4NBLA

Tailoring small molecules for an allosteric site on procaspase-6
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
269
structure length
258
Chain Sequence
AFYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQAARGNQHDVPVIPDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-6
publication title Tailoring small molecules for an allosteric site on procaspase-6.
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 258
sequence length 269
chains with identical sequence B
ec nomenclature ec 3.4.22.59: Caspase-6.
pdb deposition date 2013-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4nblA00
2QL5A 3KJNA 4DCPA 1F9EA 1JXQA 4NOLA 3V4LA 5IBPA 5IAJA 4JR0A 4NOKA 3GJRA 3NKFA 4JB8A 2XZDA 4D3XA 1NMQA 3DEIA 1RWNA 4ZVRA 4AW9A 1CP3A 3DEKA 1RHKA 3GJTA 4AWBA 2CNNA 1RWWA 4NBLA 3E4CA 3R5KA 2Y0BA 4AWAA 3NS7A 3R7SA 1RE1A 1RWOA 3ITNA 3GJQA 4QU8A 1SC3A 2H51A 4QUJA 1K86A 3IBFA 1RWKA 2CDRA 2C1EA 2CNKA 2J30A 1RHRA 2NN3C 3PCXA 4N6OA 1IBCA 2QLBA 4EHDA 3R7BA 2CJXA 3EDRA 3H1PA 1ICEA 4EHAA 3OD5A 2C2OA 4ZVTA 2H4WA 3R6GA 4HQ0A 5LU9A 2CNLA 5K20A 3V55A 4EHKA 4QULA 3DEJA 4JJ7A 1I3OA 4DCOA 2CJYA 1KMCA 1RHUA 4N7JA 1QDUA 1RWVA 5LU8A 4ZVPA 2WDPA 3D6HA 5IBRA 3R7NA 3SIRA 4D3ZA 4EJFA 1RWXA 2QL7A 4N6NA 1SC4A 1GFWA 3D6MA 2XYGA 3RJMA 4QUEA 4JR1A 1SC1A 5IC4A 3V4OA 2H65A 3QNWA 4N5DA 5IARA 1NMEA 1QTNA 1SHJA 4FGUA 4EHLA 4FDLA 3KJQA 1QX3A 1BMQA 3H13A 4JQZA 4ZVOA 1M72A 3H11B 1NW9B 5IBCA 2C2MA 4QUAA 4I1PA 2C2KA 2H5IA 4NBNA 4ZVSA 1RHMA 1RHJA 4N6GA 2AR9A 4QTXA 5IC6A 4EHNA 2H48A 4PRZA 1I4OA 2H5JA 3V3KA 5I9BA 2HBQA 4EHHA 4QU0A 1GQFA 4PRYA 1CVRA 2QLFA 2H4YA 3H0EA 5IABA 2HBRA 2DKOA 3KJFA 4NOJA 4QTYA 1SHLA 4ZVQA 1RWPA 2J33A 3SIPA 2J32A 2HBZA 4JJ8A 4QUDA 1F1JA 4JR2A 4N7MA 5IASA 5IAEA 3D6FA 3P45A 3V6LA 1I4EB 2K7ZA 3R5JA 2XYPA 4QU9A 4PS0A 2Y1LA 2P2CA 4HQRA 3EDQA 4LSZA 2C2ZA 4M9RA 1RHQA 4QUBA 3H11A 3R6LA 4QUGA 4PS1A 1RWMA 1I51A 3NR2A 5H0IA 2CNOA 4HVAA 5LUBA 1NMSA 1PYOA 2QL9A 4QUIA 5I9TA 2XYHA 3DEHA 4NBKA 2H54A 4QU5A 5IAGA 4EHFA 3GJSA 3K7EA 5IAKA 3BIJA 4IYRA 4JQYA 4DCJA 4I1RA 1K88A 4FEAA 4FXOA 5IANA 3S70A 4ZVUA 3S8EA 2FUNB 3PD0A 4QUHA 2QLJA 1PAUA 2FQQA 4NOMA 3UOAB 3P4UA 3V6MA 2XZTA 4D3YA 4JJEA 5LUAA 4IEFB 3UO8B 5JFTA 2FP3A 3PD1A 3IBCA 2J31A 2HBYA
chains in the Genus database with same CATH superfamily
5JD4A 2QL5A 2JA1A 4YP1A 1DBSA 1MRZA 2QR3A 2Y3IA 3U26A 2FMFA 4ZQCB 1ZRSA 3S99A 4AWXA 4YLYA 3VNVA 1IBKB 3PQDA 1XVAA 2ZUCA 1ODFA 3CBQA 3LUAA 1JQDA 4KWCA 4DLNA 3QEBZ 2VOJA 3QQ5A 3IMKA 4WGGA 2P4HX 2JKYA 1A7AA 1T0PA 2CHFA 3GNQA 4CMGA 1N5JA 4F72A 2BBTA 1KO5A 3P9XA 4LX8A 2XADA 5LB2A 3RSGA 1OOEA 4BX9A 4RQUA 3IXQA 4B3BA 3BE5A 4PQEA 3TZBA 3PPXA 3OQVA 3ZNPA 5B3AA 2QEQA 2Y0DA 3U9LA 1DKMA 3IBFA 4BEVA 4RNDB 1IN1A 3C7CB 3P2JA 4JCCA 4Y0AA 5T6MA 2O0LA 3ZJUA 1EXWA 1ZOIA 4MI1A 3H1PA 4JLUA 1KE2A 5EKUA 3SD7A 4MW1A 4RMNA 1YF3A 4ZRDA 3VZDA 1KA9H 3DQPA 4ZDJA 3P96A 2FEMA 1DRUA 5JC1A 2EJTA 1UBHS 4U2DA 5AWFC 1U0SY 5AM2A 3PXCX 4AT1A 2ZE6A 3DAYA 4R9VA 4CG0A 1I0ZA 4JB2A 3FCOA 5KSYA 1Z07A 3NMUF 1KK1A 2ABWA 2FUG6 1SC4A 1GFWA 2VQ6A 1JXMA 2ZETA 2ZSJA 3EWNA 3FI9A 4X3CA 4Y2TA 4BNTA 4CKEA 4EOGA 4R01A 2YJTD 5ALSA 2CKMA 4LYGA 5KQRA 1M1XB 3P20A 5TMEA 1Q19A 4JKYA 1FJGB 4ED9A 2H17A 3VKFA 3VGPA 3OC0A 4TVBA 1TM2A 3IXMA 3JYHA 2XWSA 4RCZA 3K70D 3NLLA 1H2WA 1PG2A 1FFXB 4GPAA 4P5EA 1NKVA 1TZKA 2CMDA 7REQB 5KS2A 4G5FA 4HNHA 1RC0A 1KHHA 3Q7SA 5CB8A 3PE4A 1K0UA 5ALKA 4OHFA 3T1VA 4GYJA 2GEDA 4MKHA 1BH6A 2PMKA 2DFKB 2FFHA 1CF4A 2V54A 4KGVA 4BO6A 4CM1A 3DKRA 4QLBA 5ICFA 1P0FA 1TUBB 3PICA 2F6RA 2IBTA 2JLZA 5F9FA 1G66A 2IUUA 3SIWA 4K9QA 1I4EB 4GZ5A 1ATZA 3TLBA 2BJWA 2XYPA 1YRQA 2H2HA 1J8YF 1P5ZB 1QIIA 2X5JO 2XQIA 3C3KA 3VO8A 3U6KA 3B78A 5ALGA 2IX3A 2QKYA 4TTJA 2H57A 4PSVA 3GROA 2ZJ2A 4BHTA 4Q9HA 3AVTA 1O9GA 4YBZA 3UHPA 4RVUA 2O8CA 1W44A 4D8WA 1P0IA 2ES4A 3FOFC 3V9PA 1K7SN 1ZW1A 2AG8A 2JKZA 1XRNA 4GNKA 4WY8A 1E6LA 1FY2A 4KBFA 4BNHA 3E1GA 3JVEA 4EBFA 1H5NA 1IY0A 2C1XA 2I71A 2ZRAA 4I1RA 4OQQA 3FHJA 4OTZA 4UEWA 4G0YA 5ECGC 2IEYA 1L4HA 1KJWA 1XEXB 3K3PA 3QMWA 3OTIA 3WJ2A 1KQOA 3O2JA 3Q9LA 2CFOA 1BRTA 3THRA 5HX7A 1GRQA 3PHCA 4JLNA 1HQCA 1NVUQ 1A96A 5GY7A 4CODB 1A77A 4F7WA 1ZX1A 3V1TC 4DCPA 1OLXB 2CBXA 2HZ7A 1SBNE 2KJQA 2O1XA 4HBGA 2QTTA 2WFZA 5A04A 4F3RA 1YB4A 2JIRA 1RZVA 4JC5A 3P9NA 4LOHA 1UMCA 3MZ0A 4D3XA 3OP4A 2FG5A 1YZYA 2FQWA 1WWKA 1CCWA 5DHAA 3GGDA 1U9YA 4HB2A 5ADUS 3UCFA 4N3AA 5J23A 2EP5A 2ZS8A 4BQFA 4QT0A 1CZOA 1AB5A 3VI3B 4EG3A 5EE9A 2J67A 2P6PA 1EB8A 3PWZA 2IS2A 1ZICA 4B8ZA 4EHIA 1PZGA 3L7IA 1J0BA 2PK3A 3FHOA 4AD8A 3BRSA 4M9SA 1O3YA 4HH3C 4YVFA 2XMBA 1CZRA 2J7PA 5AKEA 5JCJD 5KTRA 1F5NA 1KY3A 2AR0A 3ESRA 2C0QA 2DUUA 2OAEA 3M6MD 3UZUA 3LPAA 4O3FA 3F73A 2IHJA 5A4JA 4BLUA 3CZ5A 4EKEA 1PR2A 2WJWA 1PJQA 5CLQA 5T57A 3C5EA 2LD4A 3ZDCA 1GRVA 4L16A 2OD7A 1N2CA 5LB4A 5E1MA 1DQRA 1P4HA 4CCYB 1KIAA 1THZA 1USVA 2X4GA 2GXQA 5DU2A 4XLZA 4EI8A 5KPDA 3V8MA 3RC3A 4BJ5A 1VBNA 3E7FA 3S1AA 1NW7A 2WA2A 3AFOA 4QOJA 5EXTA 5EJAA 4Y2XA 3U3KA 3ZHTA 2CJWB 4GEGA 3PWSA 4RVFA 3IBYA 1ACLA 2OK7A 3PDWA 1E9VA 3DMTA 1ZU4A 5IJWA 5DYWA 3I53A 4JIMA 4J16A 1UFKA 2ZTVA 5C8VA 3NCHA 3OUZA 2A59A 3D2BA 2V7XA 3KQQA 1TMYA 3H16A 1XJ0A 4MSUA 1BX3A 4Z86A 1T6NA 4RIGA 1ZJ5A 1RYHA 2VI5A 3ZDXB 4F4IA 4WOBA 5E3JA 3K2IA 4QQKA 1HSOA 2ONCA 2YRFA 3THYB 1A5ZA 4QASA 2QZ9A 3UV6A 1MFZA 2QE6A 5KU1A 3D7MA 1N6PA 4GM0A 3R3JA 4UXHA 4DLWA 4MRMB 4Q4LA 4TMKA 1AMOA 2YWRA 5IABA 3PDJA 3HB0A 1ZHOA 4M8LA 4EKIA 1GGMA 4KE9A 2BKAA 2VUUA 4PNZA 3QVVA 5CPBA 3T0FA 1C9KA 2O6LA 2V96A 3KHUA 1PK7A 2HV9A 2DY1A 3EZLA 4NS1A 2V4UA 4GUAA 2H9YA 4PVCA 1N9KA 4RTSA 1V16A 3WLHA 1V8DA 3TLMA 1JIUA 2M32A 3WMGA 4TT3A 4M9RA 3LK6A 1C8BA 3V1UA 4G0PA 1N2SA 4OA8A 5EVCA 1UDWA 3G9ZA 4LOAA 4Q1AA 4LF7B 2B8NA 3U0BA 4XIJA 3PC6A 5EJFA 5JPCA 4DLRA 2FEPA 1MQ9A 1SCQA 5GV8A 5IX8A 1ZLYA 2IOFK 1Z5WA 5CA1A 4XWWA 3EE6A 2CCKA 2PSEA 1FMTA 3TAXA 2H54A 4IOJA 1QRTA 1X14A 1XRQA 5JMTA 5DNYB 4A8PA 4LDAA 3RAEC 3BHMA 2PTHA 1VHJA 1GSHA 4EZIA 1KI6A 2DPLA 4C87A 3ASVA 3SEZA 3CV3A 1YBAA 2J3MA 3GJ8A 2O1SA 5HBGA 1XMPA 1GNLA 1YHYA 4EUFA 4ZHQF 1GTMA 4G1VA 3MTAA 1LU9A 2A5YB 1KI1A 1TJ4A 1ZGAA 2I4LA 4W1PA 5DE3A 3V8QA 3GMTA 1LWOA 1QORA 1O94D 3FIUA 5J4VA 2VZ0A 2R6FA 2RH8A 1A8SA 1JPJA 1W4RA 1N5RA 2EZ9A 3M1LA 4KFSA 5K4HA 1WTCA 5A2GA 4F84A 4CI0B 1SOMA 4C05A 1RYBA 3F4KA 4FTWA 1VCOA 3D02A 5EWLA 5LBIA 2W6CX 4DG5A 4PZCA 1KI9A 3SQWA 1H23A 1QIKA 1WQ4A 1IZ0A 5IW8A 4DADA 1SCNE 2EV9A 3K1AB 4DWVA 3ROZA 4LYHA 3CZRA 1R16A 3MJDA 4RSHA 1W30A 4X1YA 4ZT2A 4F12A 5B1YA 4F9FA 2PRIA 4M1MA 1ZEJA 2D59A 2Q3BA 2ZM5A 5JDCC 4BXOA 1OI4A 1OSNA 3CEMA 5DTMA 1RXEA 4Q48A 3RVBA 4MDHA 4YDRA 4L51A 5G53C 1JXOA 3DYIA 1N0WA 1PN3A 5KDOA 5JJCA 2PUWA 1U1GA 2VL7A 3PNVA 3BXPA 4MVYA 1TCAA 4W4TA 2WMDA 5FCDA 3AL2A 5CXQA 2OGSA 3N6XA 1G42A 2C5AA 1R4MB 4MYTA 4WXRA 1NAHA 2HJRA 1YMVA 1C5KA 1VTKA 3BQ9A 3HKBB 4EM6A 1CJCA 2NT3A 3F49S 1CETA 5JSQA 5JMOA 1IN5A 1JWAB 1CIVA 4Q1BA 5LZ7A 1JFLA 2V7PA 1WR8A 3QX3A 4GX1A 1BW9A 2I3ZA 4EPXA 1OB2A 4PX3A 4P22A 4GLJA 4GKAA 1KJ8A 1LVHA 2H06A 3CIFA 2CHUA 1KRWA 4BBZA 4B4KA 3QJ5A 5HMMA 5CDFE 3OPXA 2G72A 4XFKA 4C0AC 4BLOA 5DN6D 4W99A 1BMTA 3ZD8A 1RHJA 4D57A 3K9FC 3DM5A 5DYNA 1EZ1A 3FUCA 1CV2A 4OK3A 2Q1XA 5IFKA 3UVEA 4ZICA 3NNDA 3ZBQA 2WI8A 2HWYA 4RVGA 4E5MA 2J6IA 3DOEA 2GZ2A 4WNYA 1PQ4A 1F51E 3QPBA 3PQ2A 3HB5X 2IYQA 3GEEA 3AEXA 3EF3A 3AJ8A 2HUNA 4R1PA 3QW4B 2OP0A 2HSDA 4GPEA 5CA1F 3T3EA 4HRAA 1PJLA 4RD6A 3BJRA 4RK4A 1C30B 1TADA 1U4SA 2PFGA 3B3JA 4GNRA 5F3DA 3VSEA 3ZKAA 3W5SA 3U16A 2D6FA 3TW0A 1H5QA 3DMDA 2IV7A 1U65A 4B7CA 2ORED 4CN9A 2BDUA 3ZXSA 5LWQA 3AP1A 3D6VA 2QPAA 1KXZA 2JB9A 4OQ4A 4OQLA 3KLOA 3OO0A 2Z04A 3BVPA 3QKWA 3I52A 5IVPA 3IV6A 3ONVA 4AZWA 4WMLA 3REOA 4AO6A 4J9UE 4CMEA 3U13A 5CEJA 3PJDA 2VP4A 2NSJA 2GD0A 3C3PA 2JFXA 2Z6VA 1Y1TA 2NTJA 1P9WA 1QDEA 1XTUA 1WVMA 1NVWQ 1U11A 4M99A 4WCFB 5CIYA 1MC8A 2PA3A 1A7JA 1XDGA 4X94A 5CB6A 2VJMA 1KETA 4G23A 4GBGA 3IBTA 3LKVA 4GMXA 4HK4A 4YMVA 1UPUA 2H7XA 2H1SA 2VJCA 2F3SA 3PSHA 1N7HA 2UYGA 3PC7A 3RK1A 4AJEA 1UPAA 3ZW7A 1HE3A 2WSLA 3LWBA 2EHJA 2PDAA 3IR7A 2FP3A 3KTDA 1GZUA 1YAJA 4EB6A 3ROTA 4ROTA 1AMUA 3PNSA 8ATCA 3STUA 2JKVA 5FA6A 1M7BA 5L4NA 2EJWA 3ZVRA 3LH5A 4P4GA 3ZCVA 5CX1B 3CB2A 5DYYA 2JIMA 2ZIGA 4J3NA 1N5MA 4FONA 5EJ8A 3OX4A 4ONEA 5L3QA 1DBIA 4C07A 2WHQA 1B6RA 3D81A 2X0KA 1PJCA 2EAUA 2NWQA 4Z5XA 1BQEA 2EIXA 2Z2XA 4CG3A 3KAKA 3KKZA 2G6TA 3E4CA 4UM9D 4C0XA 5JH7A 2CFRA 3ABQB 3VR5H 3R7WA 2OMKA 3SHVA 1YS7A 4EPYA 1YQDA 5F51A 1KKLA 4ADSG 1AK1A 3I28A 3G0OA 1XLTC 4M0DA 4MA4A 4QO7A 3GQVA 1F6BA 4OEHA 4BKRA 5EMNA 2OZLA 1EM8B 2GHIA 1KH2A 1MGPA 3AKCA 3HDGA 1NRIA 4NMXB 1NBHA 4YJ3A 1C0LA 1KEEB 3ONEA 3SHOA 5JPDA 4XIYA 3GEHA 2XLCA 3LT4A 5KYXA 5FUWA 1GNTA 3BM5A 4JLVA 4FMPA 1IMJA 4MQLA 5K2MA 3ANTA 3WB2A 4BWGA 4BUJA 4CM8B 1LX7A 4X93A 3D8TA 1F9AA 1V2HE 3PE6A 4ZT4A 4R0MA 5AK4A 4TV8A 1QDUA 2X7HA 4KQ9A 3S1SA 1TQHA 4IJUA 1R0YA 3CSSA 1WQ3A 1WXIA 2GD6A 2HJSA 4AJNA 1FFBA 4NAVA 1U2DC 1Z6GA 3IUPA 3K6JA 1FFCA 2BFBB 2ZBEA 4OQDA 5CIWA 1M6EX 1UWKA 5DYTA 3RROA 4UEQA 3AEKB 4YWJA 3S5UA 3X1ZA 8AT1A 5A5GA 5E38A 2WJVA 3EC1A 4D8XA 1LPAB 4EPTA 1JSLA 2DX7A 4GAEA 5HGXA 4N1AA 1EX6A 2NVOA 2NO1A 3RWBA 3LC1O 2ZDQA 1QMGA 3AY7A 4ICIA 3WYAA 4C6TA 1J2TA 3B12A 5E0OA 1DAFA 4IIHA 2HA0A 4YECA 2FPLA 3OU7A 2PVSA 1SJ9A 2E55A 4R9UC 3I8OA 2X58A 4KNVA 2NO7A 1S3SA 4I1UA 4NBTA 2VHJA 4PLVA 3IQZA 1LI5A 5I01A 1U8EA 2IL1A 2L0XA 4N8DA 2JGRA 3I9FA 4NYIQ 4O4IF 4EFMA 2H4XA 4ARZB 1GD1O 3GLKA 2GMWA 2VNIA 4BVAA 4R16A 4Q3CA 2NV0A 1IZZA 3HJGA 4AJJA 5KSWB 1E62A 1OBFO 3ECAA 1M6YA 3L77A 3H4MA 3KLNA 4AJ2A 4ENUA 2WJAA 4NEGA 4Q05A 3O0DA 3DZBA 4RPLA 4LRUA 2X19A 4CV1A 1CDOA 3PVZA 2J9ZB 4QYSA 1MAUA 3KC2A 5AVSA 4LXTA 1T0IA 4LE0A 1GQYA 1T2NA 2CCJA 3NR2A 4KI0A 2ZUEA 1X74A 2Z2KA 4LYAA 4AKSA 4JLAA 4UFOA 5B53A 3K70C 1GGVA 1RI1A 2JDIA 4V1CB 2P9BA 3H8JA 3IQFA 4XX0B 1F60A 2IYAA 2VS1A 2OD2A 1HNNA 2JFGA 3K5WA 4PO3X 4B6QA 5CHYA 2PUBA 4JI2B 5BN4A 4CJXA 1W48A 1GUDA 1JLKA 1OYYA 4RY2A 3QF4B 2I4IA 2G17A 2ZB8A 3DBRB 3PUVA 4QDZA 4QRHA 4ZT5A 1GUYA 2JJMA 2RE8A 2PYIA 3DZCA 1FS4A 3H75A 3PLRA 5H5JA 1CR0A 4D9MA 4RXTA 1XD8A 1UM8A 1ZQ9A 3ZLTA 2XAAA 2ZEJA 5DGTA 4UVIA 4AROA 3IT1A 3WXMA 4S0XA 1WCYA 4Y2RA 5CW1A 5F33A 3SMQA 4CN8A 3HRHA 3HKEA 3CB4A 3MYRA 4JODA 3WGIA 1FX1A 3EMKA 4OXNA 6PFKA 1BGXT 5IK2D 3AUXA 2AFRA 2AZXA 2XOEA 3F78A 4OM8A 4XFJA 2FP4B 3IVXA 3AEYA 2FEWB 5E3IA 4GMDA 1JPNA 4M83A 4BFZA 4I14A 3MAAC 4G5YA 4ME6A 1GDHA 1WZEA 3CSDA 3TQOA 3U81A 4JXXA 3X1DA 3A04A 4ALIA 1S8AA 1YE3A 4IWXA 4ZU6X 3RTGA 4B1FA 4EI2A 2Q07A 4E2YA 1NURA 3FPAA 2YNMA 3DHYA 3IH5A 3NYRA 1D07A 2VP2A 2E1RA 1KQPA 3CWQA 3G5UA 4OQFA 3T38A 4O4IB 2OSVA 2VAVA 2C9BA 5ALRA 3IGFA 2XMDA 2P4SA 1LPBB 2Z8YA 4M89A 2O2GA 4ZO7A 3UEOA 2GCGA 4RU1A 1A76A 4ZOLA 2JC3A 3DLPX 4MARA 1YL5A 3Q9SA 1ULUA 3NBQA 2CVZA 1S3GA 5EMKA 1QZ3A 1YHNA 4Q37A 2IYTA 2H2GA 3SFTA 3DF9A 1U3GA 3ESDA 4I4LA 4YT5A 4BO7A 4HEJA 1GGNA 1FRVA 5J58A 2NOAA 3ES9A 2OV8A 1VG0B 3I04A 1K8ZB 2G83A 3H7AA 3H9BA 1RI2A 3KZKA 4H7JA 3DCNA 1OLSB 1VXRA 2WBLC 2VHCA 3EDCA 2VK2A 3KXDA 4EX6A 2FHPA 2VHQA 2ENUA 4JNCA 4QQRA 4RAQA 5BYJA 2ZIXB 4BJ3A 4EECA 5MDHA 1U2GC 1KIMA 2XGSA 1FFEA 2CZCA 4REMA 2A5DA 2ZBQA 3KPUA 3JQFC 4K9PA 4JI4B 5FUVA 3OZVA 5K8LA 3TQFA 3TG2A 1GZDA 4D82A 1SUDA 1WEKA 2I67A 3A32A 4XVRA 5DCUA 4GXRA 3E3LA 1MABA 4FHEA 3JZAA 3UWOA 2JVIA 3O7MA 4FYIA 4RW0A 2LGJA 4TQAA 4CM9D 1CXZA 2Z5VA 3H0EA 5CNJA 1NM5C 1FYVA 2WHXA 4K9MA 4NOJA 5BPHA 4IZIA 4RORA 3RS2A 1R5BA 3L82B 2H92A 4AZTA 3WGUA 1JLSA 1KI2A 1OYVA 4DMMA 1MB4A 1O5IA 1ECBA 2X9NA 3MJSA 5L53A 4N0MA 5JISA 1DMRA 2FVXA 2Z1DA 3G82C 4YAEA 1Q12A 1MJNA 1T6YA 2QLLA 2XGOA 4RVOA 1XP8A 4NFHA 4RZSA 4DL9A 1YZGA 2ZAYA 2YXBA 5MGNA 2IC5A 1GYPA 1F8XA 5H4GA 3DE5X 1UPTA 4JFAA 4LX0A 3OOHA 2UUPA 2GHRA 5CXSA 3JQRA 1RM0A 2AN3A 2E4WA 2GLTA 3AZOA 3E5HA 3LE8A 4OY3A 4PNHA 2LNDA 1NA5A 1CEXA 3U7RA 2E0IA 1Z0IA 2O7RA 3D7KA 1SVUA 2OWDA 3EG5A 3GFBA 2AW5A 3HL0A 3K7EA 4M21A 5EJ4A 1ESCA 1MOPA 4Y7CA 1USUA 2VDLB 2YVKA 4ZD6A 4A6EA 3AVXA 2QG9A 1CQPA 3LX5A 1A71A 1QGOA 2HQRA 2KLHA 2QT9A 4DDMA 2AN1A 4WFKA 2P8SA 4HDCA 2XUDA 4YCCA 3T5AA 1WIWA 2C77A 4IDQA 4YCBA 4Y98A 3LGAA 2G6BA 4X5OA 1JI3A 1CYDA 2PGAA 4YHBA 3EAGA 1AGXA 2X0FA 1JGTA 4UQLA 1XA3A 1Z62A 1R15A 1V9SA 6AT1A 3T41A 2VK8A 1ZY2A 1G6HA 2C7VA 1E77A 3FPBA 3TNDA 4DUZB 5HR5A 1DFIA 2JFYA 3ZU2A 3STTA 1PX2A 1G7RA 3EPRA 1SURA 5ANRB 5TF0A 4NZZA 4FEGA 2BF7A 2EKLA 1Z7GA 1LWNA 1N25A 1C80A 1UBMS 4GL4A 4BMPB 4US2R 1Q7GA 1G5HA 2NO5A 1TECE 2OG2A 4XARA 1Y9AA 3TIXB 1E1LA 1WMAA 1E9AA 4IH1A 4KC0A 4BQOA 3EVBA 4O4HA 4CDRA 4MWCA 4ZI2A 1WSAA 4AQ7A 1SPBS 4H2DA 3BUSA 1X8XA 2IVFA 5TQJA 3BCHA 4FOPA 2GJKA 3PCXA 1Q74A 5DX0A 1GGHA 1EE9A 1RABA 2BFEA 2J5RA 3BGSA 3EASA 4L15A 3EXFB 4TRNA 4POAA 4E1VA 4E5NA 3QWBA 1QP0A 1MHPA 1T8WA 121PA 3U49A 1C9JA 1TIBA 5UKDA 2WUEA 2QV7A 1P7ZA 2QX7A 3WA6A 2I80A 1O94C 3H18A 1OX6A 3RU7A 4LF6B 3AIMA 3KOXA 4RDIA 3K9WA 1X94A 2FZWA 2WIFA 3PHLA 3EPKA 4UUBA 2DPMA 2VTKA 1OX4A 4AS2A 2DWCA 1RRCA 4M49A 2SHKA 5SZIA 3I5UA 2WU3A 3HB9A 1X1AA 1YJBA 3X43A 1TMGE 2MYTA 3NYQA 4ZXFA 3HUEA 4AXBA 1ZL0A 1T1EA 1W47A 2DECA 3LCCA 4MVJE 3K0CA 1DELA 2VOEA 1SKMA 5LQNA 1MQSA 2P35A 4ZU3A 5ITZB 1LW7A 2AMYA 3IQDB 3KZCA 4LCJA 1CRWG 5T3UA 1IJFA 4Q6BA 3WX0A 1HA3A 1H3EA 1VKHA 4XSVA 3MTJA 2R9VA 3QITA 3ZY2A 2GZRA 4ER3A 3P9IA 4PBTA 3FRHA 5DVZA 4EB3A 5JEDA 1BHJA 1A9XA 2L82A 2X3YA 4EHNA 3GFRA 1EMDA 5DM2A 1K5GA 1X9IA 5L7WA 1BCRB 1Z0SA 1L5NA 4MV5A 3UT0A 4LRTB 2GKOA 1JB9A 2F67A 3G0GA 1U9IC 5HUQA 1SFRA 3FDXA 4TWAA 3AR9A 3LPCA 3R6TA 4CU2A 2DG2A 1M2VB 1I3LA 1WNFA 4KXLA 3WLQA 1H6CA 3NJ8A 3CZMA 2NU6A 2JGAA 4BEBA 2ATEA 3OA2A 3A6PC 1TU4A 5DTQA 2PUHA 2WJZB 3STWA 3UQZA 3GK3A 5B3JC 2YMPA 4UNQA 2XAUA 4QOFA 1WM1A 3EZFA 1XT6A 2XRMA 1Q92A 1FYWA 1YR7A 2AFIE 2E87A 2KHZA 4BO2A 4HFNA 4F4UA 1WL8A 1E96A 4KTVE 2BYTA 3BREA 3WL3A 1WRBA 2W71A 3FCEA 1PR4A 2I2BA 1V39A 1ZOSA 2KM1A 4Z99A 3T3GA 3A9TA 3OM0A 2W6QA 4S1PA 2X0NA 4C6SA 5KYUB 2GR9A 3IKTA 5KBYA 3EGEA 2HQBA 2WD8A 3A6ZA 3UFXB 2B7BA 2I2AA 3I72A 4ZWNA 3LPMA 1EE1A 1NR1A 2PGXA 4G8BA 4RPJA 4NYJR 1ZEMA 4Y6SA 2GDZA 4WPGA 3FNIA 4PYMA 4W8OA 1ZIDA 4JYPA 1GZ3A 3GMDA 4O5AA 3RSCA 2BFPA 2G0AA 5F7XA 1W0KA 4F92B 4N3CA 1MENA 1SCIA 1MEOA 2B25A 3D3JA 2I4OA 3EGXB 1DDOA 1JEDA 1SUIA 4P84A 1O96A 3DKPA 4QVGA 5B7NA 4NU8X 1A72A 1C8VB 4Y18A 1L5HB 2C2GA 2HLNA 3RYIB 4BMYA 4RWZA 1GPLA 4TZ6A 2BGRA 5AI9A 3LQFA 1U7PA 1EH5A 4QVIA 4RADA 3EODA 5AKJA 5CJ2A 1UDAA 2VZ8A 4GX0A 3PNOA 4YRRA 3OWOA 2CNWA 1KI7A 2RHBA 1XDUA 3EVTA 4GPTA 3FB1A 1X70A 3HGTA 4QDJA 4C08A 1MFPA 1N75A 3KQTA 1BQ4A 2ORYA 1T2CA 2HWWA 3QU2A 4J03A 4UJ3A 3TKLA 4B79A 3LQQA 3IAM6 2H7CA 3WLIA 4RTQA 3QEOA 2WHEA 4B3FX 3QPDA 4E11A 4BGVA 4D3DA 4CRWB 2GF2A 3ZU3A 1QK3A 1RAFA 1W4LA 2HQ1A 2D54A 2HEIA 4PCAA 3B13B 3SHFA 2K7FA 1NBMA 1SMKA 3C4VA 4EQ6B 2YKGA 2UXDB 2ADMA 2PXXA 4M0KA 1O87A 2YXPX 4YRAA 3EZNA 1YQTA 4PC6A 3Q3EA 1V5IA 2F4NA 1IUKA 421PA 4ZK2A 3WQSB 1E5XA 5EIAA 1S2OA 2FUG1 1C1DB 1ZGZA 2WG0A 3EXHC 4QOSA 2CEKA 2F2TA 3D8BA 3L43A 4U3JB 3W7VA 1ZM4A 3HRIA 1CYEA 3MRTA 2AC4A 5JQGF 1URPA 1IM8A 3EGWA 1TZ2A 1K8YB 2ONKA 2YYSA 1HYGA 2OHGA 3O3NB 3ZXUB 2XBLA 4EFKA 1U2QA 3UYLA 4EG8A 4MV9A 2PA0A 3PX3A 5FNVA 1X7HA 1TVKB 3CINA 4E09A 2BFDB 2VT7A 5CDSA 4FSXA 4PG5A 1GFZA 4J1TC 2QE7D 1WB4A 1HPLA 3RJ9A 3BQNB 2B3TA 4G25A 3DR5A 5LP6F 3NVDA 3ORSA 3QE2A 3I3SR 1PFYA 5FTKA 4OXIA 4PPQA 4COOA 1RD4A 3EW7A 2FRVA 4JT4A 5CDUA 2ZOSA 2AQHA 3PFGA 3BE6A 1JV2B 4CIWA 3AI1A 3SDZA 3SWWA 1R0CA 4UVDA 2KYRA 3IBSA 4OQPA 2A5JA 3ITDA 2XDWA 3NALA 1P62B 3A2NA 1WUTA 4ETIA 1QVZA 1S5PA 2GT1A 5KWSA 3K9LA 2P90A 1BEEA 4JR2A 3GYBA 4HWSA 4KWTA 3S0JA 4BFCA 3EH2A 1ZWKA 3ND9A 3D8HA 3TGPA 4B5LA 2GBPA 3ESYA 3VZBA 4YAIA 1GTL1 5EGSA 3VR5A 4C3VA 2FOIA 2I4NA 1YIAA 2QY9A 1WUJS 3OZRA 5A05A 4BMNA 1LC0A 3AV0B 2AFHB 1IQUA 3IP8A 1GRRA 1XZQA 4NBKA 3JWEA 1ECJA 2JJQA 4MNTA 5IDVA 2PUAA 3GJSA 1QWOA 1FTGA 4YJHB 1QJCA 2OB2A 3QUAA 1D9XA 4P3NA 4BNFA 4UD2A 4E22A 2AZMA 3NV7A 5TIIA 3HWX1 3CO5A 1TYCA 4E5YA 2WLTA 1PGPA 3HV2A 4I5EA 1ULBA 1AKVA 2OEPA 2DJ5A 3TQRA 3IMCA 9ATCA 3B38A 5BW8A 3SXJA 3REQA 3ZCTA 2FHSA 1VKRA 2VG8A 3IAS6 2OV2A 2R3SA 3FZEA 4AM8A 1TK3A 4CKWB 1C2YA 1VCMA 2XJ4A 2PH3A 1TTPB 4BNDB 2V3CC 2P4UA 1E1DA 1RPTA 1TCBA 3ELBA 3T4XA 5KHOC 1E2KA 1O0SA 3OPMA 2BP7A 3GL9A 5HBRA 1KWGA 4LN1A 1Z56C 2EERA 5JQGB 1Y6RA 1LGYA 4ARCA 2G8LA 3E3AA 1DQZA 4MR7B 4DGSA 3A4LA 4CQMA 2R8RA 1R0WA 2JI4A 2Q6LA 1GPKA 3EMVA 4M1ZA 2VSOA 1UXOA 3MWEB 4R7GA 5A9SB 1RYYA 5D6NA 5IUNC 1MJGM 3WIBA 2PUFA 3V9AA 4UVGA 2NW6A 3FPEA 4EKDA 5LP6B 1OWPA 2C2BA 1NSTA 2AG6A 4N0QA 3CONA 3LZDA 3NATA 4FEEA 4HLNA 4CWAA 1V1RA 5BSUA 2HMWA 2V3VA 4FYJA 3BXXA 1UBFA 1M73E 5HK8A 2W4IA 2Z4TA 1G9XA 3FYTA 2YC4C 5BN5B 2OVBA 4GI2A 2JCVA 1QCDA 2I6GA 1NG9A 3QHAA 1E3EA 1K7XB 5DPMA 3RFFA 3EC2A 1X86B 2EX1A 4D9JA 4WZBB 4DJAA 3CWCA 1BMFA 2C2YA 2PWPA 5CVCA 2QLNA 4YRQA 4W8HA 5BN1A 3D7LA 1HL3A 2JK1A 3MYYA 2XSZD 2ZVQX 1ZR2A 2OL4A 4QZVA 2O7NA 4R83A 2HNBA 4IQ8A 3OCXA 5BNZA 4CMAA 4D8TA 4JCOA 3MWJA 1H0RA 2W9XA 3VZQA 2Q1SA 4DWJA 2W48A 2E49A 2WSSA 4YX9A 4PCLA 5TV2A 1NNEA 4HADA 1VHDA 3L6RA 4OA5A 2VJQA 3GW8A 1T1GA 4RPCA 5IKOA 3ZLVA 2PD3A 4NI5A 4YLEA 4AULA 4CL3A 3KYCA 3PKJA 4HNTA 5FLXA 3AY6A 3L7YA 2ZRQA 3AL3A 3R7FA 1K2VN 3OY2A 4AL4A 3GP8A 5IVKA 5CH3A 3HK2A 4C04A 4UREA 3I9OA 4WDRA 1J00A 4F9TA 5LYJF 2HMAA 3IMEA 1H1LA 3QWIA 1X9HA 3RADC 2EKZA 4REQA 2IELA 3QE3A 2NAFA 4IV0A 2V1UA 1G9TA 2FR0A 3C85A 3M6UA 4HEHA 3RSSA 2WTBA 3P0RA 1JKJA 4P3PA 1E9DA 2HMUA 2QYOA 3NIBA 2FDRA 4HTFA 2AUNA 1HDRA 1PT6A 4J4BA 3A2KA 2AOUA 3I4CA 2F1OA 2PZAA 3AF5A 2FSFA 3BIXA 1TF5A 1HG1A 2UZAA 3ZE2B 4K8RB 3RYHB 4IQGA 5KC9A 3JQGB 1UDRA 5JNVA 2DETA 2ZWVA 4ND1A 2JGMA 5BSMA 3PZRA 2KLBA 4I4TA 5P21A 4RD1A 3O3OB 3O8LA 4U7DA 1QP4A 2H59A 2MU1A 3VH4A 5JNRA 2GB4A 2RB4A 4Q7KA 1RKBA 4M0MA 4U2BA 3EMBA 4UAUA 1KDYA 1CU1A 5BQ5A 4JX9A 2D5LA 5ED0A 2XD9A 4PC1A 3KQVA 1ZRHA 4KXVA 3C5HA 1JX6A 4X1IA 3ZCUA 3WWZA 2ATIA 1N9GA 2X0RA 3NM4A 2FPPB 4P98A 2CMKA 5HIMA 1NBOA 1WNTA 1RI3A 3EJ6A 2FWRA 1QNLA 3G2NA 3NWEA 4HNAA 1XCGB 4CGZA 1XPUA 4ZAYA 1N8TA 4F86A 4OGFA 1U80A 1WDWB 3LP6A 4O2BA 3A9SA 1YMUA 4NOLA 1KI8A 1LDMA 1V4BA 2R6DA 5CA1B 1VIMA 2GYUA 3FVTA 3NHFA 2W2QA 1KH1A 3RRJA 3M7IA 3M4YA 5ARDA 1QTQA 3SXUA 3BWYA 1WLSA 4MPTA 3WHKA 4XYEA 3KDSE 1YONA 1SKQA 4M4SA 3SHWA 5KYWA 3UMBA 1JQLB 3KIPA 3HN2A 3V7UA 4X6YA 5ADVA 4ZV7A 1I7LA 4UOZA 2GPJA 2CV2A 2V0GA 2RHTA 3AB3A 2AT1A 4EJSC 4N5HX 1EE2A 4M86A 2OBXA 2GM3A 3CM0A 5EFOA 2C1ZA 1TCCA 1KDPA 1U8FO 3DNFA 4N6OA 5HRAA 1DEHA 3QG1A 5FPYA 3HN7A 1ZH4A 1DKQA 1EFLA 3H1TA 4BRUA 4FBMA 4ZVTA 5LYJB 5SYAA 4AKTA 3HBLA 2H1FA 1JKXA 1U31A 2GA8A 1G2QA 3AY0A 2ZRLA 3KQYA 2NXNA 5AKYA 4ZGGA 4A15A 1SQ5A 1RRMA 4JASB 1KJ9A 1TF7A 1YO6A 2N75A 3AKDA 3O83A 3TDKA 5HJ7A 2W2KB 2XUQA 3GRFA 1SUEA 3RRFA 1U63A 1LNSA 1H2HA 4LRSB 4EUEA 1BDMA 1E98A 3ORYA 4DYDA 1M6WA 3GXBA 1FRQA 2BM8A 1K6XA 2EGHA 4CTOA 2BZSA 4FS3A 4NL4H 1FFAA 2VT3A 1BKSB 3L8YA 4TWJA 5IC4A 2UDPA 4G37A 2BMJA 2HK9A 3LYUA 5H3HA 5LMCA 4TVOA 4C03A 1JVNA 3K0EA 4X7PA 4F5YA 4PU0A 4M88A 1Y7PA 1BHSA 4H27A 4XD7D 1WZNA 3OZIA 2GXUA 9GPBA 2J3DA 2BP7B 3H83A 3KCNA 4G2TA 1VJ0A 2R85A 1NXVA 5EIHA 1XQVA 3OEHD 4YQEA 4C5AA 3L0CA 1UMDA 1VJCA 3F5DA 3GP3A 2IYPA 4ZV4A 2NP6A 5T4BA 1VE1A 3OG9A 2FNAA 1AG9A 4JI7B 1L5WA 1JILA 1T36A 1ZLXA 4YJFA 5I7VA 4OHUA 3DLCA 3EGCA 4IWYA 1E7MA 4MO9A 4O3MA 3AEUA 3EZ2A 3H17A 4L3VA 1Y4DE 4P2GA 4ZARA 4PAMA 4CMCA 4F3CA 3J81k 2E89A 2RAFA 2YIJA 4BO9A 3Q3IA 5IASA 5KTNA 1NYTA 1O0CA 2WTUA 2SKDA 1FTYA 3PGVA 1CR2A 3IEUA 3JS5A 4IKOA 1NU6A 3EPLA 4LOLA 1E3IA 2FN4A 4N7RA 2YVUA 5DKFA 1HY3A 1W46A 2PRZA 3BD7A 1EWYA 4PS1A 4C21A 1E5LA 2NSHA 3OQ6A 5G4KB 3DUWA 1CNFA 3JPWA 5T5QA 2FZCA 3WKEA 4ROSA 2QXTA 3L01A 2PUGA 5IMSA 1RYDA 4C3ZA 2P3QA 2Q6OA 1N5KA 1XZLA 3QVMA 1E79D 4GVPA 4I4IA 1JBEA 1Z47A 4J76A 5E1DA 3A2MA 3O8QB 3I61A 2M1ZA 5K3FB 1Z8NA 4BE7B 1CIPA 3BD6A 5JE8A 1XDWA 2C3PA 3BCSA 3UIEA 2L19A 1OHHA 5ERXA 3FGOA 3TB6A 2ACWA 5JCPA 1OKKA 3DVAB 1DAOA 2YMMA 3MTGA 4TVKA 2JLAA 4UVEA 4XVHA 4DEYA 4CNQA 3T1YB 4LAFA 1ILWA 4L5BA 4ZPXA 4ESHA 1WD7A 3SLGA 1E1RA 4A8TA 1QYVA 2OBNA 1P72A 4JT9A 4MGYR 1L5KA 3RCBA 3WP0A 1XK7A 4C7JA 5IDWA 1JDJA 5DBIA 3RUFA 4JP8A 2VWGA 2DCMA 4M3NA 2EZTA 1ODIA 1G1MA 2EZ4A 1DRVA 1B8PA 3GJTA 4UE2A 1IHPA 1H66A 2WOJA 4NBLA 5DGIA 1UBUS 3JQ6A 4BGEA 3IR6A 4C0HA 5CG1A 3FPJA 1KJYA 3CRW1 1ZGCA 3VYRB 3F4BA 2EU8A 3HCBA 4G0XA 1PJ2A 4EUSA 3MLBA 4U9HS 1YR8A 5CPFA 3ACBA 4GSLA 2XNJA 5FBWB 3SJCA 4QT4A 4PG7A 1UPBA 5AOVA 1JE0A 1K3TA 2HMSA 1Y7IA 3WB1A 1L5SA 2P2YA 2WQZA 1OR8A 4RABA 3R44A 3RTEA 4BZWA 2OLEA 2OZPA 2NAPA 1U8UA 2XCIA 4ZDKA 2CNDA 1IVNA 1I0LA 4JJ7A 4YIKA 2ZUFA 5KYGA 1L3CA 3L0PA 4OUKX 3D6UA 3ELYA 4QELA 3KOYA 3GJXC 3E4DA 5FBRB 2I76A 1XELA 1QM5A 3E27A 4O25A 3TUIC 1TO6A 3DULA 2I9KA 1MIHA 1XTBA 2DZDA 5KNCH 3HA2A 1RYEA 1Z5UA 4UUOA 1I2ZA 4OHYA 2ZRGA 3MK31 1Q0HA 2G71A 4ZANA 4IVQA 1QBKC 4AJHA 3DC2A 1Q0LA 3FRJA 2ZYDA 3GDWA 1CUCA 1VFNA 1RJFA 3GP5A 4MPPA 1UXGA 2NPIA 1UBGA 1JQJC 5GJBA 4ENQA 2ZIEA 3NC0C 3T35A 2D5IA 2FE1A 2FXIA 1ZK3A 3QMMA 4F3KA 3GMSA 2CUTA 1E3QA 1JLRA 3ZDEA 4AVYA 2VHXA 1P61B 2XODA 4ZJUA 5CFOA 4RTRA 1U8ZA 3DQQA 4OREX 2ZUSA 1JLMA 5JYDA 1TXGA 3AH8A 1TIPA 4Y2YA 1L4GA 4IHQA 2XCSB 1O6GA 3IVMA 5LQKA 5JDCA 2VPWA 4ER5A 5IDYA 5BR1A 2HXYA 3E53A 4M0FA 2B8JA 1PT8A 4RY0A 4RTLA 4DIUA 1LQUA 1ZJYA 2WYIA 2ZJ5A 2VDUE 4IPTA 1MP0A 3FAKA 4PLZA 3FYUC 2WYOA 5TQVA 4KITB 2C8LA 2ZAMA 4XM1A 2PT5A 3RUAA 4C2AA 1THTA 2EFGA 1DKRA 2JFUA 1FP4A 2X0IA 3DAPA 1NVVR 3IODA 3B85A 3KR9A 5C8YF 3CX6A 3M5CA 2DBQA 1L7RA 1M0SA 2GJ9A 2WT8A 4GW3A 4H7EA 4AJKA 3IPLA 2ZS7A 1OTXA 5B2EA 5AM3A 3F1KA 1YL7A 3ZE8A 1II8A 2VDVE 2XT6A 5C1PA 2ZI9A 3GHYA 4HB4A 4D42A 4I81A 2XCUA 3LPLA 5G0WA 5AVUA 2ZP1A 3WZLA 3ER9A 3V6MA 4MWEA 4DIFA 4EIWA 4L8GA 3EF1A 5D2CA 1YAHA 5D7BA 2W6JA 4POOA 1HNZB 4ACAA 1M5UA 3GLTA 3HI4A 2VPYA 3DOOA 1A5AB 5TR9A 4HY3A 1IC6A 4X64B 3OE5A 5BUQA 2FG6C 1XA0A 2MYNA 3LQRA 4MQFA 2PCJA 3EDMA 5KMGB 5HF5A 1VI2A 4NOKA 3EN0A 1PBNA 3EISA 3ZGZA 5TGZA 4BFYA 1ZJJA 5T8KC 2BL4A 2WUDA 4ZYZA 2YJGA 3TDNA 4WT7A 3U60B 1UC4B 3PIIA 1ZNZA 3V8NA 4AU1A 1O5TA 2XMQA 3PDIA 3DMYA 4URFA 3JSXA 1EGMB 1XP5A 3DV0B 3Q3CA 2QTZA 4IDHA 1QH1A 4Y9TA 5FEUA 2RC6A 5IYZA 5C35A 1HDYA 2QDXA 3TSYA 4TMWA 1AGNA 1VSQA 4FFOA 3E9NA 1P75A 1ZOLA 4BIIA 2QTVA 5EIOA 5LP1A 4C7OA 2ECOA 4N0EA 3G68A 2JFQA 1ZN9A 3PJGA 5AQEA 3JQAA 3FCSB 5I48A 3TCNA 3TK1A 1MDBA 1BG6A 2AJCA 2J1LA 3CQ9A 2ZBVA 3RIGA 4F4CA 4CL2A 1POXA 4NK5A 5GQSA 1MPXA 3B1JA 1KAOA 3B6EA 4BLVA 2IIVA 4MO2A 3EQ6A 4FYWA 1N36B 2VBFA 1ZR4A 4IO1A 3JAKB 3W2FA 4BGUA 4HDAA 3SSMA 1INLA 1KNXA 4ND8A 4D02A 3EGDA 2K87A 5KX5F 1M67A 1QS0A 1WHTB 2YYYA 4M54A 3S2SA 3D6MA 5C8YB 2GSWA 4F45A 3VHQA 3QMVA 3H2GA 3CSUA 2DWOA 4X8OA 3IS3A 1VPWA 1YZHA 2YYZA 2VAMA 3A6DA 3BG5A 4I0WB 5D7NA 1FYEA 3K9GA 3K0SA 1BMQA 4U8HA 2YCBA 4YYZA 3LYAA 1B26A 4Q9NA 2AUTA 3V2UA 4ZHSA 1EWQA 2AKAB 4PQFA 4F3NA 1UL1X 1JFTA 1KS2A 4KE7A 1DEKA 2YRXA 4DIEA 3HU5A 3V4PB 1B8NA 4KAJA 4IXWA 4YAWA 5GZ1A 3Q5DA 1QG6A 1WCIA 1ZCJA 1Z6AA 1I4DD 4IRMA 3WLSA 2BEUA 4QU0A 4S12A 4ZODA 1EFHA 1CQIA 1CVRA 1KOJA 3M89A 1QQ5A 3M6AA 2VYCA 4OF4A 4XVCA 4H7DA 4W9NC 1RQ2A 4LNUA 4RACA 3TJMA 4D9CA 1BOOA 1MPTA 1XLTA 3N2YA 4PQYA 3N3BC 4FHZA 2J3QA 1P9NA 4RE5A 4HMOA 3DJFA 5FTNA 1E64A 3ROEA 4B46A 4OHKA 3STVA 1W1WA 1GZHB 1IU9A 1PT9A 2CVFA 3OJWA 4K9KA 3VBEA 2OPBA 4WZ6A 4XVUA 1CR4A 4OGWA 3KD2A 5B58C 1N2IA 1F8GA 4EA6A 3QXHA 2JASA 1XROA 5K8UA 4J4TA 3ER8A 2GDJA 4FFVA 4FNGA 2COKA 4OJTA 4BIMA 4UFPA 1JAXA 4CE6A 4X6UA 1K9SA 4RBNA 1V3UA 1U2DA 1A7UA 1FCJA 3LBNA 4FILA 4ZFNA 3T7JA 5FPKA 1TTTA 1W88A 4HWKA 4FW9A 3TRHA 1UT6A 4LGYA 1ZA2A 4IZHA 3STHA 1UKYA 7ADHA 521PA 3JSAA 4Q4JB 1L7QA 2HJGA 1NV8A 1FTNA 3GFGA 1QDLB 4CT4B 5A3QA 1YGYA 4IEFB 4RZUA 4G63A 4UCFA 1B76A 4LOJA 1DC4A 2XQKA 3VJMA 2HPAA 3J80A 1Q6YA 2IDMA 4X95A 5ILOA 2CDAA 2IU6A 4DR2B 3FWPA 5EQFA 2VP9A 1U7UA 4AG6A 4BECA 3O6VA 4DV1B 1Y9JA 2Z9DA 4KSCA 3RAPR 2CB9A 3P52A 4Y6GB 5KX5B 3EAQA 1KK2A 2GZSA 3U7QB 3V32A 2FR8C 1PBTA 3GJ6A 4BZXA 3KSZO 4I50A 4BKOA 1G7SA 2PMFA 5AVZA 1GT91 3KJIA 3G9XA 2FDXA 4A6XA 2AEFA 2D2VA 3L79A 4KG7A 4L4UA 4MWGA 4GZ3A 1HO3A 4CKCA 3PC2A 4H9GA 3PRKE 3F5MA 3HCRA 4R1OA 1HDIA 4D0NA 3RAGA 2CYBA 3KKPA 3R24A 3C3DA 1T8RA 2A0KA 3Q0IA 4NDNE 4NSNA 1QGED 4I3HA 4F5DA 1A97A 4OAOA 5AJHA 5HDBB 3AM5A 4JEMA 3CUKA 3HZOA 4Y9SA 4F2GA 1X7WB 3O26A 1X8LA 2GJSA 3F6EX 4ESEA 2JEOA 4HAVA 4BO3A 5HWSA 3BRWD 1EWTA 3N8GA 4KVZA 4QFDA 1SCKA 2Q2NA 3GGJA 4KAAA 2SECE 4OAQA 2XE8A 5JAZA 1OGJA 1YJAA 2DSNA 2QIPA 3GT3A 4HXEB 4BCBA 4B3CA 2IQIA 1Z5GA 1YR2A 5DNCA 2WF9A 2REBA 2BWJA 3QLVC 1AY0A 4WLOA 5FD8A 5EP3A 5D84A 1SBYA 1NHGA 2OFXA 5BNWA 1NNSA 1LTHR 4LZNA 1QMPA 2OWEA 4QATA 4DY6A 4KREA 3P9KA 3JTEA 4PGMA 3T7SA 3ZLUA 4JBGA 5JSHA 3AFIA 3L7KA 3W3AH 2B7CA 4FYHA 5B2FA 4PG6A 2O2JA 2F7SA 1RZ3A 1ZN8A 2XZPA 4ZMBA 5JTUA 3DKIA 3DWIA 3PA8A 3R74A 1MB2A 1UEJA 3AR6A 3ZGOA 4BC1A 3K9CA 4C4OA 2EGUA 4F96A 1YBFA 1R37A 2H29A 3MAGA 4BZPA 4N54A 2IXDA 1F0YA 4FP9A 2Y71A 2Z2ZA 3ILSA 3WLTA 4S1OA 3QPCA 4UHDA 5KQSA 3UT5A 4M8KA 3PTLA 3FSGD 4RDCA 1ISFA 5CVVA 2H4FA 3VJRA 2B7LA 1RWPA 4AMVA 4X63A 3RE1A 3CR8A 4L6IA 3WIUA 3JQQA 1EX1A 2A6PA 3HJFA 3FE2A 3R3WA 1WUHS 3IUYA 1RLIA 4MVJD 3C4QA 5JQWA 1TKBA 2FPXA 1YFLA 3SFVA 1O2DA 3ETCA 3ZWYA 8OHMA 2H2DA 1JHVA 2XCLA 2Y9MB 4RMJA 1ISMA 2EKQA 1G7TA 1KBQA 1ZPDA 3P2EA 3GFTA 4I19A 1XZMA 2VF4X 3EVFA 2ZS9A 3HWSA 3TQCA 1IFXA 2Y1FA 1T3TA 5HRCA 2GXSA 5DEIA 3S4YA 3U44B 4X6XA 3K0KA 3EA5A 4TS3A 1RJ9B 4GOMD 2Q4DA 1AQUA 3OETA 4KYIB 2WG2A 2FXVA 4B3JA 4LZAA 1NHWA 2WIGA 2X2OA 4JJIA 3Q3HA 4IXDA 3GZ4A 4MIYA 1CRZA 2AD5A 2V4ZA 4ND5A 4KN6A 3D0RA 4YK7A 4OB8A 4E5PA 3S70A 1I32A 1C7QA 1R00A 2PLAA 3QYJA 2Y0PA 5DHSA 5JCJA 1OIXA 1ZMRA 3U1VA 1U2GA 2H2WA 3IEKA 4M6WB 5DMHA 3SVTA 5E8JA 4EGCB 5SY6A 4FFDA 2XWQA 3AEQB 3JQFA 3AF0A 3ZE1B 1V37A 1YZTA 4M55A 4I9NA 1ZH2A 2FZLA 4ZV9A 3K2QA 4KMRA 3GFOA 4PSKA 1P4SA 1WCIB 3D31A 5IBPA 1ZXBA 5JANA 2XE6A 5AXCA 5KAMA 5BUZA 4Y6LA 2EIHA 4QICA 5ECYA 4DLKA 5CAEA 3B36A 1ZVJA 1YA4A 3OJLA 4P7BA 4F1JA 1NM5A 2TMYA 4LYYA 3V1LA 4PC3A 3NASA 5E6SA 4ZVVA 5BSWA 1J1ZA 4YCMA 1TL7C 3MWDB 2OESA 3N1UA 3T7CA 4P58A 1GHTA 4N12A 1SZDA 3U4QB 2QN1A 4E13A 4ABTA 1NUPA 4PZUA 1ZJWA 1Q0UA 2EZ8A 2RGYA 3DVRX 3MCTA 4DAOA 3IAM1 5HZKA 2PUVA 4L4XA 1MO5A 1QZTA 1WE2A 3IHTA 4JNKA 1MO3A 4IJMA 4W7HA 4QTUB 1RACA 3EUWA 2NZ8A 3IAXA 2F9FA 3PQ4A 4RMIA 4U39A 5DNAA 2W83A 4FDTA 2FH5B 4PX9A 3PFNA 3OVMA 4QGHA 3PHJA 1NW3A 1U0GA 4R51A 5ALZA 4UATA 1UBTS 1NUSA 1TVEA 2ODBA 2ZSIA 4XQEA 1YACA 2I6TA 1LPNA 4KXYA 5I9LA 4LKOA 4QVKA 1WDMA 5C1IA 4PYLA 1T13A 1Q1BA 1BWRA 5AJXA 3UICA 1JQ3A 2C2XA 3L0OA 2C61A 3NFRA 2XCRB 3WK6A 3F6BX 1RAHA 4N6NA 4K0RA 4J7XA 1L7OA 2VKQA 4HF7A 1P2DA 4WBXC 1GZ4A 3CZ4A 3PUZA 3O4HA 4JWKA 5JOQA 1VGVA 5C4GB 2QG4A 2ZVPX 4TRRA 5JAQA 2YZMA 3JARA 1YDMA 2BGIA 1IL0A 4YJGA 1HNXB 1YJCA 4M7WA 5REQB 3FDZA 3LUBA 1DO8A 1X1EA 2A4MA 4OFBA 4TUYA 5FA5A 3RRMA 1V8OA 3VNRA 3MWLA 2PM8A 2GD1O 2LW7A 3G3EA 1RLTA 1I94B 3ZD9A 2XXAA 4AMGA 3IEXA 4JJ4A 1NF8A 2Y1WA 2PH7A 3L8GA 5E1OA 5CFPA 1RRKA 3KKQA 3PUWA 1ZM9A 4PGGA 3DE1X 4D44A 7MHTA 4N5LA 5BN3A 2DQYA 4J1NA 5JARA 4G0WA 1SU7A 3VR0A 3F8TA 4B85A 1IAVA 3E7DA 3OMWA 3VPHA 3CUEF 1SRRA 4AXXA 4JYCA 1CLEA 3HHPA 3HN6A 2OR3A 2C9CA 2TMKA 3EIEA 3IQGX 4MIOA 5F52A 4QU9A 4Y6QA 3W0LB 4BNLA 5FWAA 1C4XA 3DBLA 2XY4A 2J0VA 4WK4B 4CF4A 4X7BA 3K9BA 3VX3A 1O94A 1G3UA 2EW1A 3W7AA 1LJ8A 1UH5A 3PXXA 4PHGA 1E3LA 1ETUA 3HXTA 4I3GA 621PA 5ES3A 3PLAE 3TL2A 4Q19A 4KO8A 1MO4A 2ENWA 3MAJA 4GECA 1OWNA 4LHYA 1QHSA 3ZCQA 1UIMA 4RPIA 1P2FA 2FWMX 2PANA 1AZSC 3VTZA 1KDOA 3I6BA 3FH0A 2JG3A 3UWPA 3WYFA 2GN0A 5KVVA 4O2AF 1U0NA 5DEOA 3TVDA 1MAVA 3TLGA 3HBNA 4B4OA 4YONB 3OTHA 4RPGA 2ID4A 3IAS1 1CUHA 2IHKA 5I47A 1CDEA 1ZSYA 4LVNA 1D2AA 3BKWA 4A2WA 3QSYA 1YCFA 4AP9A 1JIXA 3QE4A 1K8XB 4Y2VA 1U9IA 4YTEA 2LCQA 3BFVA 5KNCA 1CP2A 1T29A 1PEDA 4V0SA 1PJ3A 5C8XA 4QUKA 3L6EA 4QGAA 2AF3C 3OD1A 4ZDIA 3NVAA 3AHCA 4CHGA 4BWFB 2QRGA 4DR7B 3DT9A 4HNSA 2EJVA 3K6KA 2FWJA 2OLJA 1T5TA 5B3JA 1XKXA 2IDKA 1VMDA 5A7FA 4OSEA 4R8MA 1PK8A 4UNPA 4CLRB 1ORRA 3DLBA 1GVNB 4FFRA 4FX5A 4X0EA 5DX8A 4UEOA 3E9ZA 4PWZA 2DWPA 1EKXA 1LK7A 2PX4A 2YMLA 4EW2A 3HB4X 2AJTA 5DN6A 3SQDA 3ZWBA 1BFKA 2ZI7A 3K9NA 3FUVA 3ZU6A 4YPVA 3UQYS 4LF9B 2IOQA 5DJ5A 2H4WA 5EE3A 3ESBA 4RXUA 4XIIA 3VTFA 3NWPA 4HDMB 3KZVA 3B9PA 2XA2A 2OB1A 4X90A 3VMFA 2FFRA 2GN4A 2HJWA 5L3SB 2DPYA 1QNFA 3ADCA 1UBNA 2A7QA 3D1LA 3GH3A 3GLUA 3Q2OA 1XVIA 2RARA 3CJRA 3KXKA 2VHEA 1E5DA 2OILA 1ES9A 3H5TA 4TROA 4B3DA 3SC4A 1LLFA 3KETA 5IBRA 5G1OA 1VKOA 1U7HA 2C9ZA 4A8JA 2QROA 3HY6A 1I1HA 3B2NA 1ABFA 5IJ9B 3F7OA 4HD8A 1OXXK 3RVJA 1J0AA 4DAEA 3FSEA 1A5TA 1XRRA 2XUHA 2Z8XA 4ASUD 1E1QA 2O8BA 1XVVA 3RC8A 3H2HA 1KU0A 1ZCBA 1A9RA 2VDWB 1EGVB 3UB4A 1MEEA 4OFXA 4ZCSA 1TRKA 4YXWA 1ZAYA 2JFHA 1WXDA 2H5JA 2QVCA 2I6QA 4G4SP 4Y2SA 5D1NA 1WX1A 4MPDA 4O2AB 5AT1A 1EVEA 1G8YA 1L8AA 3WQRA 5IVDA 4HV4A 2GTPA 1TW3A 4DNPA 4BNVA 3M83A 4CMJA 1WSBA 4Z4EA 2ZI3A 2QAGB 1D5WA 4GMFA 1BDJA 2AG5A 2B2NA 2DPHA 2GCEA 1G17A 1RBYA 1KS9A 4QFCA 2WJYA 3GNLA 1DKUA 4R69A 3EEBA 4M38A 3FNBA 4WJKB 1O57A 1QU3A 3BXHA 4X1OA 3NBYC 2O05A 4PE5B 3FJ1A 2PV0A 1R8JA 4K05A 1T2EA 2QQFA 4G1EB 4X91A 5EMHA 2IU0A 3DEFA 2BAGA 2HJHA 5H3CA 3CRMA 1NXWA 2BLLA 5BMOA 2YZ7A 3EXHA 1TCVA 1DAKA 2JIBA 2IUSA 5FJIA 2C96A 2DKFA 1IOVA 3GGCA 3DUFA 3HDQA 4ZAFA 5FHRA 3RRBA 1Y6FA 1NYRA 2IYVA 2D7JA 3STXA 1EUZA 3PD0A 1EGHA 1NF2A 3BH6A 1XNHA 5BXYA 1JG4A 4K6OA 1QIDA 3B1ZA 2ZCVA 1PSDA 2XUPA 2ZKLA 4PTYA 5FFFA 3K15A 2HRRA 1K5PA 3KALA 1FBTA 1NYLA 2AD1A 2QJRA 3QPWA 4J1TA 5DHFA 1LCIA 2UYYA 1J0EA 3ZBPA 2AC7A 1NPDA 3B1WA 3R5FA 2MT9A 5HZMA 3OCVA 3DD5A 4NK4A 4YA6A 3UJPA 3LRPA 4BO0A 3FVQA 3MW8A 3KZOA 1KAQA 2WAYA 2PGNA 1R88A 2HCJB 1ZCFA 4U6QA 4Q3OA 3TLAA 1CUJA 1FFHA 1NY5A 2P9JA 2O6HA 3HJUA 3RO7A 3WA7A 1KDZA 3NTQA 4GICA 3GRUA 1U0FA 4NY1A 1Y33E 4AS3A 2D1RA 1BAPA 1EDOA 2Q1WA 2RBGA 4DNQA 3RSLA 3ILXA 3UB2A 3ITNA 3V5NA 1CY4A 1Y9ZA 4E3WA 4ETWA 3MOSA 2K4MA 3OEED 1ZOOA 2H11A 2WIDA 2XDQB 4YAKA 3C6QA 4Q9IA 3G0BA 4QUJA 3R9IA 5LOVF 3IHWA 5CXUA 3OE1A 2VFAA 1T34A 2IPLA 4MJ7A 4V0KA 5FL3A 3B82A 3ZR4B 5AUPB 3PV0A 3ZY6A 4FR5A 1OFUX 2DFNA 2CLKB 4GVLA 2QTBA 4TGLA 1K8RA 1ADYA 2OM6A 3QV2A 3AVYA 3GUUA 1IDN1 2C2HA 1FS5A 4YP0A 3HDYA 3WMFA 3JD3A 3E48A 3DBHB 4FE3A 3DEJA 3FTEA 5AXAA 4UOEA 1XALA 4RKYA 2H2IA 4R3NA 1G8SA 1ZI8A 1PGOA 3W9YA 2LP4Y 2VBCA 2KWIA 2I2CA 1LK0A 4OBEA 1YQ9A 1ADBA 2QRZA 5IS2A 1TK2A 4IFBA 1K92A 3QNWA 1SOVA 4QDUA 2R60A 1CZHA 4NHOA 4PZPA 2P6RA 1PS8A 4CVNA 3O4GA 2GASA 1M6VB 1W36B 2I2WA 2B94A 3DL7A 1W8IA 4D25A 1GKYA 1XVLA 1MAHA 2BHSA 1TE2A 3PEFA 1KY2A 1NVFA 4J91A 3P9RA 4DQDA 4F8JA 5BOSA 3LY8A 4RLFA 2AQIA 4PHTA 5B1EA 1UWVA 2EDCA 4I46A 1RWQA 3BWEA 3HVUA 5K45A 3VVLA 1NP6A 3DXXA 4UMDA 1BE6A 5IJ0B 1GRNA 3M82A 3ICVA 3PQ3A 4V0OA 2FPIB 1Z08A 3JVIA 4TTAA 1GQQA 1D4FA 3ZV7A 1V1MB 3HWRA 5CYGA 4HZUA 1FLVA 2J0SA 1L7AA 2YRWA 3PYLA 1OWLA 5F4BA 3DNPA 3DSRA 4GX5A 4PQRA 1L1EA 2I2FA 2Y0CA 3EFEA 1E59A 3U48A 2Y1LA 4BTVA 5ADWA 4WESA 1I4LD 2X7XA 3HUUA 3T94A 1BOFA 1UPFA 1YC5A 3C6BA 4EVSA 1IJBA 5IHXA 4C20A 2PU5A 3G2HA 3IP9A 4Y9UA 2YHSA 1I0IA 5L6MB 4LVCA 4X3PA 1U3UA 2Q1TA 3FKSA 2W90A 5AM1A 5IK2A 2WYWA 4CR8A 5KYYA 1H8HD 1ZESA 2EJUA 2EXXA 2HIHA 1NWCA 2P5TB 3G85A 3NAGA 4ITUA 3Q40A 3UGQA 5LOVB 2ORWA 5E7MA 3CXUA 1TQDA 3N8HA 3RAFC 4RQBA 3Q2IA 2OLKA 3IO3A 4WRRA 2BTQA 1YIOA 3BXEA 4ZOCA 2OQVA 3BSYA 3EOBI 4CLOB 1WPGA 3AIOA 4PONA 3AK4A 4QSHA 2WQ7A 1J1UA 2HA2A 1JSCA 2R48A 4G8JA 3DR3A 4WBNA 1ISPA 3U19A 4MUKA 1IN7A 4GXNA 3AF2A 5C34B 1GNRA 1ZUNB 1TC1A 1WS6A 2WMYA 1KO7A 2V6IA 1G98A 3N0WA 4XPIB 1NLZA 2GJAA 4LF5B 3BGVA 3ZJYA 1YU6A 4J0IA 3L0YA 2AOVA 2VT2A 1XTJA 1Z7BA 2HREA 3BWCA 1VE3A 3A25A 4OD0A 2QGFA 3EIXA 3OZUA 3ST7A 2VBGA 1BJRE 3MT0A 2NQ2C 2WFMA 3U5TA 2AFHE 2TMDA 3NEJA 2JLYA 1NN0A 2AL7A 2RAUA 3H2BA 3W3AA 4M1WA 5EQTA 3SDBA 3TIIA 3VUFA 3QVWA 1FW8A 2ATCA 4WCVA 1HEIA 3M0EA 1RXYA 3ROXA 1UMKA 5JADA 1L6IA 1FQOA 4G1CA 5J2UA 4MQEA 1Z5ZA 2AX4A 1NTOA 1SHUX 5HS6A 3DAFA 3O8RA 5CA0F 3CZCA 1QUEA 1R9JA 2WU0A 1M0TA 1UPCA 1A1SA 1XDSA 1G55A 2G3YA 4FYKA 1BC5A 4IIUA 4L08A 4PAOA 3T5DA 4RDXA 4YP9A 4EVIA 3ZQKA 3ZI4A 5IU6A 5JRJA 2Z3WA 4KRFA 1JSZA 2CJPA 4GWLA 1USIA 3N59A 1N6KA 3EXHB 5TMBA 3WWDA 1YDWA 2GFQA 3A05A 3JXEA 5KDDA 1QQBA 3BWBA 4GM1A 2B98A 1G0OA 1EUCA 2R7MA 3KHTA 4LJ9A 2EWVA 5ALFA 5K0ZA 1MRNA 2D1FA 1VP3A 4LHWA 4KN5A 4FYVA 3D6HA 1VCHA 2ZRMA 2FN3A 4EZBA 4D43A 4WN3A 1GPNA 1H42A 3BWVA 2M98A 4HR7A 5EESA 3V1KA 1BJTA 1GV0A 1Z34A 2PWAA 4LWZA 4XA8A 3NEYA 1TLFA 4FX2A 2GK3A 3K0FB 4Y0VA 3TMKA 5AIBA 2PZEA 2RG1A 1AQJA 4FR2A 5A71A 3OKAA 5COBA 3TN7A 4EUNA 5EWJB 1LTQA 4UEJA 1WKCA 3QRWA 1R9NA 5H59A 4K2HA 1G2OA 1JAHA 3PL5A 4RGBA 3CVXA 4KO4S 5H4HA 1I4WA 5DBGA 2P7HA 2YIDA 4IIFA 3VYWA 1L4NA 1XYYA 2I78A 3GLIA 1TCUA 2WSMA 5KYKA 2GESA 2ETXA 3DS8A 4MRAA 3PNYA 4RCVA 2HA4A 4ENTA 2DEUA 3ASZA 4WLVA 4FVTA 2CBZA 4WZBE 2P5SA 5F9MA 2PD4A 2IHTA 1WXFA 3DTVD 4EJSA 4B3SB 3LVQE 1SHLA 1TD9A 1LSSA 3GELA 2BHRA 2ZB7A 3HJAA 3UBMA 1A8QA 3ZKWA 2AUMA 1QO0D 1S7CA 1J90A 2BGMA 4WNAB 1ADCA 2F62A 3KEGA 5LZ5A 4ZA2A 3L7DA 1DI0A 3I2KA 1WY7A 3ZWWA 2Y4OA 3Q7TA 4JMLA 4XWTA 4ID3A 2E7ZA 3LFUA 4BFWA 1W19A 4ID9A 3AHGA 3LUPA 2F48A 4IKEA 2NUAA 3CZAA 3UUEA 2F3TA 3WL4A 5TVGA 1I51A 1SXIA 1PVOA 1JFFB 2LKCA 2FJPA 3RVNA 1B93A 2H3EA 1NYQA 5FP0A 2SICE 3VV3A 3D2CA 4MW4A 5A3SA 4MDFA 1RQ7A 4H7IA 3W79A 5CA0B 5DM70 4XGNA 3GUCA 1VLVA 5JU6A 4F97A 1R18A 1W29A 3E22A 3E82A 4RK6A 3TW8A 3GFPA 4K8OA 3NBZC 5JFOA 3D4LA 1QHNA 3KQUA 1IWBB 2OHFA 4DW8A 3PFHA 3NYIA 4RHFA 4C01A 5GIPE 1HE5A 1M34B 1NW8A 3I8SA 3TQSA 1N1EA 1I7NA 5CD9A 4W5QA 2J31A 1Y4ZA 2Q3DA 3LHDA 1W94A 1H2YA 2ZJ0A 2ZROA 3DMPA 3DTNA 4LISA 1XZGA 2EYUA 4E51A 1U3FA 5FIUA 2BV3A 3I1FA 3H87A 3KWFA 3WLPA 2X9LA 2IHNA 1EHIA 1RT9A 4AMBA 3N2NA 3CTPA 1SVIA 3IVGA 1S96A 2VDJA 3U40A 4B45A 1N3LA 1TAHA 1QB8A 1UAGA 3HKCB 3JAMA 3IIJA 1VECA 5H16A 4FHGA 3V34A 1EUYA 5AW7A 1RWWA 3NHSA 3QF7A 3VR3D 1ZMOA 1JZTA 3H4IA 4P4LA 3WHIA 3VC2A 3N0XA 5BMVF 1JKIA 3FZYA 2VHVA 4MQ6A 3VR6A 2VYFA 4X8HA 3KU1A 5H83A 2CXRA 2BW0A 1XI2A 2FWBA 5LYYA 1KDVA 4IJWA 4HH1A 5KNBH 4DEVA 2N46A 3QX9A 2HADA 3JQ7A 3CUUA 4PPGA 3S2IA 4EGFA 2J59A 4WZAB 2JVJA 3BXOA 1SWWA 3B51X 4J0HA 5FTJA 4LDPA 4MTLA 4MPRA 2PTGA 3LW7A 4S1VA 3K32A 4QAJA 4I36A 2ROQA 4EK9A 4LI0A 5LC1A 2R97A 4DR4B 2QBYB 2GERA 4ZJPA 2IY9A 3AQ4A 2RGUA 2V6BA 3OZBA 5BT9A 4XWOA 4IG9A 1GUAA 3SIRA 5MFZA 1T8SA 3EK2A 2MINA 1YBVA 1MJHA 3MUEA 3PUKA 3DLTA 1ZMTA 2HX1A 4MV1A 2OTCA 2AV6A 4KPFC 4LBZA 4UULA 3WI7A 4FSDA 1I80A 4XRGA 4F60A 4XIFA 1ZGHA 2GYVA 4PLHA 3VDMA 3EVZA 3X1YA 3HXQA 4AICA 5B30A 3F7NA 2C8KA 4Q4AA 2BY4A 2F8SA 1AS3A 3ZH9B 3R8CA 3A9CA 5HCIA 3WBJA 2DUWA 1JDNA 2O8DB 2LZ0A 3DPIA 1Z8DA 4DA7A 1DZIA 2NSLA 2BE9A 1PSWA 3C16C 3NKLA 4LGMA 3ZN2A 5HK9A 4AY6A 1Q1AA 3TUZC 1HDGO 1SA0A 2FSSA 2BKUA 4MQEB 2J3JA 1E2EA 2QVBA 5GZ6A 3VR6H 1SGWA 2D8AA 2CLEB 3I5MA 1IUNA 1K9VF 3H86A 3KLMX 2GEKA 1OBVA 4HDNB 4KNWA 4WCDA 3HM9A 2YJ5A 1R6DA 2SCUA 4C6HA 1Z74A 3GN2A 3SDSA 3ICEA 4OAPA 4ENRA 1B43A 4KXWA 4ZCTA 4XIGS 2WD7A 4LXQA 1YA6A 5BMVB 4NYJQ 4NS4A 2X41A 4GKBA 4RIEA 5HMLA 1FC0A 2ZLBA 3G0IA 2BGWA 5FORA 3EEQA 3QKRA 5CDYA 5HILA 1XF9A 3FLMA 1FF9A 3NH6A 4KE8A 5FYQA 3VHXB 4XLTA 4A91A 5ALPA 3BOSA 2DUNA 3COYA 2JCXA 3LHKA 4HFMA 2AF4C 1FZTA 4LNHA 3BBLA 3BCUA 3GUZA 1ECFA 3QUTA 4MR9B 3DZ8A 3TSCA 4B09A 3JQ8A 3RKSA 1XEWY 4AY2A 1KMNA 1AV6A 4ARUA 5AJZA 5CVEA 2Y1OA 4QPCA 4UU1A 4HNUA 3WRYC 1ZGBA 1X42A 2AYYA 1Z6ZA 2UAGA 2VUTA 1F9EA 2ZRFA 6ADHA 1F0KA 3GLSA 4C3UA 5K8JB 4H1VA 3EFOA 4UZFA 5CFRA 2OAQ1 2IZ5A 5DSXA 4BAZA 1M2FA 4GR9A 4CZ2A 3G6KA 2CN1A 4YCDA 3ZCXA 4MV0A 2OCBA 3AR8A 4TWZA 3HUTA 2IE8A 5E6RA 3ZKWB 3T5PA 4FDVA 1Y37A 3D3WA 3ZE7A 2BN4A 5IVHA 3FYUA 3E1KA 3OEYA 4NJMB 4CM4A 4GOND 5BORA 4C0JA 1Y1RA 2R65A 4NE2A 4RPKA 4U2EA 3R9KA 3TCKA 4YMUA 2I7TA 1FIUA 2H8GA 3TLYA 1CDDA 1JJBA 4M1YA 5BSFA 1CZNA 4WLUA 1I7DA 3ODPA 1D8TA 1CS0A 2V7GA 5CH5A 2QE7A 5LQRA 3NHBA 3RS5A 1L5QA 3OHMA 4AX8A 1Y5IA 3IIIA 3N39C 2EBHX 3QUSA 2CNLA 2RHWA 1Z2AA 3BRCA 3TSZA 4A0SA 3MRXA 3QUBA 4QULA 2JD2A 4XDZA 1BXRA 2X9GA 1DBRA 2BPOA 4YDHB 2XE4A 1O6CA 3BEOA 4MI3A 5JZBA 2HU5A 1FQWA 3OJ0A 1GGJA 3NOOA 1OYOA 1AIPA 3W5JA 1OE0A 2I7DA 3FTDA 1ZGGA 1UC9A 2XTJA 4IJ6A 4J0CA 1HF3A 4R68A 4TMZA 4UDOA 2XYGA 4XJVA 1ZHFA 1BWPA 1D2HA 1JDBC 1J49A 2O48X 2QTMA 3M34A 3CLKA 4RIIA 1TI7A 4G81A 4ZOAA 4PX2A 2IWHA 2HIMA 2OV1A 3C1OA 2C5SA 5T8KA 1EGQA 3DB1A 2A33A 5J4KA 4YWHA 2FSVC 3AUFA 1UMBA 5TPWA 1CY7A 2QXUA 2VDOB 5IXSA 1UDBA 3C4JA 3AMVA 2COEA 3KFXA 1TKAA 1U1IA 1JSRA 3EAFA 2GN1A 3BL6A 3JD0A 4LWOA 4FFPA 4N7BA 4U63A 4GC5A 2HFKA 3RYCA 1MLDA 2J3IA 2J9RA 2DKOA 3LUJA 3QVGA 5GOTA 4DV3B 1IATA 4GPD1 4RVHA 4BE4A 3WGVA 2ZPUA 3N28A 3ZNOA 3TLXA 3SIPA 4OYLA 1DXYA 4QHSA 5I7HA 2WC1A 1BKYA 5LXTF 3T95A 3O73A 3TMYA 3R5JA 1IAQA 3BMOA 4CIVA 2X8WA 1R5NA 4LOKA 4UEKA 4MQMA 1E2PA 3UGTA 3R5HA 5K5EA 1X1RA 3FWZA 2CY0A 2HK8A 2QW0X 2YXLA 3E3OA 4UU7A 1VDZA 1E7SA 3CF2A 1MCZA 3RFCA 2PWYA 4KPUB 1GGKA 1ZNYA 3MTBA 4LA4A 3T5TA 3SJZA 2P0YA 1LBSA 3KOZA 2Y1GA 1CUWA 3NNNA 2QX8A 2D4AA 3RF7A 5CBPB 3E15A 3PEWA 4E3ZA 2ODTX 4H18A 3H8WA 2AR7A 3IAHA 4ZVUA 5JHHB 3FJOA 1KC1A 1Z28A 2XZTA 3ERCA 3L92A 4LRYA 1WDKA 4BTEA 2CYCA 4MUNA 4AC9A 3CR3C 3WXBA 1JA0A 1IJKA 3BL8A 2VA8A 3H5VA 4QPDA 2HF2A 3AHEA 3CH5A 4K1LA 4RCYA 2PSSA 2F4VB 2HSJA 4HB0A 1L7DA 4PLGA 2W2XA 3D2LA 3ZZUA 3U6BA 4BMOB 3QLEA 4ML3A 4MH0R 5KKAA 1BRMA 3IP6A 3K05A 3ZH2A 5K0FA 3ZWQA 3KVNA 1HV8A 4W9NA 2KX7A 4DCCA 2RGXA 1Z0ZA 3KQWA 2YZ2A 4G2NA 5GINE 1SA0B 5FOWA 1NXPA 3JWPA 3ZTWA 4ZVKA 7ABPA 4MHTA 2XSZA 3GEGA 4RVCA 1E69A 1Q1ZA 2N9UA 1SCBA 3L7AA 2JLXA 1Z8HA 1E2MA 2BELA 1ENZA 2EKBA 2XF2A 1V6AA 1FDRA 3CPEA 5DLPA 4CMHA 1NRXA 4NBUA 5JAHA 4UBJA 1XCJA 4F71A 4TPKA 3D1VA 3V7YA 4MUYA 1CIJA 5FNZA 4PLWA 3MS4A 1W5AA 5LU9A 3ZIDA 2O9JA 3ANLA 3WZMA 4JMPA 5EINA 2JIZA 1T8TA 4BVGA 1LV7A 5IZCC 5DNDA 4HN2A 1AF7A 1IPEA 3OT5A 2W2LD 5T41A 2QQEA 4D0GA 1NI4B 2ZIAA 5LXTB 5EKXA 1NPTO 1PJRA 4F56A 4ZVPA 5A4DA 1DG1G 3A6FA 2FPSA 4AJ9A 1YS6A 2WUVA 3RYFB 3BIOA 2ODAA 3OICA 1DMSA 4G86A 1Y80A 4L2IB 4L28A 3Q1LA 1GKIA 1MH9A 2DM6A 2K2QB 3IELA 3MMPA 5E4TA 5SZJA 3QHQA 3UH0A 1O0BA 3DF7A 5I7EA 5H8WA 2QENA 1U6JA 4JBHA 2V55B 3EIWA 5FBQB 4HT3B 3T3OA 2VDNB 1B6SA 5HF9A 1PR9A 3H11B 1MT0A 4X85A 1N2GA 2C2MA 3ZIAD 5F3RA 2YINC 3ICWA 4HGZA 3T4UA 2JNWA 1IHXA 1NJ1A 5H3LA 3F6YA 3VPBA 4W5RA 2PL9A 3ZJ5A 1PV2A 1KARA 1KP3A 3RPEA 3WWOA 2IXBA 4LXGA 4Z9FA 4HO1X 3HDTA 1QYXA 1EUDB 3QXSA 2P6NA 3W6NA 1U6KA 5FWDA 1H69A 5IF3A 2GZ3A 3L8MA 1P8AA 4ES6A 1ABEA 1DG3A 3A6KA 1J70A 3BTUA 4R1LA 4LXXA 4YRMA 2GCOA 4OH7A 1Z5OA 1BE0A 4FZ3A 5KJCA 5KSZA 3MERA 4DR3B 3IDAA 1HDXA 1HYEA 2ZUUA 2NO6A 4AY3A 1SKUA 4P93A 4EF6A 1R0BA 3Q0TA 1DWOA 5DP1A 4B4UA 4YQFA 2JIPA 3CZQA 5EKDA 4MVJH 1OFTA 1WMDA 3JWIA 4MKZA 5IXJA 1N1DA 2YFHA 3AF4A 3QLVA 4O08A 4QHTA 3O4RA 1NOJA 4O63O 2VH2A 2RB5A 4W5JA 1FK8A 3BTOA 3VR4D 1Y8RB 4LDQA 2OBLA 4MS3B 1NUTA 1T9DA 2A5LA 2WMNB 4FCTA 3PI6A 5DF1A 4R1TA 4BLSA 1QVRA 3HR7A 3NT2A 5EL0A 3B5EA 3LM8A 4YRFA 3RKUA 4RA6A 1NQOA 4E15A 2VIIA 2X1MA 3HS3A 3WLKX 3OQMA 4ZEVA 4P4TA 3NQ41 1DADA 4CF7A 1U90A 1XLWA 3NTOA 4XEHA 5BW6B 1JHDA 1U3TA 4LMRA 2PEYA 4UNSA 2NVUA 3T3PB 5GTDA 5EUCA 1QOQB 3LKZA 5F77A 2QP4A 1EEHA 1P5FA 3MILA 2A1IA 1JLLA 2D2IA 4FGJA 2BFFB 2Q8PA 2Z1MA 1J2RA 3IX7A 1MZVA 1H0KA 4TL9A 2I6SA 2XZLA 1KYWA 2EFCB 4OOFA 3AINA 2YZKA 3ICQB 3PITA 2B6HA 1V48A 2WD9A 1Y4AE 3ONWA 4NJEA 1IZYA 2R00C 4URXR 5JI2E 2P9CA 1GFIA 1VPLA 4CV3A 3RWOA 1RCUA 2O8EB 3Q8WA 1OXTA 4E2WA 2YV5A 2C3UA 3LVRE 4V03A 2I03A 5EJ6A 1XZDA 3BB4A 3M6WA 2VHWA 5JS2A 3ZWNA 2HLDD 2Z2JA 2C58A 4UHKA 4BJHB 2BCJQ 1ORIA 3EJWA 4PIPA 4HVTA 4YGXB 4LDZA 2NZ2A 5I6DA 4G41A 4D99A 3DZHA 4XD7A 5I8WA 4ZT6A 5F1KA 4DBVO 4DOMA 5HFJA 1LQ2A 5FPQA 1C9NA 3LO5A 5EYPB 2I9PA 3EIFA 4GGMX 2IIQA 3OEHA 2OYSA 5C2JB 4TKMA 1VSBA 4EEXA 3ZX5A 3R41A 4GZ6A 5CM2Z 1IWPB 4EHBA 3AIIA 1U3VA 3IOYA 4HDKA 3RBZA 2P1DA 5C7YA 4IAOA 5BRJA 1PK9A 1YBMA 2MSDB 3H6GA 3RIYA 3VOTA 3ZV4A 1S3FA 2X77A 2Q5QA 3OCWA 1QKKA 2FV8A 3CEAA 4LGCA 4BP3A 821PA 2VH1A 4O0LA 4V38A 3BJMA 3VU3A 1B0PA 1WPXA 3A1UA 1W2HA 3C41J 3H84A 3UXEA 2BCEA 4P92A 4LDNA 1W4AA 2CL5A 2VDMB 4NYIR 2YXNA 4EY8A 1DJQA 5THQA 1JHPA 2RI6A 3L18A 5CDFA 4RVNA 1V3QE 1NQXA 3B3FA 5T64A 1V71A 2ZZKA 3VSCA 3DCJA 2H3HA 3CCCA 3B5JA 5TPZD 2PBRA 2X1LA 4LFAB 4OI1A 1TX4B 3CJTA 3RV4A 1CJUC 2ZE5A 3I09A 3Q85A 1ZQ1A 2W2PA 2DFPA 1F2UB 1FLNA 4JA2A 4PZDA 4BS9A 1AKYA 3GJ3A 5HPYB 1KORA 1QYIA 3QLUC 5JXIA 1FJXA 1E79A 1JMVA 1EFDN 2XVXA 1J9ZA 2BKXA 4DDKA 4UTRA 4DY4A 1N2XA 1II0A 2WICA 3T1TA 5I9SA 3ETDA 3LECA 3SZOA 2GEVA 2X6QA 3TINA 4RM3A 3BMQB 4GWGA 5FULA 4X20B 4UZSA 2J32A 3VPDA 2Q5EA 2E6UX 5KYWB 2QI9C 1LBIA 1KR5A 1YJXA 3SICE 4HUQA 3H9EO 1E1CB 3ID6C 3AHJA 4TXHA 5D3QA 2BLNA 2DFVA 1GFSA 3LY9A 3RUHA 4EFDA 3CKYA 3RV3A 1B41A 1KZYC 2IDJA 3HGQA 5KTYA 1CY0A 4R7TA 5A3VA 1F0PA 3MVEA 3A1DA 3GAFA 1UJBA 2CFTA 3HA7A 3TR5A 2HHHB 3KWJA 4QFBA 2BGKA 2HAEA 2F64A 4RAOA 5CT4A 2Q9AA 3B52X 4LSMA 5L3RA 2PMDA 3DKKA 3MRSA 4FQ5A 4K40A 4MP6A 5GIOE 1E6CA 1Q16A 1JEYB 2KS6A 1ZUD1 2W6ZA 3CZ9A 3TKAA 3VKWA 1K88A 1LRJA 1EDEA 2XNCA 5E8RA 2OXTA 4YRZA 2OGUA 3DW3X 3N58A 4LQ4A 4RFVA 2BM0A 2GF0A 1EZ4A 3R4CA 5B1HA 5K2OA 2D2FA 3SC3A 4L4RA 5JIBA 5LZ4A 2W58A 3Q3VA 1MTOA 3PX7A 5LZ8A 4II7A 3ORHA 4C0WA 3LIPA 3C6YA 1N78A 1F2TA 1SNYA 4FGWA 2ODNA 3C98A 4H60A 1CEQA 1Q91A 4DJ5X 3C39A 2UYCA 2PKQP 4WOPA 1LUAA 1T9HA 3TD2A 3AUYA 4CW7A 3CMMA