4NBLA

Tailoring small molecules for an allosteric site on procaspase-6
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
269
structure length
258
Chain Sequence
AFYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQAARGNQHDVPVIPDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tailoring small molecules for an allosteric site on procaspase-6.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-6
total genus 89
structure length 258
sequence length 269
chains with identical sequence B
ec nomenclature ec 3.4.22.59: Caspase-6.
pdb deposition date 2013-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4nblA00
4JR2A 3DEIA 3GJTA 4NOJA 4PRYA 3KJQA 3UOAB 2AR9A 3GJSA 2QLBA 4JJEA 4IEFB 1SC4A 3KJFA 4JJ8A 2FQQA 3R7SA 3NS7A 1SHJA 4ZVTA 4QTYA 2H5JA 3EDRA 3V3KA 5JFTA 5IAGA 5IAKA 1NMSA 5IBPA 1RWKA 4JR0A 4D3ZA 5IC4A 4NOMA 1PYOA 3SIPA 4EHKA 4IYRA 1I4OA 4QUBA 1RHKA 2QLJA 3R6GA 4JQYA 4N6GA 5IANA 2H5IA 4N5DA 4PRZA 4QUHA 4N7MA 2XYGA 4ZVSA 1SC3A 4QU5A 1SC1A 2J33A 1RHMA 4DCOA 4NOKA 1CP3A 4AWBA 3IBFA 1ICEA 1BMQA 1RWWA 3OD5A 2FUNB 3D6FA 3R7NA 1RWVA 4EHAA 2CDRA 2XYPA 4JR1A 5IAJA 3GJRA 3IBCA 4NBNA 4EHLA 1CVRA 5K20A 2WDPA 5LUBA 4JB8A 4JQZA 1RWXA 4JJ7A 1RHRA 2H4YA 1M72A 4FEAA 4ZVRA 1I3OA 4DCPA 2Y1LA 3BIJA 4N7JA 2C2ZA 1K88A 2J30A 2QL5A 5LU8A 4I1PA 5H0IA 4EJFA 2HBRA 2Y0BA 4D3YA 5LU9A 2FP3A 5IBRA 2XZDA 4DCJA 2H48A 2H4WA 2CNLA 2C2KA 2HBZA 3DEJA 4QUDA 4AWAA 1IBCA 1SHLA 2C1EA 3PCXA 2HBQA 1PAUA 1QTNA 4EHDA 4QUIA 3D6HA 4D3XA 2CJXA 1NMEA 3KJNA 4PS1A 2HBYA 4QULA 5IARA 2C2OA 4QTXA 3V4LA 1I51A 1I4EB 4EHNA 4N6OA 4ZVUA 2QL9A 3H11B 1RHQA 2H65A 5IBCA 1RHJA 3H1PA 5IAEA 2C2MA 1F1JA 3RJMA 2P2CA 2CNOA 3D6MA 3K7EA 3R5KA 2DKOA 2J31A 4I1RA 3DEHA 4QUAA 4HQRA 2J32A 1QDUA 2QLFA 4QU8A 2H54A 4PS0A 1KMCA 1NMQA 2CNNA 3R7BA 2QL7A 2XYHA 3UO8B 1JXQA 4HVAA 4QUGA 1QX3A 1RWMA 5IC6A 3SIRA 1RHUA 4ZVQA 2K7ZA 3ITNA 2H51A 3PD0A 3E4CA 3R5JA 4NBKA 3V55A 4LSZA 3R6LA 4NOLA 4QU9A 4FGUA 5I9TA 4EHFA 1RE1A 3H0EA 3EDQA 4N6NA 4HQ0A 1K86A 5IASA 4M9RA 3V6MA 3S8EA 1RWNA 3GJQA 3PD1A 1GQFA 1NW9B 4QUJA 4ZVPA 3V6LA 4FXOA 4QU0A 2CNKA 4QUEA 3DEKA 4AW9A 3S70A 5I9BA 3H11A 1F9EA 3P4UA 4NBLA 4FDLA 4ZVOA 1GFWA 3NKFA 5IABA 2CJYA 5LUAA 3V4OA 2XZTA 3NR2A 4EHHA 1RWPA 3P45A 2NN3C 3H13A 1RWOA 3QNWA
chains in the Genus database with same CATH superfamily
3P97A 1TECE 3PQ7A 4RHCA 2NVUB 4IIJB 2QRVB 1Y4AE 3ZH2A 1L1EA 5C37A 4TLEA 4XEHA 1KI3A 4MJ3A 3ZE6A 1FXWF 3PF8A 1T4GA 3PUXA 3COWA 4HWTA 4MPJA 3ETNA 3W6NA 2IA5A 4BAUA 2W00A 1W0JD 2OL4A 2FPPA 1BJRE 1VG1A 5FADA 3JYLA 4KR7A 1NXOA 4I2NA 1YR1A 3R6TA 1EZ4A 2NSYA 2Q21A 3TLXA 1ZK2A 2X4DA 3LO8A 2AC7A 4I55F 4TTPA 3ZV4A 4RFVA 5JCJA 1A5BB 1BS1A 2YIJA 3BCHA 3MCZA 3F98A 4ZPJA 4RD3A 3MD9A 5CEJA 1TT7A 3OOEA 4P7KA 4CL8A 3I5AA 1R74A 2OFXA 3W9BA 1ISFA 4OJYA 4R16A 4WJKB 1AB6A 2IF0A 4HLUA 4M8NE 4PY2A 3CVJA 1IM5A 2QJRA 4MDFA 3UG7A 1X14A 1C1YA 3E82A 1VI2A 1LI5A 1MIOA 2CF6A 2BM8A 2YBEA 3D8HA 1ENYA 1MB9A 4BFXA 4JB8A 2WICA 3ZY6A 13PKA 4QPCA 4KWCA 1G41A 1CG6A 1I3OA 3RPEA 4INZA 2IHKA 2Q5QA 5EP1A 2WJAA 4U2BA 3ZS9A 5C5DA 5CLJA 3R5HA 2JIMA 1AKTA 3DP7A 1TD9A 3NHYA 5BN3B 4KRFA 3O8QB 3O90A 1Z5GA 4GS5A 4DVJA 3L8ZA 2P75A 2J59A 4IP0A 4R3WA 2R6ZA 4TSFD 2X8WA 2PLWA 1N9ZA 3WMGA 3BAFA 5HFJA 4D3XA 4XWWA 5F9MA 2XXAB 3FNEA 4XEUA 2QTTA 4HAVA 1DKPA 1NU8A 3OX3A 3A1FA 2QPAA 4G5GA 4RV4A 4CM6A 2BFEA 2H1HA 4FQ8A 4F4JA 5HA5A 1M2EA 4UEKA 3VZCA 4A73A 1KK2A 2AJBA 5K5EA 4OMUA 4M37A 3EQ8A 4CEHB 4L28A 5KOHB 2UZ4A 1K1EA 2PKCA 4YDQA 4JXXA 3FN4A 3WO1A 4XX1A 2PXAA 1Z6QA 3P9YA 4RVHA 4OQYA 4R71A 3B3FA 5CFQA 1QGYA 4Q9KA 4H17A 4MQBA 2AIRA 2YXDA 5AKGA 1PYGA 2EFCB 2HA6A 4HQRA 4EG5A 2BVNA 3NX4A 1KJ9A 1M54A 2HCJB 3LT5A 5G02A 3R3YA 1Z6YA 5EOVA 3MRTA 4D0GA 3H5TA 3WAKA 5E4YA 3OTGA 4NFSA 3ZKWA 4ZCSA 3UWMA 2JKVA 3B85A 4F9EA 4PONA 1K5HA 2MSEB 5HM6A 5FL3A 4M22A 1KP3A 3S2IA 3QOYA 5IAAA 3TN7A 1XRQA 4PYOA 5IJXA 3V6MA 1FJGB 4KFUA 3W2FA 4XDYA 1NVKA 2X2FA 3EC2A 1KSJA 1ZAKA 4FWIB 4ZZ1A 2B5OA 1L9XA 4URUR 3RWBA 5CLHA 2QMQA 3AJAA 5DTQA 4PAWA 1JHDA 4Q4CA 4FW8A 2C0PA 3O4GA 2Z1NA 4KOAA 1QKKA 2W0SA 1MRZA 3I72A 4INAA 3NT4A 5HIJA 3RW9A 3HXPA 4Q47A 1XNGA 3RASA 2J7KA 4B1FA 4BNVA 3ROZA 2X40A 3DB1A 2PGNA 3ESBA 3PDCA 5IT5A 1QTQA 4WKPA 2QN3A 3FXAA 4Q16A 1OJLA 5IZCC 4K26A 4R2MA 1M6NA 4WI1A 1TAQA 1G55A 1MO2A 3I01A 1S1MA 1DIAA 4UTXA 5CIYA 4BXOB 3GLVA 5EJ9A 3VR3D 4RV9A 2DQSA 4XAQA 4BLPA 3SC3A 1NKTA 4ZZ2A 4GR9A 2VHXA 1YA4A 2PO5A 1OXVA 3L92A 2DSNA 2F9MA 4L8VA 1MU0A 5K51A 1W88A 3E84A 4YXFA 2DERA 4JKYA 5ITSA 5HF9A 4D8YA 2D8AA 1L1RA 1RAEA 1O08A 4EKYA 5HG0A 4ZREA 3CBQA 4IQGA 4BBAA 2PSFA 4ZI2A 3EH1A 1WZ2A 4CMCA 1DO0A 4Z9XA 4LZJA 5TQJA 1IOZA 4PSCA 1FVFA 2X9GA 4L6CA 4II3A 1NMZA 5G0WA 2DR2A 4N82A 3B2EA 5E6RB 1Y9AA 1VL6A 2A5JA 2I6GA 3V4PB 3TWOA 1Z8HA 1F8FA 1TADA 5FL7D 3TKLA 3TW8A 1H8HA 2JFZA 5AW2A 2CFTA 2JH3A 1KC1A 1TMKA 4CKWB 4DSZA 1CUHA 2ECOA 2RC6A 4J1TA 1V6AA 2ZR0A 4JMPA 5AOCA 4MIEA 3PS9A 1YB4A 4IUBS 4L4ZA 1ZA1A 2IOQA 1JN0A 2RK3A 3RKUA 4C4PA 1VGRA 1KS2A 1SCDA 2O0LA 3PJRA 4F5ZA 5GJWC 5T4HA 3WGIA 4P4LA 4BJ3A 4E15A 1JG1A 2WSSD 2BFPA 3D8UA 1MV5A 3E1SA 1HBJA 3P9QA 4XJXA 4UVGA 5DW3A 5FA5A 1W73A 3EXFB 2DFKB 2P78A 3T5PA 2LR0A 1OB5A 4OXXA 4I1UA 4BUZA 1BA3A 3FPJA 1N1DA 2IUUA 3U0VA 2A6PA 1FEZA 1H5NA 1SQ5A 2H3HA 2YV5A 3I2KA 1V7PC 1VHQA 4YRQA 1F5NA 1GA6A 4CLRA 1E79D 2ONKA 2XGMA 1HYQA 1LJUA 3E9EA 3K7EA 3TRJA 4DIKA 1PVOA 1ZL2A 1Z6GA 4TUYB 3UB4A 1QE0A 4WNAA 4EI7A 5J47A 1GFIA 1Y5MA 5JWOA 2Q5OA 4DWJA 4EVIA 1B43A 1B6SA 2WEKA 1JG3A 1N3YA 3IR5A 2GCOB 3KSZO 3SZRA 2GEFA 4B8WA 3OIDA 3OM1A 2IJGX 2V7PA 3EGCA 4BLWA 3QE0A 3HB5X 5AW9A 2HF9A 1QHEA 2WKRA 3AVQA 1CQWA 1UMBB 4G9GA 2NG1A 4LGMA 2J3HA 1DJPA 3UB2A 5C34B 3QBVA 2J48A 2XMZA 4QPNA 3FDZB 4KE8A 4MCAA 3TX2A 3VHXA 1V8FA 3MQ4A 3KB8A 3PYMA 1A95A 1VSBA 3JQAD 1PK8A 4MQ6A 5ICMA 3IUBA 1BC5A 3ER8A 3VKUA 5CD9A 5AW0A 3VX3A 4MB2A 1QAOA 2F1IA 4X1YA 4QA9A 3ZZ0A 3IQHX 1MABA 3D0RA 5ALMA 2JG3A 2VF8A 3K2BA 1P2TA 5GONA 4ZC8A 1R64A 2QTVB 2A4KA 2ZRBA 8GPBA 3T3EA 3WL4A 3EZ7A 4G0NA 3RROA 2RAFA 5AM1A 4ARBA 3AVPA 3BILA 3FUXA 5CT8A 1BA2A 2AOUA 2ZSEA 3OE7D 2JHAA 2YOHA 4IFEA 2VDWB 4K28A 5ALQA 5UKDA 4C7JA 1RAGA 5LYJB 4JA2A 4D4KA 1L4LA 4GFDA 2NADA 2HUNA 2Y99A 1GCIA 1MG0A 3MAJA 2PD3A 3TECE 1RJDA 2ORED 4KO8A 4HGPA 4HH1A 3S40A 1CSEE 1FYEA 1HLGA 3GLGE 1FSSA 1C3OA 3EGXB 1A71A 2PD4A 1O4WA 1GEGA 1YBAA 3AR5A 3DOFA 3G59A 3PNLA 4Q93A 5EVJA 5KYYB 4U0KA 4ILEA 1A2QA 3SI7A 1I6WA 1LBIA 4Z3OA 1QLWA 2I7VA 1ZNQO 2W98A 4G5SA 1DAGA 1VHDA 3W8NA 4MV9A 5ELXA 1ZRHA 1G59A 3WIDA 1Q0UA 4NH0A 3S1AA 2VZ8A 1D2GA 1O9BA 4EI9A 3SHFA 3KKPA 4NX2A 1K27A 1SOUA 3ADCA 1OZGA 1L7NA 1M2JA 4RQTA 1QMPA 3NDPA 1TQ2A 2AI3A 4GOLD 4LRWA 1ADFA 3REQA 3BL8A 2ILTA 1XD8A 1Z15A 3RS8A 1P2DA 3TEJA 5HM8A 2IW1A 4PVDA 3EQ7A 1E20A 4R51A 4I1PA 2O7NA 3KKOA 3LC2O 2BKXA 4HJRA 5TARA 3WKBA 1VJRA 2OEPA 1SIBE 3CH7A 1W44A 1BAPA 3H2HA 1PQPA 3KJIA 3KTFA 4Q4HA 4EY3A 4J90A 1UFVA 4PRKA 2QY6A 4EY6A 3KQOA 1W48A 3BIFA 5HYVA 4JUAA 3G2LA 2P6NA 2XGGA 2VUHB 3GUZA 3LI2A 4YAKA 1H1LA 5HBRA 3WLIA 1E5XA 721PA 3K8YA 3HSSA 1SUPA 5IVKA 1XYGA 2H5EA 1XMIA 4UZFA 1XNJA 2PUFA 1RM3A 1A9TA 5ALUA 3VPFA 4FWTA 3B1JA 4ZYUA 3VI4B 4HEA1 1A9ZA 3SS8A 5J63A 1GLVA 5DISB 5A6SB 4DMGA 3B78A 1CZNA 4IDQA 5LOVF 1U8AA 2BM0A 3ZLJA 1Q74A 2Y1FA 2ZULA 2XV1A 2WF5A 1TM5E 3KJEA 1L8AA 2NPOA 1ZM2A 2A7XA 2VKQA 5HTKA 3C7CB 4MARA 1P5RA 2ICAA 3NHBA 3P4XA 4HB0A 2H54A 2WB4A 3EEIA 5CVCA 1CLUA 5K1ZA 2GN4A 4J29A 5JNRA 1U4OA 4EZEA 4LWQA 1AV6A 2GB4A 2DWQA 4JITA 6ABPA 1LQUA 3OQHA 2HHJA 4Q7JB 1G2IA 1RQGA 5FNZA 1KVRA 2J1LA 1JEAA 1EH5A 3Q0IA 4OM8A 1M1UA 3TFQA 1ESNA 4ALKA 1VB5A 3D3QA 3CT4A 2E4UA 5L4NA 3ZE7A 9GPBA 3AVTA 3RKSA 3VHRA 4ABTA 1PLJA 3ANYB 2W6ID 3BH0A 3RVLA 1NOKA 2O2GA 2QTMA 4DUPA 3JY6A 5B6PA 2E4XA 4IF6A 1ZJ5A 2HLNA 4M9CA 3VNSA 1YE8A 1ULTA 3HB0A 2ZTUA 4M60A 4LOIA 1ZJYA 4IDCA 4K86A 5EY5B 3ELWA 1DJNA 3L3BA 4O2BB 3UWDA 5HS4A 5IYZA 1J00A 4YMLA 2Q3BA 4ND8B 1OFGA 1NN5A 1IHOA 1OKKD 5DBGA 1M76A 1LUAA 1HURA 2BCJQ 1EXMA 3ZGYA 1QRRA 2ZRGA 3ONDA 4RJKA 2O3SA 2Z4TA 4Y2YA 2UUOA 5COQA 1V16A 3BGVA 3N76A 4FX2A 4IYRA 3V7YA 1QHFA 2VVTA 3M1LA 1GXSA 4QC2A 2YFYA 1Z25A 3OZCA 1JH9A 5IUKC 1EJ0A 4GWLA 3L6CA 5AP9A 3HY4A 2DHRA 2AGVA 2PPLA 4PWZA 3FFBA 1IAVA 1M34B 3O03A 3JWEA 3WOVA 3H3XA 1JJVA 3DH0A 2GAIA 3ZHTA 4L8FA 4Q4DA 2GBPA 3VC7A 4D74A 1QP0A 3GUYA 4LKRA 4PSKA 1Q16A 1X1EA 3DMFA 3FOCA 4AJEA 4BRUA 5H81A 3SZGA 1VYTA 4F3RA 5JXJA 2NZXA 5IMBA 5KQSA 5FR1A 4L3OA 1VECA 4HLDA 4RYDA 3S6JA 3ASZA 3L0YA 4PHFA 5BV8A 2YYYA 1JW9B 2QTRA 2Y0BA 4XB1A 2ETXA 3CRW1 4C0JA 2JLXA 1Z88A 2WF6A 4KNWA 1CF2O 4MJXA 5AW7A 3BORA 2Q4OA 1Q44A 2X0IA 3G7SA 3P2EA 1CVIA 3WGTA 1W29A 3G02A 2ZAMA 3VHQA 3ONVA 4WRRA 3HS3A 3DTYA 4M0MA 2O2HA 1ZHFA 1NW5A 3HL0A 3A26A 4MWEA 2ZJ0A 3L7KA 3D1JA 4UOQA 1XCLA 2QRQA 1MAWA 3DVAA 2DPHA 2H4HA 2XMDA 3F8WA 3GGSA 4H08A 5HF8A 2E9SA 3SBDA 1QQBA 3H11B 2F1JA 1XK7A 4Q9HA 1U9IA 1BN7A 2CK3A 5IBCA 3ZWMA 4CEIB 5JFOA 3MCUA 3QUBA 4KPUA 5KCMA 3HGTA 1B23P 3AKZA 3OD1A 1PLLA 1R3DA 1R0KA 5AHOA 3U1TA 3G0DA 4ACAA 3AUUA 3CHYA 1IPFA 2A0YA 2PL9A 5IDQA 3JQDA 4UMFA 4O2BA 1QDUA 2VP4A 1I2AA 1KETA 1QCYA 5DNVA 2OVFA 3PSHA 3M2TA 1LX6A 1MV8A 2AVDA 3RT7A 4KYVA 4X6LA 2W2KA 5DI3A 3OIFA 5FO1A 4BQEA 3SQLA 3NT5A 1OJ7A 1KYQA 1PT8A 3JCZA 3GZTB 3U3DA 2JEYA 4OJQA 1FVXA 1HMPA 3V32A 4YV0A 1Z2EA 1NBWB 1TRHA 1XRJA 1E2UA 1SVUA 1P9OA 5LA6A 1AD2A 4I81A 3JATA 4M86A 1E62A 3AIIA 1NTRA 1R0CA 1VFPA 1UDAA 2IGBA 2WJIA 3C15C 1EDDA 2DOKA 4XCVA 2V4UA 5DWQA 2IDKA 1RRPA 3DVSX 4HDKB 1A9SA 1OYVA 1BU8A 2XNCA 2XODA 2VA9A 3OE7A 1T29A 2YCBA 2DFTA 3VHLB 4HY3A 2B83A 5DYWA 2X9NA 4X7BA 4ZZ3A 1SVWA 1Y8ZA 1XXHB 3NJRA 3QJYA 4XARA 2ZM5A 3NB0A 5K6AA 4M6WB 2GK4A 4EB6A 5FUMA 2R11A 2D0DA 3MBKA 4YJ3F 3SF8B 3P4YA 1YR9A 5HRUA 1LQ2A 1IY9A 1BNCA 2ZBFA 2JIPA 3WDMA 3AR2A 2AJTA 5KVQA 3GPBA 4LBVA 5TRTA 4F5DA 2AWOA 2YZMA 4LCJA 3INRA 4MDEA 1B26A 3NVDA 5IAGA 3HU5A 5DLPA 1VE3A 4OQQA 4GVPA 4ZARA 5FLEX 1KH3A 4ITUA 7MHTA 1VE9A 3MRVA 5EJ6A 2GASA 1A9XB 5DYTA 2WJPA 2OZPA 2YQ4A 1WHTB 4LXGA 1I4DD 2PXHA 3FYUB 2IW3A 4OI1A 1PJ4A 3H83A 2WAXA 5LJIA 4H7PA 3CRQA 2OCYC 1GAEO 1KS9A 2RSLA 3OZTA 4NBVA 1NVWQ 1DIOB 2ZI9A 2A67A 4I7EA 4IHAA 4YRTA 1AUVA 4EBBA 1NWCA 3FCAA 4L76A 4QYTA 3WI7A 4BRWA 1WDLA 1DZIA 3AEXA 3G17A 4JK3A 4N5NA 5ARBA 5CGZA 1I5OA 4QEKA 2C5EA 4JLOA 3T38A 5E6SB 2FRXA 2PA3A 5K0EA 2OP0A 2YWCA 2NT4A 1AKYA 2V3WA 1TT5A 5FAXA 3DEYX 3RJTA 2E5WA 3DUFA 1H5UA 3ENWA 2YCLA 4QGBA 3NBXX 2P2GA 3NVAA 1RKQA 3HXLA 4ZGBA 4WN9B 3QTLA 3IBTA 5JQGA 1C8BA 3R7LA 3BOSA 4CMJA 1WPGA 3W6PA 2DFVA 4IGFA 3K6SB 2O06A 2PEYA 1ZCJA 2R1VB 3IR6A 1Z33A 2BOVA 1QM5A 3O2NA 1XHEA 4MRVA 4BX0A 1Y8RB 4UDOA 5DT2A 1RPZA 1I51A 2IEYA 1U7ZA 2F1RA 5BV7A 2EFJA 3CLUD 1A88A 3PT5A 1Y5LA 4NPCA 1BHSA 1I0LA 3F96A 3RC7A 3B36A 2C2MA 3CPSA 5DF1A 3HCBA 2WU1A 4AXXA 5C8YF 4LHVA 1BW9B 4AJJA 3QNMA 1SM4A 1GL7A 1E0JA 4B7CA 1TVEA 4BVBA 1TEHA 1N0WA 2M9MA 2RK4A 2A5FA 2ZLBA 3SHQA 3ZGLA 4FSXA 3GRRA 1ZW1A 2O5CA 4MV1A 1EX9A 4LCEA 1UBEA 1TZ2A 1QYDA 2C3OA 2YMLA 2CNNA 3O9VA 4RVUA 1E4EA 5A6VA 4CKZA 1QRSA 2ZT5A 1Z2DA 3EVDA 2BMEA 3N3AC 1NURA 1RCTE 3DVAB 3BIWA 3M3PA 4LFCB 4BTVA 2SKEA 1KOLA 4DIOA 1PT6A 1YZQA 1KRWA 1DO8A 1G1AA 1L3CA 2Q3LA 3A14A 4X92A 1X7WA 1AMNA 4U02A 1ZONA 4B3BA 4MKHA 1FW6A 1NLUA 1U1DA 4FDTA 4OK5A 5EEHA 3V6LA 3VR2D 1YS4A 2Q5LA 3A6EA 1NYLA 3OOSA 4YI5A 3MERA 4RMNA 1ZUNA 1O6CA 3GL9A 3I5MA 5TT0A 5HKAA 1CE8B 1YCFA 4V3CA 1JFFB 1TI7A 3R76A 3W5DA 3TGWA 4LHSA 5KAPA 1MKYA 2VS1A 2BJVA 1E5LA 1T9BA 3A4NA 4KXUA 5AO9A 5LM3A 2PWZA 3CSDA 1TZBA 3EXAA 4FFMA 4U3JB 1TMYA 3K5IA 1E4EB 2C5AA 1X77A 2X3UA 5CCBA 1EVEA 4XH9B 2J07A 2PGOA 1JQLB 4FONA 5IZ4A 5TGTA 3ZHZA 1M75A 3D8SA 2JATA 2QU8A 3QPBA 4B6GA 2D4HA 3KE9A 1FMJA 1Z6ZA 1US8B 2B4AA 2NZYA 2YFKA 4BV9A 3I1IA 4WZ6A 1AQLA 2EXXA 1VE5A 3FNFA 1N6OA 3N6VA 4FBGA 3ZBPA 4BLUA 2XEDA 3GVHA 2O0JA 4PO3X 3QV1A 1R8QA 2HWXA 1X7ZA 2Y66A 4CQNA 3VDXA 2REBA 3KXIA 1EFCA 4HRXA 1ANKA 3T52A 3NAQA 5BW5A 4J16A 2X9VA 5EA2A 4YXWA 4C7KA 3IQWA 1YVDA 2I8LA 1SVIA 4KLAA 1GZVA 2B4TO 1QE5A 3BPSA 2GNOA 4W82A 3B1KA 5LDDC 3W06A 4PPYA 2P6PA 3KLMX 4HRAA 4TMVA 5I4CA 1WQ4A 2AZTA 2C42A 3C3BA 5JJBA 5KTMA 4DGQA 5DH9A 5DEIA 3ETEA 4ZEMA 4KQWA 4RJJA 1THTA 1F6WA 4W99A 4O8ZA 1MGPA 1UEXC 2IV7A 1E7YA 4KI0A 3L0OA 4FEEA 5FULA 4TQUS 5LU8A 1ZMBA 5K01A 4KXMA 3OF5A 1AC5A 1KI7A 3AUFA 3GRFA 3NU1A 4MW1A 3B6MA 1GYQA 2HWYA 3AVXA 1Y1RA 2WD7A 5ANRB 5JH7A 4WK0B 4PFKA 5ARCA 1FLNA 3FOBA 1PJ2A 5JAUA 1IIBA 4J0DA 1XNRB 2JFXA 5L53A 3C3XA 4GPD1 4RABA 4WEQA 2JGJA 3BD6A 2FRVA 1FMFA 2Z9DA 1SIOA 3WB0A 2WHPA 2D6FA 2QKYA 3LFUA 5IARA 5C8VA 3Q3EA 3U3XA 3QVVA 3L6BA 5JE8A 2VK4A 2X3FA 1AMOA 2C61A 3ITKA 3CJTA 3PA6A 4QJ3A 1WXXA 1GGNA 2D00A 3BQ9A 3G68A 4RZIA 4YY3B 3IODA 3WB2A 2PWYA 3HR8A 2FW6A 2UYGA 3GRPA 3GIDA 2FY8A 3LX4A 1LPSA 2YFHA 3N2KA 3K1AA 4MGZR 1DT3A 1TLTA 4Y2QA 3CNBA 1U1CA 3M33A 3OFSA 4B7AA 1H4SA 2NZ8A 1AVTA 3BWEA 1CBUA 4PLCA 4Y30A 1U0JA 3KKEA 2ZCVA 3B5JA 1KOJA 4BVEA 1L4FA 2BZGA 4FMPA 4W9RA 3FE2A 5ER9A 5FYQA 4CMKA 4ND5A 3RGGA 3HA2A 4U00A 3GDHA 1KMCA 4XYEA 1ZM9A 1N2SA 4GH5A 1VQ1A 3O7MA 3UAYA 3W7VA 1I4LD 2R6DA 4LW8A 1NI5A 4IL5A 5LJLA 2HEGA 1H8HD 4F8EA 5FBZA 4UNSA 4PR3A 1T1IA 4ATNA 2Y05A 4LX8A 2DPXA 1L9KA 4RJIA 2VF5X 1K6JA 2WM9B 4KXQA 4QPZA 4GZ6A 3NTVA 5DYYA 3KAKA 1O94D 1GL9B 4NNOA 4EPVA 3BEOA 2QN9A 3VGPA 3FMPB 1TW2A 5JZSA 1DC7A 1QXSA 4RK6A 1JQJC 3O82A 1MQ9A 1FQJA 5AXAA 4DA6A 5AVWA 4P31A 3BGOS 3W3AH 2RHOA 2O8VA 4JLDA 4RHFA 4ZN6A 1BH6A 4ZCQA 5HKBA 3A4YA 1IHUA 4R54A 1E9VA 2P4QA 4C7XA 2X5NA 1KDTA 4DLSA 2OGWA 5FPPA 1KO4A 1R3UA 2HCBA 5C81A 2HKIA 1AGXA 1ZGAA 1VPVA 3H13A 4R6WA 5D7BA 1RJ9A 1VJ5A 2JJ2D 3CRVA 4X1KA 1QK5A 2FMFA 2JI4A 5FPYA 2Z2YA 4H6PA 2PGAA 1G3MA 3LUPA 4HDCA 4MR7A 2FW0A 3KPWA 3PR1A 4IMJB 3SE0A 4LNAA 5JAMA 5H4HA 3S2ZA 1ONPA 1P7CA 2ZUWA 3HKBB 1XRRA 3JZDA 3Q8XB 4WEOA 3BICA 4FGJA 1GPMA 4AKTA 4B8YA 1G21E 1K9VF 3LUBA 5AW5A 3WGUA 1VXOA 1HO3A 4M7PA 3X1ZA 5BOSA 3W34A 3DGFC 3IUMA 1MX9A 3KZXA 4BZQA 1DBRA 1DDGA 2XGOA 3KZ1E 2GJAA 3UAZA 3NBYC 1YC5A 1T1GA 1MOZA 1U2TA 3ERCA 1ZK0A 4OY3A 4DZRA 3ZXSA 1RJFA 3DAGA 4KNVA 2G9UA 4B85A 5CDGA 4Y7CA 3F5QA 5FO0A 2MINB 4PO1A 4XFDA 3DE6X 1BFKA 3EDYA 3L6OO 4FWBA 1FE8A 1E2HA 2PCLA 2WUDA 1B16A 2Y4NA 3ESXA 3OIWA 4YQZA 3KQMA 1KP9A 1RWXA 2WZQA 2ZQ5A 5G4KB 2JIZA 4G0MA 3U7GA 4PYJA 4FEAA 1RPJA 2Q6TA 3L0BA 5JAZA 4YCCA 1U2PA 1Z6TA 3MCWA 3GLFE 3HXQA 4U2EA 3CVYA 2FWJA 1T3ZA 3OT1B 3WAJA 4I9UA 1JFSA 3K0AA 2Q99A 2FP3A 2IXBA 2GT1A 4G1FA 1VYUA 1Q0TA 4E4RA 1U0GA 1K06A 4QQNA 5CT6A 3MLBA 4RGVA 1U7PA 2PH3A 2POCA 3HKBA 3P96A 4YI3A 3GFSA 4B3JA 2ZCJA 4OGKA 2V5AA 1ZD9A 3T0FA 3FB1A 4N5MA 1XF9A 3VV3A 1DKNA 1GPAA 4LNHA 2WQZA 2VTVA 4DZZA 1OGYA 1EG7A 4MGIR 2XCLA 1F6DA 1VBKA 1L5QA 4L8WB 2PMBA 1M2GA 3WGOA 5CEFA 4P35A 3SYMA 4LG1A 1M1YA 2BR5A 4FHGA 5KDLA 4K9LA 4MWTA 1NN3A 2FX3A 5BO5A 2LVBA 3EYAA 1NXTA 1LY1A 4B6SA 1QR6A 5C1OA 4ERNA 5FEMA 2VZLA 1DS6A 4FOPA 3ILSA 5H80A 2W2PA 3OZEA 4KQEA 3ST7A 5EIWA 1JNXX 3C97A 4JBIA 1A8PA 5IKEA 3OCYA 5DSTA 1NASA 1EX7A 1HKHA 2R87A 3A25A 3NNDA 5J2TA 2ZZMA 9ATCA 4OJKA 4YMHA 2NXJA 4YJKA 4O0LA 3RS3A 1XJ5A 2BKVA 4QU9A 3VDQA 1D09A 4MV4A 5EKUA 2IDMA 2W9XA 3FB4A 1VMAA 1SK9A 2Q28A 5DCYA 2H52A 3BE5A 1DIHA 4HQ0A 2HU2A 4CFYA 1Z2NX 4QVIA 5K0JA 1I13A 2GCPA 2NZJA 3FUWA 1DSSG 2VATA 5D1NA 1V47A 2R4UA 2Y1EA 1WSBA 2ZIXA 3PEFA 2QSZA 2WYUA 1TC2A 2VAVA 5TQ0B 4RANA 1A8IA 3B1XA 4MMXB 4KQ9A 4M38A 1TJ4A 4HXFB 4EVRA 4DS3A 3IMFA 3TLEA 2RBKA 3TKYA 4GMGA 1XEXB 3ICVA 3GDOA 2KPOA 1XDBA 1ZH0A 4RU1A 3D7LA 5DTRA 4MS1A 3PQ5A 3IAM6 5CYFA 5FIUA 3QM1A 2G1UA 3KJXA 4O4HB 5AJHA 2NU9A 2MCFA 1QO9A 2A5YB 2BYTA 2GZHA 3D4BA 4X1OA 1RXEA 4D3ZA 4MYSA 3HA3A 3VHXB 2PANA 5LQKA 5IDVA 1YQ9A 4E2WA 4EZBA 2J3DA 3FW1A 3JVIA 4IJMA 5D2CA 4X20A 3D3KA 3VR0A 3ULKA 3WVNA 3EVCA 1NJ1A 1G291 1E3IA 4Z9YA 3RKRA 3L4BA 2Q5CA 3L7LA 4RPIA 3J81A 1RLIA 5EJFA 1RBZA 4GSKA 3ZDXB 1H2YA 3PL5A 2Y9MB 4EI2A 5CYGA 3IT3A 2OC9A 5ECWA 5AVQA 3CZ5A 2EDAA 2I03A 3IRUA 4L16A 4LZNA 4BP8A 4UAUA 4EYEA 2VF4X 1N57A 3ICCA 3HCRA 3PFKA 4DKJA 1GADO 4PYRA 4E07A 5J59A 1GSIA 3WKEA 3FYTA 2R7KA 5DHPA 1CY6A 3DKIA 1PNRA 1A77A 1USGA 1GP2A 1HDOA 3OP4A 4NHEA 2WF8A 1TC1A 2PGXA 1FU7A 5LLSA 3ZIAD 2WAMA 2O4CA 5B53A 2NU7A 1YKSA 2WAOA 4EF4A 3BWBA 2VK2A 2GFHA 3JW8A 1U28C 4KMOA 2GOYA 1FUUA 4CM9D 3B9PA 3QF4B 3H8VA 4CT4B 3AUTA 5DFAA 2D0PB 5H3LA 4PC7A 2X0KA 3C3KA 3CBGA 2XB8A 1ODIA 2CXTA 2IYXA 4ZO6A 1M0SA 5KHOC 3OZGA 3TOVA 3OKPA 5JMTA 3AIMA 2ZAYA 3MUFA 5LVAA 1L4MA 4GOND 4AZTA 3CNNA 4XVUA 1EK5A 1CF9A 4R7ZA 4UVIA 4C6TB 1T3GA 3PK0A 1THMA 4H9GA 4PAMA 3KQKA 4DR4B 1ZUNB 1JZSA 4PZAA 2C92A 5ALJA 2CJWB 3DDUA 4OQFA 5K3SA 3RJMA 1U0RA 5MF6A 4G24A 2B30A 1Z37A 3DKRA 2MDTA 2WTAA 1P81A 3H84A 1NBIA 5AK4A 5G1PA 3Q2OA 4URXR 3VV2A 1Y6JA 5KC8A 4Z0NA 3QIAA 2RG7A 1DAHA 2YOFA 3DQQA 4LA4A 3C1AA 4XUCA 3ZK7A 5K0BA 4DUYB 4PG6A 2QX8A 2ZRJA 4RCZA 1YE3A 2I33A 1Q2XA 1T5LA 4G0XA 4YASA 1EDOA 3ITNA 4MS4A 1D0IA 5D7NA 4D9CA 3UG6A 2Q45A 2HY7A 2OKGA 5B57C 4GX1A 3H0EA 1G98A 2Z57A 1UJ5A 1DAEA 3KZVA 1BKDR 1MA0A 5EFOA 2GWHA 2NU6A 3QVWA 5C80A 1U2EA 3IAEA 2ZRHA 4UEJA 2W11A 1O94A 4DXDA 1U5BA 2I76A 2WFAA 3P4UA 1P7YA 5A4AA 3JD2A 2ZWAA 2B7LA 4AS2A 3W3AA 3UUGA 1UP6A 1WE2A 1PHPA 4X1IB 4BJHB 4AKEA 2E87A 2Z6AA 1GT91 1U99A 2AEEA 3KKNA 2C83A 1HSZA 2ZJZA 1OSNA 4P4TA 1KE2A 5JDIC 2X8JA 1P1HA 1UMBA 2O1SA 1C30B 4B6FA 2WV7A 4EL0A 5E4TA 4EEKA 1EP9A 2PJDA 3RBAA 1PG0A 3MTDA 4JEUA 1BX1A 2HN9A 4M89A 4P36A 3A7EA 2HA5A 2ZPUA 5HCNA 1TU3A 2HSEA 1R10A 2XE7A 1KL7A 2H5IA 1CP2A 1JIUA 1RTTA 3IESA 3N2IA 4NATA 4Y2TA 5L6MB 2QUAA 3DW1X 4Q12A 4RIGA 4CV0A 3ZDFA 2YXNA 2ZSAA 2R8ZA 2VP2A 1P3JA 1NLMA 3IVGA 4WECA 4DCMA 1KWGA 4G9EA 1DV1A 1E9DA 4GOXA 1N6RA 2P69A 4GKKB 3IKLA 4LFAB 3S99A 3SAJA 4E88A 5FI5A 4X84A 3A4LA 4OHXA 4X91A 1HFKA 1Z5UA 3NDBB 3SC2B 2AI1A 2O3RA 1C41A 2WKQA 3EVAA 5SICE 1GCAA 3UQYS 3AXTA 5LOVA 1TYEB 2PKEA 2Q0SA 5DX8A 5KVVA 3WGYA 3DJFA 3Q6MA 4DEYA 4DRZA 3ZY4A 3I37X 1J2YA 4BEBA 1C9YA 2BT4A 3DE0X 4NYJQ 4G85A 1JQBA 3UWKA 1NF9A 1OQAA 2J0UB 3VPGA 1I6LA 3ZY5A 4PN7A 4I50B 1RI5A 1A9XA 1EFVA 1E3QA 5HKOA 3W79A 4F1KA 4BMYA 4YX9A 3PFNA 4RHXA 3ANMA 1X1RA 3LD9A 4AN0A 3FKSA 4P6VF 4AKHA 4W8GA 4BZXA 3TEFA 2NIPA 2D59A 1N6PA 5IVDA 3DW3X 4CTKA 3D6VA 2I80A 1WXQA 4H7KA 2DE0X 2XQGA 4GVXA 2R60A 4HGRA 4IIDA 4TSRA 4HFJA 1W25A 4JLPA 1LFAA 3OKFA 1XX6A 1B4DA 1V71A 3KALA 2EKDA 3TCNA 1X7DA 4ND3A 1PJCA 4QYIB 3R5KA 1VCOA 4KTTE 3RS0A 2WJJA 1V1JA 3DBHA 3WRWA 1GKKA 1SRQA 4UTOA 4YNBA 4A0HA 1XKTA 3QA9A 2YJNA 3A6DA 3EZ6A 1II8A 2CDBA 2XUFA 1T34A 3QXGA 3WSWA 3ZGXA 4YMGA 4QBHA 2WUWE 3H9UA 4WCFC 1XEAA 4WCDA 3RYCB 1GR0A 1QDLB 3G5MA 3H5AA 3NWPA 3UW3A 1Z4PX 2F43B 2QY9A 3BSWA 3FLBA 5BOSB 1Y9JA 1FC0A 6AT1A 2KBFA 2NYAA 3D7NA 4HGOA 1ADCA 1RABA 2AFHA 3HJRA 5FFMA 3VUFA 2FFAA 4B8ZA 4LTNA 3H04A 3TB6A 2E18A 4UM8B 4DE5A 3U60B 1V16B 3TR0A 4P32A 1EVKA 2CFRA 1GCOA 2CXSA 5I7FA 1I7SB 4KQ2A 1M1YB 2PAFA 4MUNA 1GAXA 1L7PA 1GQRA 1JQAA 2EWMA 5CVDA 2DWCA 4E5YA 3AY3A 4IIHA 3ZHQA 4EITA 4P4SA 4PHGA 4DMRA 2V6FA 5LUAA 3SNKA 4BFLA 1J90A 3DOEA 1ATZA 4NJMA 1N33B 1E59A 4XD2A 4NE2A 5DX1A 3LT4A 4CN9A 3AUSA 4MZDA 4IFBA 3ANSA 1MFZA 2H9YA 2UZ1A 2WT4A 2W6MA 4C0AC 5BSVA 3CRNA 2W8BA 3X0DA 3SXUA 3THRA 1J5EB 2V6MA 4MS3A 3IMEA 2MYPA 4MWOA 1R6TA 1WDMA 3M2PA 4PGFA 5BYKA 4TZ6A 3QVGB 1Q19A 1TZMA 2HUPA 1Y42X 3MSCA 4OGLA 1OZHA 1SGWA 1HG1A 2ZYHA 3KQPA 3HUDA 3WTCA 5F7XA 2BMDA 2NO7A 1OFTA 2AN1A 2OXTA 1K89A 1CY8A 4KH0A 1CLEA 2YASA 1C9EA 1Y5NA 3DNPA 2AUTA 4ML3A 3PFFA 4W8HA 1E3SA 4AP6A 5KPDA 1ZFNA 3TR6A 4F04A 4RTNA 3ESAA 1IQPA 3ICQB 1Z28A 2YWJA 3LTEA 4XD7A 5BSHA 4AKSA 5DLEA 4RY8A 4EY7A 2WWVD 4TTAA 4YMTA 5JSZA 5JZ9A 2F8SA 1N78A 4KVFA 2WHXA 5AJUA 4ZIRB 1FTNA 1ND6A 2FPGA 3JWIA 4L5AA 1TW3A 1WOMA 2I3GA 1GTRA 4IW3B 3DVLA 3IQXA 1HNWB 3U26A 1XELA 3GWGA 5K0NA 4IIJF 3C87A 3LDGA 4JC0A 5BT9A 2C7PA 4ICIA 5KNBH 2ZJAA 2ZIFA 1K8XB 2DH6A 1Q0QA 2NM0A 1UBKS 2QN6A 4FQ5A 3Q7QA 1GTMA 1ZCFA 1D1TA 4JBNA 1WMEA 3FR7A 4IIBA 5AVUA 4ZI5A 3GYGA 3I5XA 2HBQA 1H65A 1TJPB 4LJSA 4OI4A 3JU3A 5T4FA 1GYRA 2XTJA 5HBGA 3AEQA 5CTJA 3T4PA 3TE7A 3V1KA 3G7NA 4AS1A 3BFVA 4DT1A 2I2AA 2YVKA 3QTBA 4KTVE 3OMXA 3ZWBA 1GGEA 4UQOA 2KJQA 2IYUA 1M2HA 3OHMA 1JHMA 1B74A 3D9QX 4N6OA 2KLHA 1DRWA 2ZWPA 4GBMA 3WGZA 2JGLA 3X3HA 4Z53A 4FGKA 4ZAZA 1N34B 1FSGA 1XZDA 1YHYA 3KEFA 3EPJA 4G0WA 2HJRA 3VC3A 1YQDA 2QAGC 1ZD3A 3MWDA 1JYSA 3PHGA 6Q21A 1JPNA 3PXDA 1XZBA 4ENSA 1TYAE 3BTUA 1J99A 1TMOA 2WIDA 4XTRA 3RODA 4OP2A 3B20A 2C2BA 2C95A 3B9QA 5TGZA 5HOQA 4QJBA 4CTJA 3SHOA 4YMWA 3P8ZA 3AG5A 3OZAA 4XWTA 1N36B 1H6DA 3E7WA 4YO8A 2ONZA 1H6BA 2GCEA 2R6R1 2VDOB 3MSXA 3OI7A 3W6UA 3PJGA 3EIQA 1UJNA 4UE3S 4DN6A 2OQ2A 5IXJA 2PS9A 3IAUA 1XCMA 2ZE5A 2I2DA 5SZKB 1TCCA 1ZGGA 1AA6A 1I10A 2GPJA 3AY7A 2WSSA 2XE8A 2GZMA 4LVNA 1NJSA 2CXHA 1IN7A 3H05A 3N2KB 4RK5A 4XJSA 3TNYA 1P2GA 4MCHA 1NLZA 1G38A 1AO3A 3PU6A 1YVRA 3GUHA 2CNKA 3WLOA 4DCNA 1AS3A 3FF4A 1GJRA 1MXHA 1U81A 2XWJI 4KE6A 2J9RA 4NESA 4I5FA 3CLVA 2X2EA 3OCVA 5HZKA 3ZV5A 3FYHA 1KTVA 4M1EA 3W3AD 3HABA 3GLGB 2YICA 3BX1A 1WLSA 1OI2A 1MB2A 4ZI7A 3E1GA 3E5MA 4O5OA 4OFBA 3QEKA 1MABB 2FPLA 3DXZA 4LWOA 2Z9BA 3MWYW 4IIEA 4OKSA 2O54A 3E70C 3QX3A 3SY8A 1RPTA 2PRZA 4G67A 4OU4A 1AZWA 3X1YA 3KT6A 5JS2A 5DV9A 1ODFA 1V8BA 4B84A 3C7DB 1MJNA 2CVQA 4B71A 4RW0A 1TPYA 4DLAA 3ZDAA 4FC6A 3WZMA 2QTAA 3K09A 3OA0A 4Y2VA 2WVJA 4DLUA 4KSCA 5DGIA 1KPGA 4A26A 3GARA 3H5VA 4BASA 2QJFA 2DXIA 1QQ6A 3KLOA 3PLNA 2EX0A 1NW7A 1Y6ZA 4QE3A 4RJ2A 3PUHA 1K8ZB 2C20A 3I1JA 3VR4H 4AF8A 2CL7X 1JZQA 1N7JA 1CJUC 2GXQA 2J0EA 2P6MA 2XAAA 4YR7A 4B82A 2P0YA 5I51A 4BP1A 2GSWA 4C43A 3VYTB 5CXQA 4V1CB 3LQRA 1G21A 4BB0A 3IBCA 4NBNA 4RKEA 4LJYA 3KZNA 1II9A 3KLBA 3WGGA 1JBKA 2UXDB 3PB3A 3JZIA 1LDNA 4E1BA 3QEAZ 4HFMA 3A6PC 3S7ZA 2EWVA 1AV7A 3I9NA 1Q1EA 4IOKA 2PMFA 3GP8A 3LK6A 4BVHA 1NQVA 3JQAB 4X6XA 1TM3E 5IKXA 1EXNA 3PNVA 1OI7A 3DDNA 3I9V6 5ADWA 4MLPA 4TV8A 1KDOA 3R1IA 4Y8VA 1VLMA 1KXZA 1KI9A 2GJ9A 4H27A 3A1NA 4F6LA 3SJZA 4F2PA 1FJHA 4LJ8A 4MW9A 3DNFA 3K32A 4RZ3A 2AEJA 4GIBA 3GFRA 4UTNA 4BX3A 4YJFA 4N49A 3F73A 1GU0A 2FEXA 1JXOA 2YNMA 1GA4A 4L0MA 5EJ2A 2B99A 1JAZA 1MQAA 3B6ZA 2JLAA 121PA 4LHEA 4ER6A 5A2GA 5A1JA 2JAQA 3K8ZA 3R7AA 2IH5A 3TOXA 4J3JA 4JB0A 1OOEA 4NECA 5F3WB 4QEDA 2ZJ8A 3OFKA 1EQAA 1EX1A 4C21A 4DBZA 5A9RA 1XZAA 1Q1QA 3B1WA 3IDAA 1F1JA 1LW7A 3ITEA 1SUCA 3WLQA 4ZCRA 5IHXA 2ZJ6A 2FDRA 2EZ8A 4LOLA 4RPHA 1UJCA 1ZSNA 4DZTA 1HORA 3SN6A 1JEEA 4RXMA 1ZNXA 3DAPA 5ALFA 3USZA 1B1AA 1UXGA 1CYDA 2RDMA 3HZRA 5I8PA 4KQMA 3I62A 4LJ4A 5CHYA 4IG9A 5HJ5A 4CKCB 2GAOA 1G6HA 1M1ZA 3TL2A 3OZ7A 1CTQA 4MVYA 4OB8A 3W8EA 1UMCB 4CETA 3H9JA 2SBTA 4AWXA 3DBRB 4KBGA 3RSLA 4BFCA 3WDKA 3IHTA 3LV8A 3R6LA 2A3RA 3K15A 5I9TA 4NNJA 1XTJA 3IPXA 5FBRB 1BVRA 1KYZA 2WFLA 2GXAA 5E7QA 1GSHA 3AYZB 4OHVA 5FI3A 5AUNB 1B8OA 2YH2A 3DZGA 5LKRA 4QUJA 2ZSJA 3ICPA 3CC8A 5ILQA 1Z4LA 5JYCA 4LF9B 1UAYA 3TZHA 5CK4A 5SZIA 4CQMD 1BQ3A 2G6BA 4LDAA 2ZG6A 3DBHB 3PFWO 3T7RA 1O4VA 3FETA 2OCGA 5G2OA 5MN6A 1PK9A 5IWCA 1F8UA 4DKXA 2VCYA 2Y1XA 4EZIA 4J6FA 5DNUA 2RARA 1Y3CE 3AEKB 1AK2A 3AL3A 3KOWA 4BLTA 1PGPA 1PEKE 4BTLA 1ECGA 5DM1A 3CNEA 1Z7BA 1GPNA 5KJFA 3B6EA 1JTVA 1U1EA 3AKYA 4Q7LA 1M2OA 1BEZA 3RQSA 2QPTA 2Q3CA 1E89A 5BR8B 1USVA 3RYHB 1SBYA 3JASB 2OT3B 2DLDA 1JG7A 4XGIA 4POAA 2GLUA 3KV3O 3JSXA 5H3CA 1E5VA 4DM4A 1IZ0A 1AS2A 1QR2A 1YRBA 2P11A 1L8QA 3CF6R 3DAOA 2C4TA 4FSDA 4PZYA 3GMSA 1THZA 2A59A 4CU5A 1EBBA 3CX7A 3OJFA 4U4AA 3D0OA 5FQOA 1HPLA 4BNYA 2BGKA 2X13A 3RU2A 1RZUA 4WTOA 4EGFA 3W5IA 3N8GA 3VTAA 2GPBA 4Z51A 3KOYA 4ZTUB 3BHNA 3TTVA 2HLHA 1WDTA 3PUIA 4XJVA 5LQRA 3KDSE 3WGLA 2X6RA 2NV2B 4XD7D 1PDOA 5E2IA 1FDWA 5BUQA 3GOQA 2Z56A 3NYIA 4P7BA 5JOQA 4P86A 3L1KA 2H18A 4AUKA 5A3JA 4AB1A 5CM8B 2J7PD 4JIMA 4YDHB 3WGVA 2FN8A 4D6XA 2ZSFA 2P4HX 3LC1O 2QMOA 1SOVA 4RZXA 2H16A 3HB7A 3N3BC 3K4HA 1GIAA 3PGVA 2AG5A 4I55A 4MAFA 2ATEA 3CKYA 4BVKA 4UOEA 2XYVA 1NUQA 3TMAA 3MMSA 1PW5A 2B7BA 3R3XA 3THOA 3UNXA 2O2JA 4BLQA 1H1DA 3DZCA 2YMQA 5E0KB 3KT3A 1Q1BA 2YFQA 1FXWA 4DQLA 2HDHA 1DDOA 1PZMA 5JI2E 3CINA 2ST1A 5L3ZA 1Q7TA 3EGEA 3DC2A 1BXKA 3GLQA 2SHKA 1J0DA 3E0XA 2GJ8A 4FS8A 1YB1A 3ZI4A 1J33A 2TYSB 4PLPA 3KQVA 1FYVA 1MW9X 1VKRA 3OJCA 1K08A 1YH3A 1JVBA 5HW0A 5E6SA 4YV2A 3A6FA 1CUJA 3ZD7A 3FYCA 3PUWA 2DETA 3QLJA 2TRSB 4GLOA 4EDHA 1M2NA 3OCJA 4BIMA 4OQLA 1MRNA 4OHUA 5BSMA 4WW0A 3FFTA 3GQBA 3O8DA 4YC7A 2G09A 1GG2A 3PQ8A 3FOEC 1T8YA 2Q4EA 2R62A 1EE2A 2OHHA 5T57A 621PA 2CF5A 5EHQA 4H7FA 4PSVA 2QG4A 4QSHA 3ZIAA 1MR3F 2PBLA 3MT0A 4C0BA 2PPVA 2QMZA 1QFMA 4N03A 3S3TA 5BV1A 5CB6A 5J23A 2JLSA 2ZYSA 3BREA 4CF4A 3NGLA 3QOFA 5KYNA 3LC7O 2R25B 4HAWA 1BDMA 3DMPA 3OUTA 5HQJA 1SC6A 5ICSA 1E0KA 2FPWA 2FJPA 1SHZA 1Z62A 3V8RA 4XTCS 4YRFA 2ZUDA 5JWRA 4KDRA 2AEMA 4NYMQ 4KXYA 2CK3D 1Q3HA 1P9NA 1N8NA 5KVAA 3AOEA 1L3IA 3GZJA 1MO6A 4ADSG 4U7GA 4O4LF 1MTZA 4WKNA 3TZBA 4MXDA 3TFOA 3MGBA 4N47A 3H9CA 2UYOA 4Y6GB 3TBFA 3KZOA 3U4HA 3P20A 1YBMA 2I6TA 3CCFA 4OQPA 1S9DA 2CLDX 1YZHA 2HXGA 1JJBA 5EE3A 5H9VA 2V3VA 4Q6BA 2F17A 1JDZA 4ZHQB 2YUIA 2WFZA 1Q77A 4BB5A 2A0FA 3JQBA 1PNQA 2QLJA 4AZVA 4DT1B 2GPAA 2ZETA 1ZWKA 3G2HA 4NFYA 1KSGA 1RC1A 4G36A 3DAHA 2E5LB 1VXRA 1GV1A 2ZTSA 1TEXA 4FZ5A 4ARVA 4TN1A 1DDIA 3HM9A 2UU9B 2IYOA 1I01A 4KN8A 2G25A 1WTCA 1C50A 4NMMA 2IYVA 2ZRDA 3OQIB 1PFGA 3KEQA 4ZZ0A 5I3CA 1T5IA 4GKVA 2D5AA 1FP2A 2AQ8A 1NJ5A 4ZVRA 1ADGA 2QYSA 1RT9A 1TTTA 2G7ZA 3NOOA 2HBRA 2QOEA 3D6UA 3QBDA 2XBMA 1ODCA 5B55A 4HR7A 3L0SA 1QGZA 4A82A 1F8GA 5A5EA 2DFPA 5CAEA 1QK3A 3CNQS 2R86A 4H1UA 2VQEB 1Q14A 5CX4A 3U3KA 4Z86A 1DX6A 4F11A 3OP1A 4HADA 4J0HA 4P2BA 2R0QC 4MV8A 1NU6A 3R8CA 1T24A 2FWNA 5F23A 4UPEA 1OCEA 1NNEA 3RNLA 4MB6A 2WY2D 1W85A 1UWLA 2FETA 2QL9A 3FMFA 1N6KA 2BF7A 1SBQA 2IYQA 2ZTLA 3OWXA 1X3LA 1IZ9A 2GDJA 3BHJA 3NHJA 4JP3A 3DYIA 4TTIA 5TT1A 1C80A 3MW8A 5TPWA 3UAXA 5JNTA 5JYDA 1ZU5A 2R6FA 1KJZA 4UM7A 2HJGA 4IDAA 1L3BA 3TD9A 1UK8A 3QOWA 1IWBB 1DC4A 2E7ZA 1CR4A 2V0NA 3AHFA 3C4JA 3MF4A 4QFDA 5THKA 1Y6GA 1MOSA 3EGWA 1SEVA 1CB0A 2BHLA 2ZS7A 3A3YA 1N9GA 4R3NA 2AZXA 2JDIA 4RKYA 1OC4A 1O8BA 1RHUA 1PX0A 5AI4A 1MEJA 3JQRA 5EHZA 2K6GA 2FFBA 1E94E 1E8MA 4CMGA 3E27A 3T3PB 5LMZA 1U3VA 1O0CA 1UKYA 3KYBA 3O2QB 5GV7A 1JLLB 2HRCA 4IXMA 5GPBA 3VU1A 4M9QA 1R15A 1RRGA 3B9RA 5LYJA 3ZLTA 4ZQIA 4GI5A 2ZZKA 2OM6A 2DUNA 1K0UA 1JEQB 3F0TA 5CK5A 3WGMA 1PWEA 1P4HA 2ZKIA 5HKKA 5AW4A 3U19A 3UF0A 3H8WA 3DMTC 4H7JA 2AG6A 5DYNA 4CNQA 1II8B 2ASEA 2WTMA 3GFPA 3QQPA 1DBQA 2I1VB 2O0MA 4TRMA 4GI3A 1PRYA 3CZRA 4RA6A 4WOCA 1VI6A 1ORVA 2X77A 1TCBA 3G0CA 5SYMA 3GJSA 1SUSA 5FA8A 3KPYA 1N9GB 3WK7A 3QQ5A 3JQ9A 1WB6A 4M0PA 2P3LA 1AKMA 3A9VA 2L42A 4KLCA 4I1SA 4LMBA 4ZXPA 3ZW7A 5AKXA 4AO8A 1TO1E 2WMOB 3I0ZA 3SLGA 4D46A 1B8VA 3PNOA 4MP8A 5K0LA 2CB0A 4V1CI 4EAAA 2WOOA 3IR7A 2HQBA 4NZNA 3QWAA 5EZQA 1J0XO 2IWRA 4GPZA 4BTEA 4E21A 1RJEA 1HQYE 3A32A 2NQTA 3OJXA 2WHYA 2Q5FA 5J4LA 2W6JD 3I1YA 4LJRA 4YRNA 1SCNE 3HO1A 1DIGA 1RYYA 2FR0A 2TMYA 4D45A 3I4FA 3PFHA 3LDFA 4LMRA 4OXRA 4W4TA 2NUPA 3QFSA 1F0KA 3O8OB 1NJ8A 3QLUA 3TCKA 3THYA 1UZMA 4LDJA 1BHQ1 1DRVA 1G9TA 2FSIA 3FWHA 3RG8A 2H57A 1BE8A 3ETJA 3HUTA 3WNQA 1TJNA 2GZ3A 3QE3A 5DNYB 3FVWA 3IVCA 3KUUA 5F51A 1YTUA 1XTKA 2C9OA 5LMUB 1PNTA 1YBVA 1EUDA 2Q41A 2JGKA 4KGDA 1PP4A 1D6NA 1VGVA 2QT9A 2VI5A 2WD8A 3EGXA 1NQ5A 4EUSA 3U7JA 3QVKA 3HGQA 4XFKA 5BPHA 5ETJA 3VPSA 4QT4A 4C3OB 1A7AA 1J23A 1VKNA 3ILXA 2I1LA 2WP8J 3AETA 4QUDA 3OOWA 1XBTA 1QV9A 1SCBA 2H5LA 1P9WA 1G8PA 4CW7A 1QANA 3R20A 4B40A 1KJQA 1KNQA 2H7XA 4RF2A 3UT6A 2DBQA 1CXZA 3ZD9A 3NASA 2JANA 1MD9A 2B1GA 1N2ZA 4RMIA 3GAFA 2YWFA 4HNHA 1T2AA 3QEMB 5ILGA 3UV6A 3IQIX 4EVQA 1UJBA 4ZO4A 5A2QA 5E7IA 1ZN8A 1G3IA 1MN6A 4PW0A 1KQFA 1RJ9B 4B6EA 1T4CB 2VHYA 1BD3A 1RR6A 3HVJA 2VLIA 4U7PB 1Z3CA 3HRHA 5ER6A 2IXTA 1XZKA 5DBHX 3TXAA 3QPAA 2VJLA 2ZQZA 4ENRA 2HTFA 4MNTA 5BWBA 3PXCX 3TW4A 1JWLA 1GV0A 4JS0A 3RS2A 4NCNA 5LQNA 4DHWA 3HHEA 4XVRA 4TS4A 4M1MA 2A88A 4KR9A 1HYHA 4D82A 3IPCA 2VRWA 4NCAA 1E9EA 2R6CA 2YS7A 3GMTA 3GRKA 3PFBA 1XAIA 6CHYA 5LLTA 1GTVA 1I24A 1ZD5A 2VBCA 4QM7A 4YRBA 1JHAA 2OLEA 4R8VA 4ZQGA 3DULA 3HJUA 3DO6A 3VBEA 1NVFA 1PO7A 1TKCA 4JMLA 1RI2A 4YJHA 3S8EA 3J7AC 2AFHE 1Y8AA 3D8NA 3SJUA 2JHFA 2C2HA 2Q1TA 1UPBA 4EF6A 1JIKA 2JA2A 1MC4A 2CFOA 2ERCA 2FZ4A 4LX0A 4QUEA 5G41A 1B0PA 2R2AA 3L82B 4I3FA 3NKLA 3S28A 1KEEB 2P77A 2C4MA 3JWJA 1CU1A 3B1YA 1FDUA 1EFHA 1MP0A 5AHKA 5LMCA 1UXHA 4WXHA 4BX9A 2VPYA 1Y8CA 4H4EA 4WCFA 1DKUA 4JGIA 4JLSA 2IYPA 4KQJA 3M1AA 4O33A 3FYUA 3WLAA 3FYDA 1JR6A 2Z95A 1U2GA 3ONFA 1PR4A 2CY0A 3LGXA 2FFHA 4HTFB 4DR3B 4AX4A 4TS3A 3RTGA 2D54A 4HAZA 4Y18A 3SOZA 2FPOA 1QZUA 3PNSA 3I9FA 3QLVA 5DN6D 1TOAA 2CD7A 2ACKA 4DJJA 1K5DA 5CM9C 4EHKA 4YJHB 5C2JB 1U80A 2L69A 3ZVRA 3QEBZ 3V7WA 3I42A 4MR9A 3HDHA 2PT6A 4YYEA 1O95C 3SF8A 4AQ7A 4MJ7A 5EZYF 1V8ZA 2XCOA 4DUGA 2DQKA 3MGGA 5PNTA 4UM9D 2BDTA 1TQ4A 3MMPA 3PC3A 2DEUA 3DL0A 2PTHA 3JWGA 5IYZF 1E5DA 3ZDYB 1N7GA 1VCIA 2RGXA 1BO6A 4JJ6A 2NV6A 4CNBA 2DPMA 2G28A 2HDNB 3FPBA 3LUGA 3ZBQA 4OUDB 5K2MA 1CVRA 1LPNA 3WLHA 4E31A 4EW2A 2APJA 3L02A 1L4GA 2PUBA 1E9FA 5C46F 4G5OA 5DU2A 2ACVA 3IT1A 1LBQA 1R2QA 3L7AA 2BGUA 4M1ZA 4MO2A 3E3LA 1K88A 2NXEA 1Z4JA 2X8JB 2YOGA 4WDQA 1FTQA 2Y6VA 4JAVC 1Z07A 2XLCA 3DYVA 3IKMB 4WFIA 3VPCA 2P90A 4BB6A 1YQQA 4EOGA 1CR2A 1D8TA 2CJFA 3MJFA 4WZBA 4R2LA 3U81A 1RACA 2Q6OA 4LHXA 5F98A 5JCOC 4W9NA 1VSQA 4MYDA 3GBSA 5F33A 4R1UA 2QRZA 3DV9A 3D6HA 2I0FA 1OYWA 1C0IA 3VU3A 1DVRA 2G76A 2J85A 3EWNA 2PSDA 4FLFA 1IEXA 4MVJP 3GLIE 2WM2A 1K5GA 3L49A 4ALIA 4OV6B 4J2HA 4C4XA 1VBFA 1QOPB 1SPBS 3CLKA 3WNDA 2XUOA 2VJMA 3CWQA 1DX9A 2IDJA 2HMWA 2NGRA 4YAOA 1B0AA 5GIPE 4Y1RA 2Z5GA 4AUMA 4C6HA 1DAKA 2VAPA 3AF0A 4KN9S 4OREX 4Y6LA 1PD0A 2HFJA 1DC8A 4P7JA 5JBNA 1N1MA 1AKQA 1TK2A 4B76A 1JLHA 3JARA 4IO1A 5BMOA 9ABPA 5BUZA 4GKBA 1I2CA 1PL7A 4E94A 3QMMA 3BRWD 3HKDB 3NIFB 3OWHA 2EQBA 3IGFA 3DVRX 2DY1A 3UJNA 2ABWA 3FYUC 5AKEA 4PCVA 1U2ZA 1LQTA 1ETUA 2H2HA 2O07A 3CPHA 3D3JA 5TEWA 4F9TA 4GEKA 1YRQA 3OECA 4YCBA 3I01M 1WBBA 3V1LA 1AUQA 4FGLA 5JSFA 3TLAA 5HQ3B 2FPPB 3LL4A 1KEKA 1DQYA 1V5EA 4ILKA 4BQOA 1FPQA 2JFHA 1G8SA 4OIFA 4KWTA 1D07A 3PKJA 2NZ2A 2J67A 4M0UA 1K4KA 3ZE1B 3C1TA 4QHSA 1ZIOA 2YV2A 5E4JA 4O3FA 1X1DA 2Q50A 4FFOA 3I2HA 4JBHA 4EUNA 2G4VA 4MW2A 4U6NA 4DLBA 3VZBA 1VLQA 1GZHB 2EP5A 3VKFA 5ENDA 2W8ZA 2HV8A 4GPAA 2PT9A 1NA5A 2Y6UA 3FRIA 3B8HA 3KYDA 1YUBA 3QVXA 4JYZA 2ZE7A 2OXIA 1S3SA 1RRKA 4HOYA 5JRZA 5ESRA 1G9SA 1QUFA 1SOMA 3EMVA 4IVNA 1QQ5A 1QG6A 3RS9A 3USES 5EEGA 1Y9EA 4RLFA 3KO8A 1DCTA 2R8EA 5EQTA 3HJNA 1GHTA 2QPLA 5CTAA 2VSQA 1JPUA 4N1AA 1KVTA 1CJVC 3ECAA 4D4HA 2Q9CA 1SK8A 1V9SA 2QTBA 2IH2A 4RHEA 3ZWQA 5KINB 5ES4B 2BTQB 2YWGA 3OZRA 5CCXA 3OEED 3LPLA 2QDKA 1AXEA 3A1TA 1E7WA 3DFZA 3OG9A 3OZDA 4I4LA 1KEWA 1ECJA 2OHGA 5EXXA 3MJSA 4BNFA 4UNIA 4QDUA 4EPYA 3T5TA 1QIFA 4Y3UA 3U31A 3UJ9A 4BJ6A 4F4IA 3NEPX 3L5KA 4MUIA 5I7EA 1MB3A 3DE1X 2CVHA 1G7CA 1UM8A 2EG5A 1GAQA 3C5CA 1Z0KA 2GD6A 3E2IA 2Y27A 3HB4X 3QHAA 1CUAA 4G97A 3ODPA 3I9V1 4O4IF 5KSOA 4LI3X 1GZ3A 3ZHVA 5H0IA 4EJ2A 5AHRA 1IOVA 4HH0A 3RSQA 3PZRA 1J9GA 2H1CA 4ZQEA 4ER3A 2Q5HA 3UWSA 1PGQA 3SPXA 1P73A 3LP6A 1GU7A 4L9WA 1J2UA 3AR3A 2FYTA 3FMGA 3LKDA 1O54A 3ACDA 1F3OA 1Y7PA 3ZUGA 4QJIA 1CR1A 5LZ5A 3EZNA 1DQZA 5AVXA 1SWWA 3SDBA 3WYBA 2A7QA 4RTQA 3AUYA 1GNVA 1CUIA 3JAMA 4HUJA 4IG4A 2XOKA 3UMSA 3THSA 4NMXB 1YNOA 3NGMA 4MHSA 2C29D 1BEEA 2Q0HA 1FMTA 3P5SA 3PIRA 4JOQA 1IN6A 4CLXA 3EWSA 3R41A 1OAOA 4A0SA 4K46A 4ZVVA 5AFSA 1FNMA 1DXOA 3MQFA 4ZT2A 1CEEA 3N8HA 2ZRMA 3ZCQA 4FDVA 2X7JA 4QREA 4DA0A 3OBIA 1CETA 3H6HA 5JADA 1O0BA 1R9MA 3AM3A 3C3EA 1WEHA 2O1WA 4RM3A 3STWA 1GN8A 2ACWA 1CJSA 3L6EA 3SOPA 1DKRA 1WP4A 2VQDA 3SXUB 3JQCA 1NJFA 1E79A 2V97A 2ZRNA 3COYA 3OZVA 4R7TA 5HGJA 2VH1A 5AESA 4UJ5A 4WADA 1L5FA 1H2HA 2MOKA 4IPTA 4Z2YA 3UO8B 1XMJA 4MAMA 3BKWA 3H0CA 4KE9A 3FD8A 3CFYA 3MZ0A 5CFMA 3C7KA 1ZJZA 3OJEA 2W2NA 5HUQA 1KMIY 4JUDX 4A8JC 1E3WA 1PZFA 1R8YA 5BQPA 1GTL1 4QYWA 1GPYA 1E6EA 4Y1GA 4ZOBA 2FOIA 3BTOA 3BXOA 4TL8A 2C99A 1HDGO 4UXJA 2UKDA 4R9NA 1JG2A 4ZVPA 1XUOA 1WU7A 1Y3AA 1SHKA 4GXQA 5CBPB 3THWB 3H42B 2C82A 2F67A 3QJGA 4Z8YA 4YXWD 3VZRA 2Z98A 1U9ZA 3N75A 1NR5A 4FNMA 4BWYA 2I7TA 4IHJA 4CIDA 4C14A 5CDHA 5KCZA 4L9AA 1KI2A 1HMYA 2FPGB 4NXNB 4HEHA 5LFAA 2E0IA 3CO5A 2CEAA 2JGFA 4IJWA 3TLMA 3TGLA 2R97A 5B2EA 4IV8A 1RXCA 5PGMA 1TA9A 2O4UX 3KSBC 2JK0A 4EPTA 2IODA 1YK0A 3I23A 1QONA 3EOBI 4I8DA 1UZUA 1CUUA 3H6KA 3G2NA 4M8KA 3PHIA 3BF7A 2JC3A 5JAIA 2XWBF 1IMJA 3WIUA 1O6FA 4EENA 5JC1A 1SVLA 1V96A 2TECE 3O0TA 3QX7A 4WPGA 3R0XA 5B2FA 5BSEA 5I4IA 2YL2A 3Q8MA 7AT1A 3PEWA 4HI0E 1T9AA 1J42A 1DBVO 4N7MA 4TV9A 2PYZA 5I8ZA 3RHFA 3ODGA 3K9LA 3UUFA 4HBZA 3GJ5A 3T61A 3G6WA 2WD7B 4WZBE 5JH7B 1L7VC 3F9IA 5AM3A 1ESEA 3RHTA 3GT3A 3H6GA 3SVLA 3LCUA 3PXBA 1IN5A 3H2IA 4LQLA 4MR7B 4E03A 2EZTA 4RSHA 4J3NA 3EY4A 4LV6A 2FXIA 4IJQA 1M72A 4FHZA 4HDRB 3Q6IA 1K68A 4EW1A 1NSYA 2ZREA 2ZITA 1NMYA 3OU7A 2GPTA 1Q1ZA 1VMKA 4JJZA 4TYQA 3BS4A 4IJ5A 4S1VA 5DMXA 3LPMA 1QYWA 4C88A 4GMKA 1IJKA 1F17A 3OIGA 4KPYA 1TJ3A 4KR2A 4MDYA 2R6JA 1IEQA 3KYCB 3ZBTA 2BGWA 5MGBA 1T13A 3CUKA 2O2ZA 5A5DA 4KAFA 2WINI 4HLNA 4XX0A 4BVGA 2WTBA 3FZEA 1QIMA 3NHRA 1XZQA 3VISA 1T1SA 1T5BA 3BDIA 4OP1A 4CLDA 5C5CA 2XE4A 4NEHB 4KG7A 1LTKA 4X95A 3V7FA 1S96A 3IEMA 2M1XA 4FGSA 3GLIB 3K2QA 4DSTA 3FOFC 2H4JA 5HF6A 1EGHA 3BDAA 1BTOA 4QD3A 3VPBA 2C1XA 2CL5A 1QV6A 1G64A 1F8XA 1R0XA 3TTYA 2HF7A 3O7WA 3P9CA 3VU9A 3VKGA 2E1PA 3KUCA 2XNHA 1FRNA 2GM4A 2ADMA 4LJ6A 5JY1A 3NHPA 4HGZA 3ZUPA 2PZGA 3PNMA 3TSZA 3WA6A 1Z6PA 3DMTA 5EXPA 4IVRA 3GF4A 4RELA 1OFVA 3IOYA 4FS3A 5GM1A 5T41A 2HTEA 4KQ1A 2JH8A 4Z0TA 5LKAA 3DHEA 2HK6A 1EIWA 4DR7B 4FFBA 2A9RA 3WFJA 2NZUG 3K9GA 1DFHA 5K7SA 1N7HA 4UHHA 3CONA 5FWAA 4OHKA 2XOEA 3CF4A 1JQEA 1TUGA 3R3HA 2RGCA 3SIRA 2VNHA 5JANA 3BFXA 5JAQA 4RCYA 2HRQA 1UP4A 4O4JF 3LLVA 2A2ZA 2IEDA 5ED0A 4TYNA 3A9SA 3HJAA 1Q0SA 4J0EA 4HUQB 4TTVA 4XVCA 1S2NA 3FKSD 2EW1A 4UUQA 3Q3IA 5DLDA 4I4CA 3UMGA 4GOOD 1OT3A 4Y1RB 2P40A 2WWRA 4F9GA 4ZK2A 2NOAA 2XT6A 4MUAA 1KU6A 5DJ5A 4Q34A 2Z0MA 3HFSA 4D4LA 2OHIA 1JPVA 1XG5A 5ECGC 3V2IA 4EFDA 3V4OA 4J0QA 2XZTA 1IG3A 1S8NA 4INOA 3PWTA 3UEOA 1ZBQA 3AEUA 1AN9A 3I6BA 4OAOA 3DG9A 4X60A 1V11A 2W6IA 4JFRA 1JWAB 4C7BA 6GPBA 1I80A 3QLUC 1VIVA 2A94A 3DE4X 5EFZA 1MVOA 1LPOA 4EX7A 4N3BA 4CCYA 5LSAA 4MYRA 4JJ8A 4AMBA 5KTTA 1XCGB 2HV9A 1E6KA 2H5JA 1QV7A 1F60A 4DDTA 2A86A 5IJ9B 4RESA 1M6YA 3MWLA 3NNSA 4GD3Q 3GH1A 5GM2A 3WLTA 2BCEA 2C8LA 3UGJA 2E5FA 4TWBA 2YJ4A 4M9SA 3UV3A 2NSLA 3OEHA 4IS3A 4L51A 5DCWA 3V7UA 2W6NA 3AR4A 1T8TA 3MVEA 4FCWA 3SHTA 1JIJA 4S2EA 2OD7A 2H29A 3VU8A 4PC6A 1J8QA 2FEWB 1SBZA 4IR7A 3K4QA 3PIIA 3WLKX 1DAFA 3Q6NA 4HEA6 2XDYA 3K8OE 1KJYA 1TLLA 3FZYA 4NU6A 1W93A 2FR8A 3ANXA 3BF8A 5IMSA 1TCVA 1V25A 4MIYA 3QUAA 4C05A 5CD1A 2C9YA 3DD1A 1A82A 3PENA 2JIBA 4A1FA 3NYRA 2ZRCA 2C8JA 3ZDRA 3E81A 6PFKA 5JS1A 4D4MA 1R6UA 2AC4A 3EIUA 2MSKA 2P9ZA 2JAOA 3AZQA 4MS3B 5LP6F 4BYMA 3MT8A 4KYTA 5L9AA 2ZGVA 1JDJA 3MYYA 5IVIA 1MB0A 3LSYA 5KNBA 2DU8A 4LNUB 2ZEJA 3EBPA 2DTXA 4LYEA 3ECCA 2JFFA 2UAGA 1W4BA 3RAEC 4F38A 3OQMA 1P6XA 3BL5A 1LBEA 1BYIA 1FZQA 3JWHA 2VPQA 3LVFO 2PGDA 1GRQA 5KSZA 2P30A 4IIGA 5EKSA 1TYBE 5IWAB 2NV0A 4CMEC 1IBMB 2NVOA 5KOIA 4PS1A 4QULA 2C2WA 3NLLA 1N0UA 2I4LA 4FOTA 3FUVA 2J3LA 1QFSA 2ZIVB 4QWMA 4E22A 5K99A 1KGSA 3A9WA 3HNPA 4CUJA 2ZDHA 1TK9A 4N0QA 3G8DA 5D84A 1GZ5A 1Q12A 1U0BB 3PC4A 3EFOA 1J22A 3QPDA 2GR9A 4PC1A 1JAYA 1XWFA 4LBWA 2PKQP 5SY4A 5KJ1A 1L2TA 1JSZA 1DWOA 1YB2A 3H2KA 4GDMA 2XVXA 4Q9NA 2IX3A 1M10A 3L1UA 1Y3DE 5F64A 5G4LA 1MOPA 4W7SA 1TU0A 2YS6A 1GKLA 1E2FA 1HUQA 4N3CA 3UA4A 3WSVA 2JFOA 1D1SA 1V39A 3O1LA 2WWHA 4B2IA 4HNVA 3X2EA 5DCLA 4E3WA 3PLRA 2CXUA 2BMJA 2NYVA 4LNUA 3QFCA 4TMYA 4X8LA 4WUTA 1KKMA 4X24A 1XQYA 2UVDA 4OXIA 3WY9A 4LFBB 3AILA 1DTWB 2BEUA 2IXAA 1KR2A 4L08A 3EFHA 4R2HA 1UXOA 2YV1A 3BCSA 3QF4A 2Q9BA 3WP1B 1ZGBA 4DABA 1GRCA 1DXYA 1M2VA 4X1IA 3TNJA 1MH9A 1OXUA 3B7PA 4K2HA 2CFIA 1ZGJA 2FDXA 1NVEA 4OVKA 5F1PA 4BDSA 1F2TB 1QZZA 3BMNA 4NEGA 3V9PA 4B73A 4NK5A 1M66A 3E3OA 3ABOB 4P3NA 2HYIC 3N59A 3OUZA 3WQQA 4AAYA 1IDOA 4OHZA 1TM2A 4HJXA 3TUJC 3G49A 4Z3DA 4FYIA 1WUYA 1DEOA 5AKZA 5BYBA 3VGJA 2XQFA 3NRCA 3DMNA 4RETA 2QTZA 3BXEA 3GJTA 2BW0A 5BY2A 4RLHA 2UVQA 3CWZA 4YRIA 4LZWA 1P9LA 2DT8A 4KW7A 2C03A 3KUDA 5E38A 5HE9A 2X5XA 1F9AA 3KQHA 4JJEA 2A92A 4GSLA 2VPZA 4XE5A 2QM0A 2E49A 3OSZA 3NTLA 5CURA 4C5BA 4DNPA 3PR3A 1C7RA 1HZZA 4MIKA 4W7IA 5IKOA 3G0IA 2FK8A 2WMDA 3TOCA 1JVSA 2IH4A 1TA4A 5EJ8A 2V8BA 3WLEA 4MROA 5K8JB 2D2VA 1OFUX 2AZ4A 1CUCA 3BQNB 2WUGA 3UT5A 1NQUA 3ORQA 4TVSA 1TQHA 4IIJA 3GLFB 1FF9A 4OMFG 3VSEA 1HI9A 3QFTA 3QFRA 3ZVNA 3AF1A 3Q9UA 5U9CA 3G2MA 3Q7IA 5I9SA 5LZ9A 1ZITA 1IWOA 1JHZA 4UNRA 5FOTA 4BJ1A 5EJIA 4DCSA 1T0PA 4NHOA 3RS5A 1OXTA 5EWMB 1AKWA 2I71A 4CGYA 2XJ4A 4HEQA 2C7QA 4J91A 1TD1A 3WGKA 1KZ9A 1Q3KA 3Q7EA 1QWOA 3O8NA 3AB8A 2C2YA 3EYWA 3O8QA 1Q84A 5COBA 1PJ8A 5E9WA 4CEJB 5B3LA 4UU7A 1E8NA 2GRJA 3BIJA 2GUGA 3BH7A 2C2ZA 6REQA 3KJGA 2GPYA 1HOXA 2DUMA 3HRIA 4ZV7A 5C51B 3T1HB 2FVYA 1V7ZA 1X7HA 5ARDA 1GSAA 2OAEA 3R23A 1LLQA 4M99A 3VAAA 5AVVA 5LP6A 3V8BA 4YUYA 4KR3A 1UEJA 2V74B 2HA4A 3ZK8A 1D4ZA 1QFJA 4IY1A 4MITA 1QVZA 1PS8A 1VDZA 2AJCA 1T4BA 1N25A 1VCNA 1CJBA 1MDFA 2C00A 2EYUA 3GEDA 4NULA 3UGKA 1FU8A 3LPDA 1WA5A 5E2AA 4BKMA 5BSFA 2GS9A 1U0FA 3MMXA 3VH1A 4H3HB 4WWHA 3GEPA 3H9BA 4EGQA 2HPZA 4K6HA 2HF2A 5KAMA 1QO0D 2C5FA 1T2UA 2FSHA 5CW1A 2W90A 3GLHA 3KHTA 4FD2A 3TQCA 4CTNA 4FKMA 4KJZA 2H2DA 3ZGVA 1RNLA 2VQFB 1ZD8A 1EINA 2CKMA 3E9YA 3U4GA 4PBTA 1UBCA 3E9ZA 4H31A 1J8VA 1V45E 4WMLA 1ZL0A 3N70A 3C6YA 4JLVA 1YL5A 1NLFA 2ATIA 4IXTA 4EVSA 1BX3A 4Z4HA 3ORSA 5B5SA 5JJCA 1ENPA 4REOA 2AFHB 4K6CA 3OAAD 2YY7A 4RF4A 1BIFA 1JDNA 2GARA 2O1EA 2XR1A 5IXSA 1YSCA 4PS0A 4FJ0A 4CIVA 3NRBA 1BMTA 1V95A 4PTZA 1XQVA 3ELBA 2M6LA 2GD0A 3BRCA 4QDTA 3WFZA 5GTDA 4CEIA 1NXWA 3CJQA 2XHZA 1SIUA 5J5CA 1A8UA 3Q3VA 4TMTA 2DQ4A 2NO0A 3OLQA 3AB3A 5J1SB 4OL0A 5C5EA 4JVSB 4EHFA 3QG5A 4D92A 1HZZC 1PZNA 3K16A 4GUDA 3LXUX 4JENA 5L7YA 1JFRA 3WL5A 1N5IA 1NW9B 4BE9A 2PL5A 1B0UA 1X1TA 5F2KA 3HVKA 3S27A 3V4RA 1RM4A 4DJEC 4UE2A 1XMVA 3R44A 4H15A 3CEJA 2YR0A 3B1VA 2VOEA 3JYNA 1F2DA 2PKYX 1KFBB 1T9ZA 2GD2A 2VHCA 2B21A 2IYAA 2IHJA 2B3TA 3ANNA 1IUOA 4GXRA 3ND5A 3RR2A 2VHTA 5CFNA 4IV5A 4X6UA 3I0MA 3KJQA 1NR1A 4IQ0A 5F76A 3PNQA 5IAOA 1L5WA 3L7DA 2NUAA 4YACA 2FP4A 5M3BA 4YUWA 1LSJA 3MK31 2WWFA 1EJ6A 2VHVA 3L6RA 3WBBA 5KSPA 3RF7A 5DW0A 5FBLB 2OFFA 4BNJA 1N2EA 4BO5A 3LX8A 4D3DA 4EB3A 5JLJA 2EFGA 2VG8A 5AH0A 3AM1A 2FPRA 3EHEA 3EBOA 4EO7A 2J3KA 5SV2A 4ZDJA 5IC5A 1R5BA 3D64A 4MCIA 3W5SA 4Z54A 1U8ZA 4HAUA 4ODIA 3CQ9A 1C1XB 1L6IA 4FFWA 3VOAA 4ZYVA 1DB3A 4JVLA 3NHLA 2I99A 2XYGA 3KD2A 2YHBA 4F21A 4URFA 3HLYA 3PA8A 2CXXA 2VC2B 4MVXA 3LDUA 1C29B 2WSLA 3ZGNA 1BG6A 1II0A 5AVOA 4E51A 2QUJA 3CXRA 3ROFA 2ZJOA 4YJ3A 4BS9A 4E32A 4DB2A 2VUTA 1QH1A 4O4HA 521PA 3RUAA 4Y6SA 2WJGA 5IZCA 1UQRA 3NTOA 3JZFA 5KKCA 3ZHUA 3RI3A 4OXNA 4QM6A 3ZWNA 5SYNA 1UADA 2R8XA 1V6CA 3OFND 1RYFA 4G2TA 4B7UA 2F48A 4DA7A 5IJZA 1C0KA 3RYTC 3MXOA 1P0MA 1ESMA 4IICA 3ZEAA 1QYVA 5FUXA 3P52A 2CMKA 3B52X 2P5SA 5BRNA 1LI7A 3TDMA 1YS1X 3VMFA 4Z5XA 2P65A 2W2VA 4B17A 5DNCA 2QD2A 2ACEA 1G4AE 1FSPA 1D8AA 2NW6A 2R6AA 4GHWA 1L5YA 2TS1A 2FSVA 2WUEA 2P8JA 2GN0A 2VSOA 3HP1A 3PQ3A 4RC9A 2RMKA 3AI7A 2CJXA 3E8XA 3HUUA 1GAJA 4CUZA 4DHEA 3IJEB 1XO1A 1P7VA 1ETHA 1IB6A 1JR4A 3OPYA 4D9HA 1KQGA 3DB2A 1TJYA 4YP1A 3S2GA 2PSEA 2B2XA 5CX1B 1CEQA 1PTJC 2WIFA 3PR2B 4HSGA 2GTIA 3AF2A 3FPKA 4NZ9A 2WNSA 2L18A 3LH5A 1PYDA 2GK6A 2IZOA 2V9PA 4Y2XA 2GPWA 5LOVB 2EEZA 2JLUA 4K9DA 5B58C 4RGBA 3RADC 1A4RA 3TJRA 2VFAA 5FWDA 4J1TC 2ZK7A 3A3PA 3UN1A 2O7SA 2AQKA 1ZR2A 3EQ2A 1W36C 3LHSA 3LRTA 3TZCA 1IJEA 3Q41A 2P2YA 4P1ZA 1UWKA 2O52A 2XTZA 2MTBA 2QQGA 3WLRA 4E46A 2RCNA 3RJ9A 2AOVA 5AKIA 1R0YA 1LI4A 1NNSA 3H2SA 1B93A 1Q7CA 1T2DA 4AK9A 9LDTA 3EX7C 4IDPA 4RVOA 1FTYA 2HRBA 4O4LB 4K9MA 4IHJF 4C0WA 1CY2A 1L5ZA 2M6SA 3M5PA 1WSAA 1CERA 3JXEA 5H68A 4K3UA 3L7OA 2QZ9A 4KN6A 2PYDA 2QTVA 1QIGA 1J24A 3GCZA 3TLKA 3IHKA 3P71T 4I5DA 4MQEB 1J0BA 1PT9A 3DTTA 3FMVA 3IJRA 3PD1A 1QVRA 2WVAA 4FB5A 4W5RA 4X8OA 2C9CA 5JO9A 3WHLA 4YRPA 3MJDA 4US1R 5JSHA 3UQZA 3ZOKA 3UENA 4MYCA 5JH7F 4AURA 5EE1A 5KTOA 4EHHA 1A2BA 4XRRA 3DV2A 1H2XA 5H59A 4OJMX 3E35A 4W5OA 1PU2A 1G18A 4U6QA 2Z2KA 2PLNA 3O4VA 4JUCA 1QMGA 4WCVA 3EQ6A 1VJ0A 2A0KA 4D0SA 1U4SA 2VP5A 1JXAA 3QSGA 4NDAA 4ER7A 2BUCA 2QRPA 3W5CA 2FF5A 1YNSA 1MAHA 1WTAA 2G04A 2MINA 2JIOA 2QD3A 2X1HA 3BE4A 3ES9A 1G7SA 3G0GA 3LW7A 4FOLA 5H3HA 3T3MB 5K3EA 1X9IA 2WYOA 2BH2A 5B3JC 3GRCA 1N75A 2VWPA 1U3TA 2EW8A 3AP2A 4JOBA 3RYIA 3I04A 3RDPA 1JLRA 2ZSKA 2BFDA 2P4SA 2ZU6A 5CB4B 4JI8B 1R37A 5JV5A 1AUXA 1CWUA 3H1AA 4XIIA 3INTA 1GGHA 4H1HA 4U8GA 2FSVC 2NYUA 2NUTA 5JU6A 1QAMA 3F71A 3HJGA 4M1TA 4BO9A 1X7YA 3EXFA 1A7KA 5DGTA 5E7JA 4F6RA 4FMDB 4KNYA 2GM3A 4QUKA 2DSTA 4UUNA 4H1TA 1IVNA 4D25A 2R5FA 1DC6A 1TVCA 2OILA 2CLLB 3HP4A 3RIHA 5CFOA 1F2UA 3BUSA 1H4QA 1GNQA 3RWOA 5ERYA 3C8MA 3NIWA 3WZLA 5LQAA 1GNRA 1J2EA 3K1ZA 5E95A 2V7BA 4L9SA 1OH5A 2H17A 1R4NB 1XTRA 3F3SA 1DUIA 4MRNA 4YJFB 5MFPA 1F06A 4YDSA 3UFBA 4QQKA 4K05A 4RTJA 1V5FA 1CDEA 5BSTA 2HBZA 4DNOA 3LYUA 1RLMA 2R7AA 3INNA 5I7RA 2G83A 1E9CA 1U04A 1WXFA 1OHHD 2W7TA 3HCEA 1N2HA 4QLOA 4RHYA 4BO8A 4FFRA 4LCBA 4WZZA 4FYXA 2AFIE 4AN1A 2QZPA 1E2GA 4MLDA 1XDDA 4FT2A 4FT4A 1KA9H 4BPBA 2XCQA 1C81A 3RG2A 4C4YA 5LQJA 3RYIB 4C0QC