP1A 2FWMX 3N58A 4GYYA 4ZQIA 1UUFA 1IK6A 2EBWA 4P3YA 2JAQA 4ZVLA 4F84A 2ZETA 1A9SA 1GRQA 3D3WA 1PF7E 3HBMA 2BFPA 1IM2A 2B2XA 1TEXA 2Q41A 3TOZA 4CHTA 4KXMA 1XZFA 1L4EA 1I5EA 2BJVA 3JYQA 3PNOA 5E8JA 5EFOA 3IAM1 2X1HA 5JQGB 3O4GA 1EA5A 1U63A 1G7CA 3D4IA 4IEIA 1VJ0A 3PQDA 1RU3A 5KNDD 3CNEA 3LF2A 1SBNE 3REOA 3GV0A 4Z4FA 1KFKB 4WGFA 3V2GA 3EQ8A 2A8YA 5KX5F 2OZVA 2QL5A 3HB5X 4JFRA 3A26A 2DFNA 5KNCD 1GLNA 5BMVA 4EA6A 1EFRD 1S5PA 5JAHA 5JNUA 1JDBB 4B3BA 5EIBD 1MBZA 3UB3A 4RJKA 1ZA1A 3EEFA 3VSBA 5KC9A 1KY2A 4BQRA 5K5EA 4NJMA 5EE3A 2LKCA 3OY7A 5DOZA 3IS3A 4EPVA 4B34A 1E7MA 4HS4A 1FUYB 3QRWA 4H9GA 4LJKA 5ALKA 2ZVJA 1YFLA 1G2PA 1UCFA 3DBLA 4A03A 4MV1A 2IK8A 3WHKA 4HAZA 4DCJA 3F3SA 2O8EA 3L8DA 2PXAA 4EHNA 4JBHA 2ZR9A 4QA9A 5ISMA 3NAQA 1V4NA 3INGA 4R3UC 4CF5A 3ETDA 3IILA 4HDSB 1C7EA 2GS9A 3FF1A 4QODA 2QJFA 1PSWA 3GEPA 2CJFA 1AGPA 2RGXA 1U28C 4H31A 3V33A 3UAYA 3T7TA 3VPSA 4C9BA 4V1CA 4J9UE 1JFLA 5KX5A 3AVQA 1ZSYA 3WLAA 2HJRA 1T0IA 4Q19A 1RRGA 4JXKA 1ENYA 3FW1A 4GIBA 2WJZB 5EQTA 5EWLB 1YU6A 5BSFA 4YV7A 1RYZA 2QRMA 2V5AA 3OAAD 1KQGA 3TW8B 3AEZA 5CDGA 1T13A 1YRHA 2K2WA 2Q1YA 5EXPA 4E5SA 3EWNA 2EXXA 2JFHA 1X80B 4QSMA 2R84A 5JLAA 3PXGA 5FI3A 4AMBA 5JCZA 3D2LA 3KDSE 1VL5A 1G7TA 1IN4A 2G4VA 1EVKA 4MKHA 3S1SA 3ZD6A 4HN9A 4R8KA 5B1DA 1N9GB 2M2IA 4FDMA 1Y6ZA 4JNKA 4U5QA 2HSZA 5IXJA 5FOSA 4EYGA 1WXDA 4FNGA 2GBFA 4ER7A 1TI7A 4Q3CA 2P4HX 4LF5B 2GYVA 3Q7RA 2JKYA 5D3KA 3TW8A 5LQCA 4O08A 4IDNA 4MQBA 2J1LA 4NU0A 4ZVTA 1P60A 1ZUIA 3OG9A 4XM1A 3W06A 2ZQZA 5ICCA 2CWDA 2QD4A 4RACA 2DG2A 2Z4RA 3ZWYA 1YJCA 3S2GA 2XUIA 3FNRA 1M1YB 4RQBA 4P3PA 3OCVA 5C2JB 1KYWA 2W2LD 3AT1A 3E05A 4NBNA 3AHDA 3Q3IA 2QLFA 5JI2E 3RS3A 5K0EA 1J22A 4O4IF 5DNVA 5LWHA 2DHDA 2HF9A 3LCJA 4BFWA 2BFOA 3F78A 1G64A 1ULBA 3D6AA 5DLDA 1JGTA 1U02A 3HVJA 1Z45A 4YTEA 4F3RA 2EKBA 3GO4A 1CVLA 3HLTA 4Q3AA 2OO3A 1GLGA 4BKRA 4BQNA 3VR1A 3TPCA 3FTQA 2OFXA 1BX0A 3B6MA 2DEUA 1DWPA 3E18A 3EIXA 5KHOC 1DC3A 1ZVJA 3ABRB 3PFBA 3RU9A 4DCSA 1EE9A 1YAHA 2DU8A 1P61B 1G59A 5A9SA 3CFYA 1AKUA 2G04A 2WJIA 1H6DA 2YWJA 4B81A 1XEAA 1W85B 1A8IA 3FMFA 2DOKA 2V9ZA 1DAFA 3CJTA 3CX3A 3EF0A 3IJEB 3R5HA 4I1SA 4BBAA 1TECE 2IHZA 4MI9A 4TRNA 3IRVA 1B23P 1KXJA 1OI4A 2A1UB 2WWHA 3FM9A 5J2UA 2QYTA 3O90A 3IAM6 4LRXA 3RAGA 2X7XA 4EVIA 1Z15A 4NDNE 4UASA 1J42A 3T34A 2GTHA 3IA2A 2RHCA 2W2KA 3X1WA 1VLZA 1FMTA 2DC1A 4HVCA 1SHTX 3D6MA 4D4HA 2XMRA 2ZBDA 1XUOA 2IA5A 1GNRA 4RXUA 2H65A 3PNBA 4JROA 2X2EA 1GQFA 4JBYA 2PNFA 3U7QA 3ESRA 2HUPA 4ZHQF 2BLLA 5JY6A 4OHXA 5JSUA 1JFRA 2JA1A 2KI5A 4CTKA 5K0JA 4PLFA 2AD5A 4WXEA 2WMDA 4WINA 5B6PA 2SKDA 2DLDA 1AKYA 1ZLYA 1VIMA 4UNQA 4UVEA 5LQUA 3RTDA 1IAQA 4CLXA 1CQJA 1R4NB 1GPNA 2PRKA 1ZL0A 4TMTA 1BHO1 1XXLA 2CMFA 3WLPA 2CL5A 3EW9A 3UK7A 3WYFA 4DWJA 4YMTA 3WGIA 4UAGA 2TMYA 1E7QA 1U80A 5J1SB 2CMGA 4D3ZA 4HGNA 3OE7A 1GPH1 3RSLA 4ZMRA 2O8CB 2RHHA 2O5RA 4HWGA 5LP6C 2GO7A 3DVAB 3RNOA 1FDOA 2P6UA 5B2EA 3O31A 4ZEVA 2DJ5A 2XPCA 3VR5A 1N6NA 2I7TA 5BNTA 2F1HA 2G77B 5K4GA 1I1HA 2Q07A 1JILA 3KZOA 5ALQA 1U1DA 3F3YA 1M6EX 3TQOA 4B3HA 2JJQA 1HYQA 2W9XA 3GGDA 3AK4A 2JLZA 4JJAA 3EG9B 1FSFA 5DBHX 3R7WA 2GN1A 1L5HA 2C9CA 2G36A 3FDXA 2OOKA 3MCZA 4M54A 2JI6A 1N2OA 2PGDA 5CUQA 3ZWPA 4DLKA 5J23A 5DHQA 1NHGA 3AF0A 4MVCA 4HGZA 4O2AA 1GUDA 2NT4A 5LZ9A 4BX2A 1IN7A 2IPAB 3LMKA 5ALXA 1BOOA 1RQGA 4ROTA 3T3HA 2R1TB 2ZWIA 3L41A 2QRKA 3AUSA 2FK7A 1UKBA 2K7ZA 1G38A 2AG0A 3MT9A 4IZOA 4O4HF 3BQ9A 5B55A 1R2QA 4NZZA 1QBKC 5ER9A 2JNWA 2TMKA 1T8TA 1REQA 1RMQA 3QLUA 2P1DA 3Q4GA 2DFTA 2WYUA 2AGVA 3N5KA 2R0QC 1K75A 2V3CC 4L8FA 4DR7B 2PE5A 2FX2A 2C31A 3DBVO 1Y3DE 4K8RB 4Y2RA 1J20A 1Q1NA 4LV8B 3LLVA 2V6IA 2LP4Y 2VK1A 4OSOA 5CCDA 3SZ3A 3EZGA 1NW7A 5LXTF 3OQJA 4DA9A 4Z9YA 3CVWA 2GNOA 4HX5A 2ZR7A 3IO3A 4EAAA 4IX9A 1XVIA 4GVLA 1E9RA 4ZV4A 1XMVA 5BR7A 1WDTA 3DDSA 4RY2A 4EW6A 3IV6A 4O2AF 4OHYA 4U7DA 2XNSA 1Y33E 2P5SA 1X7YB 1SWWA 1E89A 1E0JA 2OPHA 3T5AA 3GXOA 5I8ZA 1XYYA 2JLXA 1G6OA 3F6EX 3A4LA 4E70A 1JAZA 2EKDA 4EUFA 1V7ZA 3WNDA 3MK31 5M3BA 4MHTA 2D5BA 1NFRA 4G1VA 4XYEA 5BN4A 1D2MA 1UBUS 1BQEA 2F3QA 2J3MA 2P77A 3NHBA 4DG8A 2EARA 3JCZA 3MMXA 3RVMA 1P1BA 1FCJA 1YQUA 2P2ZA 3UKDA 2EWMA 2R11A 2FW6A 3O47A 4XUEA 3AM4A 1DCKA 2AN4A 4DTIA 5KO2A 2WWTA 4S1PA 1ZUD1 3B20A 2PJUA 4NBKA 1IFXA 1VTKA 1WCIB 3V5NA 3CIOA 4M6WA 5JAZA 1FLDA 3PUHA 4C4XA 3LQYA 1MFZA 4Y9SA 5F4ZA 3BKWA 4HGRA 4MARA 1L6IA 2PMWB 1VE9A 1XRQA 1ZWLA 2HB6A 2XNDA 3KYIB 4I9FA 4UUNA 1Z2PX 1Q6YA 3RC7A 4D0GA 4GMDA 4IGEA 5C53B 3HJCA 1MZPA 3NUGA 5JWOA 4MWSA 1VFNA 3AOGA 4D57A 3SJBA 2YINC 3ZNPA 4B83A 2I87A 4WN9A 1F14A 2DSTA 1KI7A 2PGJA 2WICA 5DM2A 5DN6D 3TG2A 1B42A 1SZJG 3STYA 4GOKA 3I2KA 3KVVA 5H02A 1AN0A 2CN1A 5LP6F 1P72A 1P91A 5CHYA 1ULSA 1V6AA 2VAXA 3TUZC 3DUFA 1WZUA 4CTNA 1C3OB 4AWBA 1H4QA 2QL7A 1QFYA 2CXNA 1LPMA 1Z07A 3QVLA 1XCOA 2JLYA 1HFWA 3Q85A 3ZIDA 2BEVB 1TYBE 2CXSA 2FN9A 2HBZA 1VI2A 2BGKA 2HCBA 4PLWA 4PZPA 2MR6A 2Q4EA 5DI3A 4PGMA 2PMCA 5KU1A 2D1RA 4EY8A 2ZSDA 5TF0A 3NALA 3K70B 2ZWMA 2VF8A 4BB9A 2HQBA 3AESB 2GMWA 3N6XA 3O1HB 1YUMA 4NYMQ 1BS2A 3EN0A 2PTGA 5C8XA 4ZGBA 3R4CA 5K3FB 2V0GA 2K4MA 2PT9A 2XUFA 3WWYA 2IZZA 4J0DA 4A2WA 2I8LA 3UA3A 4M46A 5T4HA 1M10A 2R8YA 2J9GA 3UY4A 1GTSA 3DMFA 4PBTA 1WCWA 2VPXA 3O6VA 2B4TO 5JC8A 1JPVA 2I4MA 1IHDA 3V4FA 1XTZA 3FTNA 2NUPA 4NE9A 4ZOLB 4X91A 1F3OA 4B09A 4YRIA 5H7XA 5THKA 1CLUA 1QGDA 3RT9A 4OOEA 5AKGA 1NDQA 4QOIA 4QOJA 2COKA 4PCUA 4KR9A 3OE7D 3QU4A 5ALTA 3ZQJA 4J16A 3CLUC 3V4PB 1PZMA 2XB8A 1DVRA 3AFGA 2OO5A 1T0BA 4ZOLA 1OT3A 2WKSA 5COBA 4BNIA 1O5IA 4C4PA 2XA9A 8GPBA 2VBFA 3VR4A 2A0XA 1G1MA 1V1MB 5BSTA 2VRWA 2CC2A 1Y8ZA 4D4LA 1K4MA 3I3SR 3C15C 3HZRA 4M1EA 4MPDA 5HF8A 4XIFA 2DKFA 1QTNA 5AH0A 2ZRCA 3FNQA 4G1MB 3HUTA 4WERA 3O3CA 5L4SA 4M1OA 3BSFA 2PH1A 2LCFA 5HQJA 1FXWA 2G82A 4DJ5X 1UJ6A 1ZFNA 3CF4G 1TT5B 2IOFK 3AY6A 2ON6A 4KOAA 5I5GA 3B2EA 2I7VA 4OGGA 3CC8A 3HUFA 4M76B 4G36A 4NQZA 3FNHA 1GRNA 1UK6A 2WT8A 2BFCA 3BSYA 5FTLA 5BYKA 4LY6A 4X1YA 5EYPB 2JPDA 2GDJA 2NSLA 3X2FA 1T6BY 4DC9A 5HUJA 3IVGA 3KSAC 3C5CA 4W5TA 3K1ZA 3OWHA 2NQ8A 2R00C 3HEBA 2XECA 4IIGA 3H1BA 5IC4A 1QIIA 3OEHA 1L5QA 1L8QA 4P86A 3OJOA 1RZUA 2CF5A 1ZK4A 1CULC 4WBXC 3GAAA 1GNPA 2NO4A 4MJLA 5TSDA 2DHCA 4QBKA 5SYAA 2ZRQA 3RJ5A 4KO8A 2AKEA 4WACA 2YXNA 1NBWB 1YE3A 1CUFA 3TAUA 3CEAA 1GCUA 2HM7A 1XMJA 2V7QD 3EDOA 3BXOA 3PRJA 5AHXA 4IKOA 5E6UB 3W5HA 4BVHA 4YQFA 3TBKA 1RKXA 2Q5JA 4MPRA 2O5VA 1X19A 1A4RA 3ESAA 3QM1A 2R96A 4K40A 2VTBA 4RIIA 1XE3A 1VPTA 3PFKA 1T5BA 4DS3A 5BURA 1M1NB 2QE7A 3GMTA 3N39C 1XF9A 3UAWA 5KTTA 3EIHA 2C9YA 3OIWA 3OZ7A 4I50A 2I7XA 5DNYB 2QRZA 1QCCA 4KBYA 1A7AA 2P30A 4C04A 2OC9A 3EPKA 1DOZA 1T1IA 1ZMOA 1SR8A 2A3NA 2LR0A 2RAFA 5IUJC 3VKUA 3L8FA 3WBBA 3BVPA 3RE1A 3L6EA 4M87A 5JNSA 2OORA 3UA4A 4H08A 2XB6A 3K94A 2GR9A 2GASA 4LJYA 4TSFD 2JGDB 2WWXA 5DX0A 3T0IA 4IUDS 4BX8A 1QDEA 5LM3A 3OJCA 3I0MA 1GTZA 2UVDA 5DSZA 1H9BA 1CUXA 2HSJA 3ZWXA 1GT6A 3OPXA 2PUDA 4ZI7F 1GGNA 4XDYA 2HU2A 5A3JA 2GK6A 3MTEA 1J9ZA 5G02A 1QX4A 2ZUCA 3JAMA 1FYVA 1DCFA 2Y6UA 4CQLB 1JHAA 3R23A 3EUWA 1SQSA 2ECFA 4LWQA 1CRWG 2QAGA 3RRZA 2DWPA 3UV3A 3X43A 3UNXA 4B7UA 1MOSA 4GECA 2GJ8A 3RM3A 6REQB 1KR2A 1TT7A 1Z5VA 5LZ4A 4X6UA 3VYVA 3IOMA 4I50F 1ISGA 4BNDA 2XB9A 4CDMA 3WGMA 3S81A 3TZQA 4OP3A 3S70A 3SEZA 5ARBA 4X7MA 1RWVA 2VF7A 3I0NA 1H5UA 3K9QO 4WH0A 1T3HA 5FA5A 3P7MA 4C2BA 1VOTA 3H8VA 4L74A 1B41A 3R44A 3TL2A 1KYTA 1Z3CA 2A59A 3NWOA 1YB2A 1BKSB 4M89A 4TUYF 1TIPA 2UVPB 1PL6A 2O07A 4DA7A 3RUIA 3P2IA 3UKJA 2OWEA 1TJ5A 2ES4A 2LXNA 3CPHA 3G5UA 3WQRA 2RHDA 2EP7A 4UEQA 3BTSA 4PLYA 1P4AA 1H1LB 2VJOA 3EVCA 3KALA 3MWKA 4PZZA 4YP6A 1L5YA 1W52X 4C3UA 2WUVA 1N5RA 3NHKA 2UYOA 4KAJA 5FI5A 4HHEA 1DZ3A 1FK8A 4FMPA 1FTWA 2QMZA 1N6PA 1H6BA 3LX5A 4FZVA 1JDUA 2HBRA 3K92A 4KVAA 1M54A 4X0EA 3FAZA 3BFVA 3LGSA 4MWTA 4RTMA 1P8AA 3JXEA 1KYXA 1NLZA 3SYMA 3U56A 4B3SB 4U6SA 3E48A 4I4IA 5KNCA 2OBNA 4UQLA 1H1LA 3MGCA 4AG6A 5LIPA 1DFHA 1C4WA 5K3SA 1TU3A 2F59A 1L4GA 1G21E 2CFSA 3HPRA 2W70A 1HZZA 2Z98A 1D5CA 5BWCA 4BNLA 2CDCA 3KU4A 2DGDA 1MNAA 3GJRA 2JGMA 2C3PA 4A1OA 1NXVA 3MSXA 2QLBA 2MIIA 2Y71A 5HTKA 4LRUA 2HKIA 3KHSA 4KUGA 4UVIA 4US2R 3FHTA 5F98A 3LBNA 4R9VA 1RXUA 2XYHA 3ND6A 2PLNA 4OLHA 1AXRA 2EDCA 3OD1A 4QECA 1KFBB 2G1UA 2GESA 2OYRA 4Y6RA 2COUA 3S2YA 1YBVA 4G4JA 4FUQA 1R0BA 2EHJA 1P9WA 2XNCA 2KX7A 3CF2A 1E6MA 1Y5LA 4QU5A 4BRSA 3VNBA 2AKAB 4EI2A 5AQ1A 5AW7A 5FAKA 3Q15C 1UEJA 2LV8A 1KYYA 2NZJA 3ER8A 3HDQA 2B35A 5HJ7A 3E2PA 3HV2A 1PI3A 1L0BA 1M2JA 2GEKA 2HRCA 2GNPA 3D6FA 4I08A 5AMXA 4BUJA 3AG6A 3QFTA 3EFEA 4OI4A 1EDDA 3WNBA 1D1QA 5COAA 3T9EA 3KQWA 2WFMA 4ES6A 5BW4A 3R7BA 3IP7A 1H94A 4HTAA 3UMYA 5H3CA 2QJOA 2BTQA 4R3NA 1N3LA 2AMJA 3OFVA 4E5DA 1DX4A 3UUEA 1SQFA 1RZ3A 1SY7A 4LJ5A 1XCLA 4C07A 1EHCA 2XNKA 1L1QA 3PFNA 4BX9A 3G9ZA 3KT6A 1XNQB 1RJDA 2BFDA 2QRNA 1CUHA 1A2QA 3HNPA 2WHYA 3MELA 4Q15A 4CM4B 1LW7A 1R0WA 2IUYA 4Q1EA 1DQPA 4XD7D 4K9DA 4MQ4A 2I1LA 1EWVA 1Y8RA 1LNZA 3I4LA 5KYWB 2JF0A 3K5HA 4GZ6A 1JF8A 3B12A 5GINE 3A1NA 2I71A 4ADSG 2PL5A 1GN8A 1DFIA 1N4AA 4FINA 4NC9A 1ZCJA 1J33A 1VCHA 1FDVA 1O95C 3HVKA 2VHZA 1Z4JA 2Z83A 4HB3A 4ZRDA 3KQOA 1UKEA 2H0RA 3S55A 3A6JA 4JLPA 4UBNA 5AR1A 4L4ZA 1T3ZA 1X9HA 3VPCA 2F17A 3F46A 1I2DA 3E23A 4IMRA 4RAOA 2VQDA 4YAEA 4P5PA 3VA7A 2NU9B 2O48X 3GAZA 3ID6C 4IYRA 1YVPA 1M2WA 3NDJA 4Z0NA 4JQCA 1C3OA 1WW8A 4HTFA 4I9HA 4IRMA 5DMXA 1YVRA 4ASUD 3W3AA 1XD2B 4U3JB 4OLAA 3ZV7A 4B6GA 4RPKA 4GHWA 3TXAA 1I36A 2W6IA 5COQA 3VPGA 1K89A 1HE5A 4DV2B 1XQ1A 3TK1A 2IU0A 2XAUA 3D8RA 4ZEOA 3MILA 2C3YA 3GL9A 4PZLA 1ZCAA 2OYCA 4R7TA 3UK0A 4D74A 2HHHB 2XITA 5EINA 5ICMA 4FFNA 4EF5A 5IJ0A 2D0PB 2ONZA 2WMNB 5DNEA 2G4CA 1H6AA 4FLEA 4LGMA 3G1WA 5EPUA 3FNFA 3SG0A 2F7SA 4IHJA 1XZLA 2FI1A 2ZQ5A 3ZYCA 4D1YA 5JXIA 3DMYA 3FPEA 1JBQA 1P2BA 4QKQA 5CVDA 1IBSA 2FZ4A 5IEJA 1BVHA 1NPYA 2QZ9A 3WL4A 4JQYA 4ZFNA 2ZB8A 4PR0A 5ECYA 2IUUA 1X7DA 4TXMA 3DVRX 1RT9A 5BRJA 2UVQA 3RVQA 3RSHA 2VYND 3FHLA 2J9XB 5CXXA 3FNIA 5JJ5A 2I2FA 1E5TA 4TWRA 2V5UA 5CEFA 4N7JA 1P7YA 4EB6A 4IIJA 2NIPA 4N12A 1D0SA 5DK4A 4EHIA 2QG6A 1B8UA 3NYIA 3T52A 1W6UA 3IHLA 3GAFA 1SOVA 4FN4A 1KARA 4LG1A 4JLBA 5G0UA 3BRWA 5FPYA 3W2EA 1TRHA 2C8JA 1EWTA 4JH0A 4D4KA 2KBFA 2H3HA 4PSDA 1DC5A 1COWA 1Y1RA 2BKLA 4QXAA 2B94A 3V4VB 6GPBA 3SHTA 3W5IA 4KE7A 4CR8A 2FPXA 5F1YA 5CVUA 4F0JA 9ATCA 3VH4A 1Q7GA 3D7RA 4ECEA 1DRKA 3CINA 3F7TA 3QVWA 4CQJA 1MVOA 4DMFA 2JJYA 1QB8A 5ALLA 3B51X 1E77A 3JD3A 2AFIE 1JLRA 3N2NA 1IY9A 1R7RA 2VTKA 2CVFA 3GLRA 3UVEA 2AI1A 1YCHA 3VR6D 3L6RA 3V8MA 2BFMA 5JU6A 1QV9A 1YR1A 2D8MA 2J7KA 1JHRA 3UW3A 2F55A 1XO1A 3Q3HA 1N5LA 3P52A 4MDEA 2JBHA 2BRUC 2FPGA 1F7UA 2RHOA 4M0EA 3OEEA 1BRMA 3U1TA 4BAZA 2JLQA 3ZY6A 2WIJA 4XM2A 1F4VA 3RABA 2F2TA 4PWZA 2P9JA 2BZGA 1AKWA 4CTMA 2IPXA 5AI4A 4O0MA 2JARA 1R50A 3PPWA 1RHRA 2WJYA 4PAMA 4DBLC 4YMVA 1O4VA 5H0IA 5A3RA 3A37A 1WMSA 1GAQA 2DHQA 3P1JA 3D1JA 2WFZA 1SIUA 1O6BA 1M2HA 4L5BA 3SZMA 1AN9A 3OE1A 5DDIP 2I67A 1ADGA 4I55F 2G5PA 2XUDA 5HZGA 2XE8A 3R6WA 5YASA 4MVJI 1R3UA 1PJ2A 3HPQA 1Y5MA 3AL3A 1E1RD 4RV5A 3PZBA 1KKLA 1Z4NA 4XIYA 2G0AA 1AV7A 1X3SA 2ICAA 4EFKA 5TDHA 2IFTA 4KTVE 2H4ZA 3OE4A 1UZNA 1QYCA 4B9EA 1KMQA 1P3DA 4CRWB 1NYQA 3B85A 2XJ9A 2ZWVA 1BSVA 3QWFA 3WGGA 1M5RA 3DQPA 2XUZA 4FBLA 3BWYA 4BZZA 2WT9A 3DZCA 3HA2A 3COWA 4ARSA 5ES4B 2P2DA 2EBHX 3SIXA 2GLXA 4GZ5A 5AT1A 3ZDXB 4FFOA 3WMFA 5BXYA 4HGOA 3MTBA 1L7PA 2V0NA 5JSFA 1G17A 2MMCA 3OQ1A 4KH1A 1NURA 4L02A 3BJRA 4ARBA 3A9WA 1O54A 2F1KA 1T1EA 3OX1A 3OJXA 4GG1A 3PNYA 1T3LA 5JNTA 4PYQA 5M04A 2JHFA 2BMDA 4D9GA 1Z62A 3QVMA 4Z4HA 4A0HA 4M8SA 4YV1A 2HEIA 3BXFA 2H51A 3MW8A 5BWNA 4Q82A 3TS1A 2UV8A 2CYCA 4K86A 2W8BB 5JRZA 2F90A 3K0EA 4M9UA 5EPEA 5DM70 5DISB 3FKQA 3NT4A 1GTRA 1XEXB 3I6MA 3KVOA 4L4YA 4RANA 4KQKA 5A2GA 5KJ1A 3K73O 3U6KA 3S2EA 1VG0B 3IP6A 2HNKA 2ZW9A 2R6DA 3PNQA 3VYSB 5HQTA 5K0TA 1MB0A 5AK4A 4A26A 1ZN7A 3PFIA 2B6HA 5DHUA 4ZVPA 1J4AA 2P78A 4A4DA 4B5LA 3W4KA 1K7FB 3ENZA 4IX1A 5K4AA 1R9MA 2WM8A 4AYTA 4M0PA 1TAQA 3UMRA 2G9RA 5BUSA 5LD2B 1Z28A 3B53X 3SDSA 3SU8A 4C2TA 1QJCA 1TM2A 2LVBA 3TQRA 3IAFA 2Q5EA 1QOPB 1L5MA 2UAGA 3P2OA 1J5EB 3I37X 2PWPA 4F6CA 2PUVA 2OM2A 4BMPB 5JSQA 1U8AA 4G81A 2J67A 3TDMA 2FPUA 4NHOA 5I3ZA 1WXFA 3TNJA 2DECA 1J0AA 1QOQB 1UBHS 2UDPA 2Y1OA 4XUDA 4NSNA 5DPMA 2FK8A 1PJAA 2XUOA 2FZKA 4HJRA 1KE2A 2XCUA 2BM0A 5FJJA 1Z08A 4TSKA 3D4LA 3MWDA 2CL0X 4KU4A 1RBMA 2O50A 2BEJA 2EZTA 1JIXA 1UWCA 4MA0A 2JIPA 5EC8A 2YHIA 1HDIA 1QHFA 3OBBA 3NM4A 3NP9A 1N5DA 1CE8B 2XOXA 2R25B 4DQDA 3O3OB 4TT3A 3ZG6A 4FW8A 4ZCTA 3LU1A 1L5WA 1SBYA 1TTHA 2I6FA 2QLMA 2CXPA 2PV0A 2HV9A 2G5CA 3GT7A 3BERA 3V7UA 1LQUA 3SC6A 4MRSA 1QM5A 1NBOA 2B25A 2E4XA 3KQLA 2WE8A 3OCXA 5T6BA 4QM7A 3ZHUA 3LHIA 5EWJA 1Y63A 2VDVE 1ZNXA 4NIMA 1Z4LA 1FDIA 2R4UA 4H3SA 3NGXA 1QO9A 2E1PA 2G09A 2D2VA 2HCFA 2DTDA 5BWOA 1MOPA 9LDBA 1DJLA 3MFYA 1EK5A 5AW6A 3ZZNA 1XZDA 5HGJA 3ZZ0A 4OLFA 3QG1A 5LDDC 2E4YA 1HTWA 2RK3A 8ATCA 1E2NA 4QGHA 2ZJ8A 3WK7A 4WZ6A 3BF8A 3PDIA 1NUHA 4MTCA 3K30A 5GAJA 3U80A 5G4LA 4G5OA 4BMXA 4COOA 4N47A 3T99A 5I48A 4KN5A 3ZVMA 3BIJA 4LJLA 3PC7A 3PG5A 3ENWA 4DMLA 2G08A 2MU1A 3ICOA 3FZGA 4MQMA 1G21A 2ORED 1Z73A 1YRLA 3KD3A 4I3GA 5E6SA 5LC1A 4PC6A 4RZUA 3U4QB 3QA3E 2C04A 1W76A 1P44A 2JGEA 2VNAA 2VO1A 3KKEA 3RGWS 4BNVA 1C9DB 2GUWA 3I73A 3WTCA 1I2AA 2C7QA 3MPUA 1W2HA 1FX0B 1UANA 2EYUA 3G5MA 5KSOA 3HR7A 3DHWC 4ZO6A 4RWZA 2WUWE 2JIBA 4C6TB 1XLVA 4K0KB 2H29A 3LXUX 2YJGA 2VL7A 2FOIA 3H2ZA 5ARDA 1I6WA 2VJKA 5LIRA 2A9VA 1J56A 2AT1A 2QRJA 3KSUA 1W19A 3QEJA 4C5AA 4OI1A 4EYSA 4F2DA 2FFBA 5DXAA 5BO5A 1Y34E 2ERYA 1XRSB 1AHNA 1B0PA 1ML3A 3L6CA 3B13B 1MEOA 3K70C 4BJ1A 2FFHA 4MICA 3UJ8A 2O8VA 2H1IA 2IYFA 4PINA 1OPXA 2G28A 2RHMA 3FF4A 1LV8A 1O6FA 2P41A 3NW9A 3PE6A 4HF7A 4F9EA 4MCIA 4RFSA 4AY4A 2Q99A 2H1VA 1CWUA 1JJ7A 3MCWA 1F2TB 1MH9A 2FZLA 2PZEA 1JXMA 2Q4DA 4NYMR 1DI0A 2BEKA 4F5ZA 4V0KA 1VA5A 5EWMA 2C00A 1GXSB 3ITDA 1EP2B 2NXEA 1O5OA 1D4ZA 2AJ8A 1SVSA 3AI7A 3WO0A 3UK6A 1NW5A 1QVVA 2J9ZB 3T7EA 4P0TA 1AV6A 1ZG3A 1J0CA 4OVKA 3WNVA 2R68A 3BXZA 2HHJA 1E94E 1NX9A 5CW2A 1P7WA 1XLWA 2Q3BA 4HB2A 2CHUA 4OHRA 3RUPA 1ZAKA 3KDPA 3R3JA 4I14A 2AUMA 2NUBA 4U2GA 5ANRB 1KDTA 4P0QB 3UPDA 2C2WA 1GO2A 2FJ0A 4HPJB 4FC7A 5KNBH 1M1XB 5GM2A 2MR5A 3T12A 3PI6A 4S1WA 4XWYA 1QVAA 1GTJ1 1VIAA 3PSHA 3IDOA 1U8YA 3GUVA 3CVJA 2XUGA 4HAXA 2CXUA 4KLCA 1WETA 1LKZA 4EKEA 1OW3B 1Y8RB 2LCIA 3QBTA 1L8LA 1HRKA 2MT9A 4KFRA 5K3OA 4JP3A 1HK7A 3DMTC 1UOPA 1XXHB 4UU0A 1U9JA 5HF9A 3L02A 3GJTA 1XTVA 2A86A 1F5SA 4G0QA 2M6KA 1QHXA 1YQDA 3N2EA 4JBLA 3T3MB 5B30A 5TF4A 3UWSA 1NRXA 4FWIB 2GEJA 2PZGA 2PXCA 5CJ2A 5CK5A 2C5LA 1Z7WA 2NU9A 4XRGA 621PA 5KYUB 3H97A 1A77A 1VFPA 2AI3A 1FYFA 5TVGA 1KU6A 2VDWB 2R6ZA 4YPVA 4CIBA 5M34A 1M0TA 1VJCA 2AXPA 1DNPA 1XXHA 3N8GA 4YQZA 5E4JA 4HQ0A 2W98A 4BC1A 1PT6A 4IKPA 2A1TS 3ASZA 2J5XA 1G2QA 2H00A 3FYDA 4HL6A 1IDOA 1I9GA 4MUIA 1FRQA 5H70A 4WBNF 4WV3A 1SRQA 4KKXB 4Y8VA 3ZDQA 5KSZA 3QE0A 1PL8A 3LRTA 5U4QA 1DE0A 3HO8A 1U3DA 3RTGA 1L4YA 2B1RA 5AJVB 1KY5A 4KFSA 3C1OA 4MRPA 2Q0QA 4ENVA 1PWZA 1W4RA 3BL8A 3VKGA 1NR1A 3HC7A 2DPMA 5DJ5A 1EVIA 2WIAA 3RC1A 4LE2A 1YAJA 5INTA 4G65A 2HCTA 4AO8A 1QJ4A 4NU5A 1HX7A 4Q9KA 1FFEA 1RFGE 3IT2A 2W6JA 1SC3A 3JWIA 4XVHA 4X20A 4KNYA 3OHPA 2QX8A 4CKBA 2NSJA 1JQAA 2OB2A 3T15A 4BRWA 1G1AA 3ABOB 4LJ8A 4MMYB 2R6R1 1RI1A 2PRJA 3M34A 3CLSD 1WMAA 2WSMA 2BY4A 1KPHA 5EE0A 3OC6A 4BMCA 2J30A 4B5KA 2VH1A 2HSDA 2X6TA 3HVIA 4Z49A 5EJEA 4URXR 2O8FB 2VNHA 4TTPA 1T4CB 2YMPA 4BECA 2RGCA 2QSYA 1GA6A 1AGYA 1ZRHA 2IDZA 4Q47A 3DHEA 4YS6A 2P6MA 3WGNA 4E12A 4XGKA 5KPDA 1XVAA 3F5QA 1PR0A 4RVHA 3OIYA 3P5BA 4US0R 4LJ7A 3G9XA 1I6LA 2NZ2A 4RHYA 1DKOA 4OXIA 5JE8A 5KYYA 3IQFA 5DASA 1QYRA 1GKYA 3E9RA 4FSHA 4OXYA 1D2CA 2FHPA 3IO5A 3NT2A 5JDCC 3VFDA 4F12A 3DNFA 1XPOA 2HMVA 1PEAA 3KJZA 1PK9A 1FFAA 1OZ0A 3NCTA 3D3NA 4CFYA 3P9NA 3D0RA 4X62B 1RE1A 4HDQB 1ITZA 5DF1A 4I66A 3AEUB 1BWSA 2AR9A 1Q5PA 5ADVA 1HOTA 3BRSA 1OY1A 1YKGA 4KHZA 1MPXA 4MMXB 4HQOA 2FKAA 3A1TA 3KZ1E 1K7EB 5SY4A 1RIIA 2C59A 3LNTA 2ONJA 1KY4A 2JH9A 1FX1A 2KMLA 5AOVA 2DBVO 3R8CA 3FTPA 4YCMA 2XQJA 3ZJYA 3GRAA 3NYRA 5DULA 4L6CA 4I36A 3SC2B 3CRVA 1KAMA 5HW0A 1E1NA 1U0SY 4KVZA 1B1AA 1UBNA 5BQ3A 1UMCA 4QOFA 5D85A 4BBJA 5GOZA 1JG3A 2GWRA 3HG7A 1QQ5A 4JGBA 4IO0A 3GBVA 5IDQA 1Z5ZA 4H35A 5GJCA 4YRSA 3KKKA 3PNVA 4GOOD 3GUZA 3R24A 4G97A 1VXOA 1P0MA 1T9GS 3VM6A 4E5NA 1OFUA 4TQAA 1G20E 3EXHA 1P4RA 4NECA 2HHCA 2IKQA 3NQ41 4H15A 4OXRA 3WWZA 3U4AA 1HMPA 4B80A 3HY4A 4WXRA 4CLRB 4F9GA 4QTUB 5BYAA 1DXQA 3EGOA 4EATA 4AJ1A 5K0GA 3NMUF 1YKFA 1NXPA 1XGKA 2AWNA 3C48A 4V2UA 5LOVA 1LS6A 1CY7A 2P9HA 2PHZA 4NK4A 1W4LA 3WL5A 2GM3A 1L5FA 2ZXUA 2YH2A 3D7NA 1DU4A 1B76A 1JJAA 1T4GA 4FYYA 3EZYA 4NH0A 5JANA 1FA9A 2ZU6A 3VV3A 3V1KA 3BE8A 3DXYA 4DMUB 4DTCA 4F9TA 2YYSA 4QJ3A 2H5IA 1UEXC 2Y1LA 4JU9A 1MA3A 4RK4A 1LSUA 3OM1A 3ZU5A 3ZY5A 2E5LB 4DRYA 4OM8A 1R4ZA 1ZGCA 4CKWB 3TLAA 3AF5A 3OLQA 2CJWB 1HQYE 2PH5A 2QL9A 3NNNA 2CMKA 2VT2A 4ZRMA 4GKAA 5EZYA 1M2NA 5IULC 2QGNA 4EVQA 3VU3A 1AQUA 5FNZA 5B1EA 3OURA 3DVAA 4G8CA 2GM9A 1KZYC 3AIKA 2OMEA 4MQEB 4BNZA 1OXUA 3WGLA 3WWCA 3F73A 3KYDB 3QVXA 1CXZA 3WB0A 1B8PA 4P8RA 4E6PA 1CUUA 4TXNA 4W1PA 2ACKA 5EUCA 3VVBA 4AUNA 3SKXA 4JI6B 3HKEB 5CXQA 4N65A 1JKMA 3NGMA 4H0FA 4DGSA 2WTXA 1NVWQ 1A9PA 1T35A 1W581 1D2RA 1EFLA 1SG9A 3GRVA 2XR1A 4HDNB 4MKIA 3FMOB 4Y18A 3UMFA 3W5DA 1BMQA 5A5DA 1X77A 4RGBA 1BA3A 3UJAA 3CNOA 3GEHA 3FBWA 4L5YA 1X1TA 3BGSA 1SQ0A 4BQQA 2DMRA 1FUUA 2A5GA 3FJOA 4BRZA 3BPSA 3I9MA 1YDWA 3UWPA 3CHYA 4I2NA 1JLKA 4MHSA 4DQKA 1E3LA 3GZTB 3KWMA 3NBUA 1DS6A 3PXUA 2O52A 3TXXA 1NVXQ 4EARA 5AW4A 1NV8A 2BFWA 1YZGA 4II7A 1F38A 3LA8A 3A6HA 5BOVA 1E2IA 5C46F 1YZHA 4FE7A 2P2GA 4KNVA 5B7QA 5E8RA 4HJXA 1KIAA 1TTQB 1U2QA 5K8TA 3ESQA 2G4LA 4XM0A 3S27A 2X9QA 2JS7A 4PRYA 4G5GA 1P4SA 4H27A 1NF2A 4RZIA 3P0HA 4M0FA 4JLMA 4TMZA 5JC1A 1JWLA 1XPUA 4ZAVA 3QF7A 3VRHA 2B69A 2GXUA 3C85A 4JXJA 1TM4E 1JSRA 4HZIA 5IYZF 2Z6UA 4PHCA 5ECGC 3SEFA 4L8LA 3SWWA 3ROQA 4MYCA 4HN4B 2J31A 3AXSA 3K9CA 2H1RA 1E59A 3GX1A 4HFMA 4WEOA 3K1AB 2W5UA 3HNOA 1XIVA 2IQ5A 1JIJA 3RKSA 4YACA 4N9QA 3FX2A 4W1QA 3W6PA 1SRRA 3Q8WA 1S01A 4D0NA 1G3QA 1DBWA 1SXIA 2QX4A 1Y89A 3JPWA 4FMBB 3UIEA 2JB9A 4NMHA 3UJDA 1IXZA 3DCIA 1DTWB 4X45A 1ZN2A 2WR8A 4EEZA 2HK8A 4GM0A 3X1MA 1Q50A 4K05A 5JXGA 3IVAA 1CY8A 4ESVA 1EGAA 3FGNA 4DVJA 3FN4A 5JZVA 2ZT8A 4NH4A 4L7VA 1QP0A 3DOEA 4CYMA 2FJPA 3MCUA 1GKLA 4B7XA 2JCGA 4BJ6A 3LUCA 3PNSA 4R69A 1UXIA 3EODA 4LA4A 3V97A 3HA7A 3PNLA 4J94A 5DWDA 3A4YA 121PA 2OG1A 2YWGA 4PQGA 1AKQA 3E4DA 3O4IA 2ZATA 3L7IA 4I19A 1W0JA 2PZJA 5CX4A 4D5GA 4DSNA 5D6NA 3GB9A 4WY2A 5FWNA 1ZD4A 3R40A 2XDQA 3UMGA 3C3MA 4KFCA 1YDMA 3LFTA 1Y7PA 3KT0A 3K1TA 1SXJD 4XB2A 3Q3GE 5DT9A 2XCRB 4MOWA 3T3OA 2AV6A 4XLLA 2R7MA 1OFVA 3ILVA 2XX3A 5A6SB 2B7CA 2O8NA 3N0XA 4CXMA 2O7SA 1LXCA 1K3UB 1OXBB 2IOFA 4KACA 4LUCA 4XQCA 1OHHA 3SS9X 5CFLA 1SUIA 2GAOA 5M7EA 2XOKA 3ILHA 3IQGX 2I3AA 5JSYA 1DUVG 4U2CA 5FOXA 3QELA 2GAIA 1K66A 1AZWA 1YTUA 4S12A 1TDJA 1OIVA 1CZRA 3JQFC 3KJFA 2J59A 2OQRA 3DR3A 1CDDA 4GQAA 1ZVVA 2XNDD 2GA9A 1Y6RA 5JH7B 3SQXA 3FYHA 1BMTA 2RCYA 4R2LA 4WLOA 5CA0A 4TQGA 3MWJA 4FGUA 2Q0HA 1M8FA 1P0PA 2J6IA 4OJMX 2OP1A 2OQIA 5K3FA 5BMOA 3Q8MA 3GRUA 5GONF 3ZE2B 5GIOE 4DHEA 2JFZA 3V8EA 4WOCA 4FNMA 4UU1A 2AHRA 2B98A 4KWEA 5CJPA 4I7EA 4CZ2A 5C1OA 3J80A 2IXGA 3RHTA 4HLUC 1GU1A 3UWDA 1EYZA 3O38A 1GL6A 2UZ4A 3G9UA 4LJ6A 2YZNA 1JXAA 3IPLA 3FZQA 4DSTA 4AF7A 1DEAA 3D4OA 2IV2X 1X7WA 1RQ2A 4RMGA 4BKPA 3OKAA 3B2QA 5A0TA 2HDHA 4R8MA 2P35A 1CQZA 4MEBA 4ARZA 3ILSA 1I1QB 2WF8A 5LBTA 4ZDWA 1DIGA 5SV2A 3THYA 4C29A 1AURA 1CY1A 4BB6A 1KDOA 1NYLA 4OJKA 1WXXA 3M89A 2Y66A 4AS2A 4TS1A 5EGNA 2IUFA 3EF3A 3EDRA 3LBIA 1WUTA 3WLSA 2ZRLA 4HDOB 1F06A 3PGMA 3DLIA 3N2KA 4PONA 2X4LA 5HJ2A 3RDPA 1E3SA 5CA0F 5BUQA 4QTXA 3M5DA 2G76A 3EXFA 3IJPA 4MKFA 3RR2A 2Y8EA 4F6RA 1X1SA 5IXYA 5D1NA 1IRXA 1NW6A 3BXHA 5I4CA 2Y77A 1ZVQA 4UTOA 2ZB7A 2O3UA 4LHVA 1ZR4A 2BIFA 5D5HA 4D42A 4TXJA 1CY6A 1YVDA 2E4VA 3Q3JB 4L3OA 2Z2KA 4E51A 1A9QA 3OZEA 5DW0A 2EF1A 4Y0VA 4EHAA 3TZ6A 4YAOA 1O58A 2R6GA 4UVDA 1TU0A 4BVKA 4W5QA 4RF4A 1XYVA 3H5AA 3PHBE 5G1NA 3SS7X 1RVDA 1XAJA 4V0MA 1T4DA 3R0ZA 4PO8A 4DPLA 4D6XA 1NBAA 3N2GA 2RG7A 4KYUA 3OZRA 4P3OA 2LWIA 1TUIA 2IPLA 2YWEA 3PWSA 3AR7A 3S4YA 2PUTA 1CCWA 4DXDA 4NZPA 3GAMA 4YXWA 4RSMA 2BR4A 2H5EA 2X77A <