4NBNA

Tailoring small molecules for an allosteric site on procaspase-6
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
268
structure length
257
Chain Sequence
FYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQAARGNQHDVPVIPDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tailoring small molecules for an allosteric site on procaspase-6.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-6
total genus 90
structure length 257
sequence length 268
chains with identical sequence B
ec nomenclature ec 3.4.22.59: Caspase-6.
pdb deposition date 2013-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4nbnA00
4PRYA 4ZVRA 4ZVTA 2XYPA 1CP3A 1NMEA 4PS0A 3UOAB 4EJFA 1RHRA 1M72A 3D6MA 4HQRA 1RWXA 1CVRA 4QUGA 1QDUA 1PAUA 3E4CA 1GFWA 4QUBA 4ZVUA 3DEJA 5IARA 5LUBA 4QUAA 3H1PA 2XYHA 4N6OA 4QUJA 4D3ZA 1SHLA 2C1EA 1RWOA 2HBZA 3GJTA 3BIJA 4QULA 2CNOA 5IBRA 1I51A 1SHJA 2FUNB 4N7MA 3KJFA 4JQYA 4NOMA 4NOJA 1F1JA 1RWVA 4NOLA 1SC3A 5JFTA 3P4UA 3V6MA 3P45A 3R7NA 4DCOA 4PS1A 4AW9A 2H48A 4JR0A 5IBPA 1QX3A 4EHAA 3PD0A 2C2ZA 4HVAA 1SC1A 2CJYA 3DEHA 4ZVOA 3H13A 1F9EA 2XZDA 3QNWA 4N6NA 1QTNA 3RJMA 4AWAA 4FGUA 5IC4A 3KJNA 4EHNA 2H5JA 3H0EA 4FXOA 4N5DA 4QU8A 4AWBA 3DEKA 1GQFA 3GJRA 4NOKA 1RHQA 3EDQA 3K7EA 3R5JA 2J33A 2CNKA 4QU0A 3KJQA 4QU9A 1RE1A 1ICEA 5I9BA 4QUEA 2QLBA 1I4EB 5LU9A 4ZVPA 1NMSA 1RWWA 4ZVSA 1RHUA 4N7JA 2H54A 3S8EA 4FDLA 5IBCA 2QL7A 4EHKA 2QL5A 1I4OA 3EDRA 1BMQA 1RWPA 2AR9A 3SIRA 2C2MA 3V4LA 1RWMA 4NBNA 3V3KA 4QUHA 3R6LA 3S70A 2H65A 5IAEA 4ZVQA 5LU8A 3GJQA 2CNLA 3R5KA 4IYRA 4JQZA 3UO8B 1NMQA 4PRZA 2QLJA 4QUDA 5IABA 1RHJA 3R7SA 2HBRA 4DCPA 4QTYA 1JXQA 5IAKA 2C2KA 3NR2A 3NS7A 4JJ7A 2K7ZA 2XYGA 4EHDA 2DKOA 2QLFA 4D3XA 4EHHA 2H5IA 4QUIA 4EHFA 2FP3A 3IBCA 2H4YA 3GJSA 1K86A 3R6GA 1RHMA 4JR1A 2NN3C 2HBYA 4JR2A 4M9RA 4NBKA 3NKFA 5I9TA 5H0IA 3SIPA 1RHKA 5IANA 2QL9A 5IASA 4JJEA 4I1RA 2H51A 2WDPA 4FEAA 3H11B 3OD5A 1KMCA 2CDRA 2Y1LA 4DCJA 3H11A 3D6HA 4IEFB 2J30A 4JJ8A 5IC6A 3V55A 1NW9B 4N6GA 2HBQA 4HQ0A 3PCXA 4D3YA 4JB8A 4QTXA 2CNNA 3V6LA 5IAGA 5K20A 1IBCA 1RWKA 2P2CA 2CJXA 2C2OA 1RWNA 2H4WA 1SC4A 3DEIA 1I3OA 2Y0BA 3PD1A 4EHLA 4I1PA 1PYOA 3IBFA 4QU5A 2XZTA 1K88A 3D6FA 3R7BA 2J32A 3V4OA 5LUAA 2FQQA 5IAJA 2J31A 3ITNA 4LSZA 4NBLA
chains in the Genus database with same CATH superfamily
1G59A 1YS1X 1TZBA 2PX2A 3AVOA 2YBDA 1YDEA 2V45A 4GBGA 4B2IA 2EJVA 4B43A 4HEHA 5BV8A 1JIJA 1UFQA 4E21A 2XQKA 4D0NA 5IS2A 1RM0A 1CZNA 3DAYA 3MBIA 1IMJA 4QXRA 4B40A 2CCJA 2GTIA 2QRJA 4IMIB 1MJGM 2WKRA 2WT9A 4XW2A 1DP4A 2IOFA 2ZU0C 3JD2A 4RVDA 4WAUA 2PKQP 1BZYA 5ALWA 5KYUA 2IZ0A 3BIJA 3FVVA 1F8YA 1L5KA 1ZH2A 1VHLA 4KOAA 3DWFA 5BVHA 5T3YA 2QIOA 4KWHA 1E6EA 3T3OA 3LECA 1FSSA 3EH1A 4P3PA 3E3NA 5EE3A 4IWXA 4OKIA 4F9GA 4RTNA 2Q5LA 2VT3A 1OGIA 1LJUA 3QV2A 4JAVC 1IHDA 5BWCA 1KSJA 2KYRA 1G7SA 4NE9A 5C8XA 3AHGA 3IAHA 3JQ8A 4QICA 3S81A 1MA0A 1RP7A 3DCIA 1YRHA 4JJKA 4RYDA 3UV3A 4IVRA 3LGSA 3VH2A 1C7IA 2IZ7A 1UADA 2J5BA 2VUTA 2VYCA 4PZZA 3ZGYA 2RIPA 5JZOA 4RPIA 2FRDC 2C8VA 2IP2A 5TQ2A 4C6TB 3TD6A 5DLPA 1LNSA 1X77A 4ZOAA 4ZEVA 4AZ3B 3IXLA 4G0YA 1TM5E 2X86A 4IY1A 4R8VA 4WFJA 4N54A 3HO1A 4MKXA 1VB5A 1K7CA 2RAPA 4QFMA 3I4FA 4X90A 5EKXA 1C0LA 1ONPA 2QGZA 1RBZA 3DBLA 1W19A 4YJ3B 5FR2A 5J1TB 4BNHA 4I50A 2BCJQ 2DPXA 1PU2A 3B1ZA 2Q1WA 3UJ8A 2FUKA 1Z2CA 1XKXA 2JRLA 1B0AA 1K0UA 1TM2A 2ATVA 4RHEA 5K3AA 4DKXA 4E2ZA 5KTRA 5EPEA 5F3DA 1L4NA 4WK4B 2JIZD 1JQ3A 4B0OA 4E7OA 2GNOA 3DZCA 2MJLA 2X41A 2FWNA 2OCPA 3M6AA 4YJFA 3AESA 1J9ZA 4OQPA 3HDJA 1DOAA 2IPXA 4IDPA 1JHDA 3AEZA 1F8FA 3LWZA 4RJKA 4V0MA 5JG7A 2PKYX 3RIEA 5B12A 4YMGA 4V0SA 1Z37A 1ZWLA 3NJ8A 4TS9A 4O2AA 4B17A 1KYZA 2R5FA 3HKDB 4DLAA 3LFHA 4QBKA 9GPBA 1YRWA 1CW2B 3EFOA 3JWPA 4G0WA 2OESA 2RHRA 4EATA 1C0KA 3ZDFA 1P5RA 2R00C 3PL5A 4M9RA 1Z2PX 3SNHA 2PIAA 2GZ3A 1ES9A 3DT6A 4M22A 5D3KA 2V7BA 10MHA 5DWQA 1AGYA 1VE5A 2D4HA 1BOOA 1E2LA 2Y1LA 2OQ2A 4W5RA 4L6IA 4ND2A 3HVRA 3OZSA 4TL9A 1IM2A 1VDZA 2E37A 5IC6A 1IQUA 4RKWA 1G2OA 2IOHA 2VZ0A 4C2UA 1WXHA 2HBQA 2WWGA 3GP3A 1NNI1 2GZMA 2IF0A 4FGWA 4LVUA 5AHKA 5DHSA 5DT2A 4IJUA 4KRGA 2A9RA 5B2EA 5B1SA 1G18A 2ZWMA 1ZUNB 2AG6A 2RH5A 1B0UA 1SZDA 2W2VA 3DW3X 4XWYA 1S0UA 3IOYA 1D2MA 1T2DA 2YR0A 3L7BA 1PP4A 1RTTA 4X62B 1S8AA 2OY0A 1GADO 3PV0A 4TN1A 4TV8F 2CN1A 2JARA 1Q50A 3DWEX 3CRQA 4CMKA 5IT9A 1OT5A 3FUCA 3QY9A 2LIVA 4FR0A 4HN4B 3SLGA 3MRVA 3IV9A 3K3PA 1E6WA 3IHKA 1R6TA 3N7UA 4DLWA 4C87A 5BSWA 1T4CB 2Y76A 3DHVA 5AR1A 4KQKA 5EHXA 4LC1A 4KQFA 1ELOA 4P0QB 2BEKA 3GMSA 4JEMA 3RPEA 3LUFA 5BN3A 1Z0JA 1KH3A 2ZIAA 4E46A 2EKBA 3RS0A 3NUQA 3GLIA 3GT7A 4Q7QA 1DRKA 2VRBA 2VPZA 3AFNA 3ZWQA 1GAQA 4B47A 4JLAA 2KJQA 2CWDA 2CCGA 4L5AA 2FPGA 4PQFA 5IUNC 1KS9A 1EFPB 3TD9A 3QKSA 5JY1A 3OE5A 2Y4OA 1AQYA 1EFHA 3TAHA 1NJ8A 5JCZA 4FWTA 3CZCA 5J5VA 1Y1LA 1C9KA 2PFKA 1JAXA 3SC4A 3KZKA 4F6RA 4KXQA 4WN9B 1YQQA 3GLUA 5ECWA 4YJDA 3LC1O 4BV9A 3R7DA 3V1LA 3FWYA 4P38A 4Z49A 1MP0A 2JI8A 4LTDA 4UE2A 1FQWA 3QYAA 4WGGA 3HMKA 4QBIA 4I55A 1RZRD 4C0JA 3U44B 2C84A 1OH7A 2CHUA 1CUEA 1QRUA 2D13A 2XQGA 3GA5A 4KXUA 3PNSA 1UDCA 5A5FA 1HE8B 4CDGA 3K7EA 4WNIA 3SD7A 1EXMA 2COEA 1EVKA 2SNIE 1Y4ZA 4XFKA 2Q41A 2VDQB 4C6HA 1A76A 1G5RA 1ZXBA 1E1QA 2IDMA 3SDBA 3QJYA 1POXA 4R83A 4RF3A 2I9KA 4WUVA 4ZT5A 1J8QA 1Q0SA 2VOEA 2VS1A 2WWVD 1C1HA 3RVBA 5LZ7A 4XVUA 4AZSA 1KAOA 4HGNA 4D82A 3I62A 5DXAA 1JDBC 1BVHA 4YAGA 1M33A 4AYXA 4QSHA 1ECLA 1W2GA 3CZRA 3W6ZA 4LMBA 4E12A 4J90A 4IHAA 2VUIB 2PX3A 5AOAA 2AQKA 5LVAA 1AS2A 1MH1A 2OGUA 3I34X 1WJGA 2JKYA 4US2R 2QNBA 1V9SA 2QZSA 2MCFA 4KQXA 2QROA 3K30A 3JY6A 1H9CA 4FHDA 2JI6A 1GZ5A 1XCPA 4OHRA 2P79A 3ETJA 1HUQA 1N1MA 4NP6A 4U7FA 3RV3A 5JO0A 4RIGA 1EUDB 3OU2A 4CKEB 4N3CA 1I6LA 1ZRMA 2BEVB 1DHTA 1TZKA 2ZYIA 4MUMA 5LNK1 3TR6A 3TRJA 4ECAA 5FLXA 1MFZA 3KWLA 3L0ZA 4EL5A 1Z33A 4P7KA 4PCUA 2O7SA 4ZVLA 1RHKA 4IILA 5DF1A 3D7NA 1TF7A 3KEGA 1MXFA 4HZIA 5EI5A 2RFLA 3CSDA 1AGPA 4OHVA 4RK6A 1YA8A 4X97A 1TJ3A 4D4HA 5AW8A 4FIZA 4O4JB 5L3SB 1F0PA 3K2QA 3N74A 1MT3A 4HS4A 2TMGA 2PUFA 2PAAA 2KSQA 2GBLC 4L51A 4O2BA 3WLAA 2Z9DA 2SKDA 4MKFA 5J2TA 3VOBA 1G63A 2VNHA 1JHQA 2Z2ZA 4H4EA 1C41A 3NH9A 3S1LA 4AKGA 3BULA 3VTKA 3D0OA 3PC8C 1QHHB 5IFLA 3NUGA 5HG0A 4BPBA 4ZHQB 2WUGA 2JLAA 2X15A 1XHLA 1Z6GA 2QP9X 4MYTA 2PRYA 4N5LA 5GADl 2C07A 2PRZA 1JJVA 2FSSA 3TB6A 5BSRA 4S05A 3B3GA 1P2UA 1MLDA 1KFJB 4QA9A 3LF2A 3U4GA 5A4FS 4EA8A 4GGPA 4ZKDA 3D6UA 4HWOA 2X4IA 1M0TA 4R40A 2AYXA 1LDGA 2V6MA 1FRNA 3BH6A 5ENVA 4M9XA 4HMQA 3HFJA 1PNRA 3NGMA 3W7VA 3S2FA 3G9ZA 1QRAA 4RIEA 4TLAA 4KBYA 5FOWA 1G3IA 2NT4A 1TA4A 4LSWA 4Q9IA 1JG7A 4IG4A 3VJMA 1NLZA 1UT5A 5EESA 6GPBA 2ZDGA 2JJYA 2DKNA 2UYOA 5ERXA 5IAOA 4WKGA 2EW2A 3E5RA 3T1YB 1M2KA 4PN3A 4HGYA 4KMOA 2WOOA 4KFTA 4KSYA 3LP8A 4EGCB 1E7QA 4HDSA 3RS4A 5CA1A 4N49A 2OLEA 1Z8NA 2PU5A 4I5IA 5DO9A 3TI9A 4I6JA 2G0TA 1RYBA 5AKKA 5CBPB 3OQIB 1T8RA 2ZJOA 3QK7A 2Z09A 1TCCA 1HT1E 5P21A 4W9NA 5CT4A 5HZGA 4RA9B 3Q7SA 1P6QA 2B5OA 3KBOA 1FFYA 3LLSA 3ZTTA 3GJRA 4PHTA 4EYOA 4MP6A 4RZQA 2CHEA 1JIUA 4HWTA 4MUIA 5HDQA 2EEPA 4F56A 1AU9A 3MBKA 3K71B 1L2TA 3C5HA 1E2QA 4UHEA 5C8DA 4HZUB 2P5TB 3EZ7A 4Y1FA 1ODLA 1N0VC 2B1JA 5AJVB 2A33A 2PA0A 5GV8A 5I5GA 1TADA 3ZWOA 1PK9A 4YJHB 2PFSA 5BNTA 6REQA 5K03A 4CUJA 1DQRA 1WR8A 3MAGA 4QXQA 4ND7A 3EPHA 2DCUA 3CX6A 2VZLA 1MX5A 3CHYA 3WS7A 3WGVA 3ZNPA 4D7AA 2H4JA 1E2PA 5LBTA 4DIOA 5ED4A 2ZZNA 3K8OE 1C7QA 3UJ6A 3N6XA 4RADA 3C3EA 3NPMA 3WVNA 4DNPA 4POAA 4IH4A 4HXYA 3Q3CA 2PUDA 2J59A 1AHIA 2PLRA 4KZKA 5TV2A 4O2BB 3DBRB 1UDXA 2X0IA 5K8JB 2IY7A 1QE0A 1BN7A 3P26A 1AO0A 5HTOA 1Z39A 2GPWA 2JLQA 3DV9A 1KYYA 4P82A 1Y8CA 4S12A 3OZIA 3FUTA 1D2NA 1V11B 5JBNA 1OV6A 5K3BA 2ZS7A 4EYEA 5JEEA 1WSWA 2DWUA 4OGLA 5K6RA 2O9JA 3BF7A 5I9TA 2WDPA 1GNSA 2IELA 3L77A 3PQ2A 2GK4A 3EIHA 2QZZA 1AY0A 3N28A 4EOGA 4MB0A 1QQ7A 4RAOA 3CB4A 1J24A 1B93A 3VR3D 4DUPA 2IHBA 4KR0A 1L6IA 5DW0A 3OTIA 4U6NA 3G0GA 2YMLA 5E2AA 5J1SB 3T0GA 3ZI7A 5DMHA 3BG5A 4ITUA 1B43A 3BRWD 4LZWA 4EGFA 4M0UA 5EN4A 5BN5A 1A4IA 5BQFA 1UJ5A 3H8JA 1Z16A 3BOSA 4WSOA 4KWCA 1IY2A 1E0DA 1PFWA 1U0SY 2V9ZA 4IFBA 3HVHA 3I9LA 3RJ9A 3ZBUA 2B5WA 3JWGA 2XT0A 2R8YA 3TOVA 1P2TA 3PQ4A 3DEZA 5ILQA 5EIEA 3U3OA 5JC8A 1QDEA 1B6GA 3HLYA 2PO5A 1D6SA 1OLUB 4EUHA 3U49A 3AEQB 1E2JA 3I5UA 3H5NA 3L4JA 5JLAA 1LUAA 2PXHA 1Z3CA 1PBNA 2OXIA 2H5LA 1JKJB 3D8NA 5BSEA 3MQ4A 3JWJA 1WIWA 4L0MA 3GQVA 3M9XA 5HHTA 2ZOSA 1DC5A 4YXFA 1Z74A 3EMKA 1U7PA 5G53C 4ZT3A 5IUJC 3D6NB 2XE8A 4G56A 4KVGA 3WV5A 2GXAA 4C30A 3WLLA 1XD8A 3P0FA 3OQ6A 1IY0A 4OHCA 4DN6A 3BMOB 4MYUA 2QZ9A 3SNKA 4B32A 2CGEA 4GYWA 4JI5B 1WUHS 1T8SA 4BLRA 5LWHA 5BRAA 1JFVA 2QZPA 2ZI7A 3I9V6 3TEFA 1TKBA 2XZDA 3FIUA 1CX9B 1QCYA 3CMCO 4EI9A 3L4KA 3THWA 1IZ8A 4CIAA 2PS0A 3N2KA 3N3BC 1EVJA 2FPGB 3C3PA 2QRQA 2QD3A 3EWNA 4JUDX 2IEAA 4DC0A 1VIVA 5G0SA 1D9ZA 3C3JA 1Z26A 3IJRA 3UWDA 5IKOA 2XCIA 2GILA 1GGEA 1P7VA 2PKXA 4LWPA 4LCEA 3UKJA 2CL0X 1L5QA 2GXQA 5L3QA 1KZ9A 1OX6A 1US8B 4EY7A 3LT1A 5EUCA 2VNJA 3BWVA 4ZHSA 3IB3A 1Y8ZA 1XK7A 3T3IA 3RADC 1NVFA 3WSVA 1L1EA 1DV2A 1QRSA 1YHYA 2FQYA 1Y80A 1GNQA 3BE4A 1QZUA 2GERA 2NXJA 4ZAYA 2UZ1A 3TZCA 2YMMA 3ABQB 1YC2A 3F8TA 1QS0A 3CF2A 3KPJA 1EA5A 3EPLA 2AFHE 1XSEA 4A0GA 4BWYA 3G0BA 2BBTA 4E88A 1DXHA 1XZPA 4BKPA 3RVLA 3GB9A 3PRYA 3SI7A 1W44A 1A5BB 3KQNA 4MWSA 1LDEA 3R5KA 4PLZA 5K9ZA 1E2BA 1WZ2A 2JGDA 3FTCA 2V5UA 4H6XA 5CT5A 1XWIA 3PC3A 4KW7A 4U7GA 5EXTA 3VI3B 3P9PA 3K0FA 4R1SA 1TXGA 2JJ1A 2R62A 3E1GA 4PG7A 4X8MA 3ZXYA 1OT3A 2X2FA 3FOWA 3PC6A 3B6IA 1TCAA 3M4YA 1NQTA 3ZBPA 4ETNA 5CFOA 5KNBA 3RJTA 2G63A 3G89A 1RSZA 5LA6B 1NZDA 3HLTA 3VU9A 2PUEA 1JFFA 3BIXA 1VL1A 1UZNA 3P9SA 3AR4A 3ODPA 2GEJA 3P2IA 1HRDA 1J90A 2PZJA 3ETNA 3F47A 5JW6A 3N2LA 3DNFA 1S89A 3KNZA 3SC2A 3LZCA 1U8EA 3DDUA 4GO1A 4YWHA 4HV4A 3LY9A 1HDYA 3DR5A 4L9RA 3DKRA 4ESHA 3E8MA 5DI9A 4Y2SA 5DTEA 1L8LA 5NLLA 2ZSDA 1NQVA 1PD0A 2GX6A 4XEHA 2I6UA 4A6XA 3F4KA 1GGHA 1P91A 2WHPA 4D5EA 2DT5A 4EW6A 3W9UA 1VPEA 2UYQA 3C3AA 4Z8YA 4U1RA 1KE1A 1MOPA 3WLKX 1YA4A 3D3WA 2RBGA 2XNKA 1L8OA 2QTZA 1VIDA 2C2OA 4R2JA 5BVGA 4JNCA 1VHTA 4MUFA 2VF4X 4MGHA 3SEFA 1VYUA 1IY8A 4RNDB 1NM5A 1RI1A 1UR5A 3C6QA 3R7BA 4URVR 1N6OA 3DVAA 1LD3A 3D0QA 5BT8A 3JQ6A 5JDCA 5CLFA 5B57C 3BA1A 4KLCA 3R8CA 4KC0A 5LKRA 3S8YA 1H6DA 2Y9MB 4R8MA 3GLTA 3HV0A 2ZZKA 3CTPA 3UOAB 2H5EA 4EJFA 5ARDA 1SKYB 1LJLA 1KYQA 4RULA 4YRLA 5CR9A 2V8BA 1NMXA 1ISGA 2AB0A 3LBYA 2DPYA 2WI8A 5IVIA 3LTNC 2G6TA 2AHRA 3M81A 5LQCA 3GJ0A 5DX1A 4GWLA 3IQZA 4UEWA 1V8BA 4W1PA 1THTA 4UARA 1H23A 1D2AA 1CJVC 1DKLA 2YYAA 3H9JA 2V96A 2YJ5A 2PGIA 1PTJC 1PTKA 5JYBA 3CNOA 2DQKA 3KXLA 3SJCA 4JVNA 3WKAA 5BV1A 3L8GA 4LOKA 1Z47A 3HP1A 4Q4CA 2GR9A 4IIDA 5AVJA 5IBCA 2RGNA 2IOQA 4DNXA 1MABA 1N8TA 5JBQA 4CEIB 1JQ5A 3TX2A 4CLXA 2JIPA 2VDOB 1ZJ6A 4CFYA 2GEKA 3UXHA 1SZJG 4R16A 1KHTA 4XGIA 4OVKA 1H9AA 3SDZA 2BP7A 3WGOA 1JWBB 4FINA 1WEHA 2C8KA 3WGNA 4NL4H 3AMVA 3IUMA 5JD3A 3EY9A 4HTFA 2NU7A 4WI1A 2WUDA 1A88A 5K0EA 4JWKA 3RTAA 1T5BA 4NCBA 4NENA 1X3SA 2IK8A 3AF5A 4IGKA 4PIPA 3TM4A 2QM3A 2V0GA 1C0IA 4CF6A 2C3UA 1IZ9A 2APJA 3CW9A 3E5HA 4Q1CA 1WUIS 2PK3A 2PX4A 5EMMA 1YRYE 2P7HA 1P73A 1FDOA 2GYWA 3K5WA 1RADA 3OT4A 4BP8A 3C14C 4PO9A 4WJKB 1IQPA 1XYGA 3OPNA 4R31A 2AJLI 2QX7A 4TT8A 4U02A 4WPGA 4NI5A 4MINA 4WFQA 3EXAA 2ZTHA 5AI4A 5JZBA 4XSGA 3FPEA 1HEYA 2EWWA 4I6EA 5KTSA 1FDUA 1ZZGA 4B3CA 3FKJA 4BASA 1LTHR 3EDYA 1H0KA 3EXIB 4JOSA 4KNYA 4G81A 4FQ5A 2F4VB 4LZNA 3FDFA 3BA6A 3HWWA 2FOLA 5FBLB 3T9FA 2Q2VA 3CRZA 1R5NA 5JSFA 2KM1A 1CUDA 2Z57A 4G5RA 2GN8A 3CYFA 3WGTA 1I2BA 5T7BA 1YF3A 4RK0A 4M7PA 1M2EA 1USUA 3DEYX 4TRNA 3NIWA 4DMRA 3G5UA 1FMJA 3A26A 1QSGA 1SHZA 1B1AA 3G7UA 3G2KA 1XNHA 2FW1A 1JILA 2OHOA 3G2OA 4L8FA 4L9SA 1KJNA 2GWRA 2OOSA 4EPVA 3GU3A 5KTMA 1OWMA 1SGWA 2FEXA 3KWMA 5HS4A 3HBLA 1GGVA 4KDEA 2W2LD 3H2IA 2YV4A 4QBFA 3AL3A 3X44A 4Q1EA 1DIAA 4Q3BA 3KYDA 3DPUA 2WAAA 5DHFA 5GAJA 3U9LA 1RLTA 2Q8NA 3NVKI 1AK9A 3AP3A 2CE2X 2Y77A 2AI3A 3AQ4A 3PYMA 2PQ6A 5D86A 3R76A 3U4HA 1YOVB 5I6DA 3AEUB 2W83A 1JX6A 4MB6A 1AQ6A 3U62A 2SHKA 1FU4A 4PLFA 5TC4A 4AJOA 1QQTA 5CBKA 4HUJA 5C1OA 3U4MA 4MRAA 5BQOA 3RNOA 3ORSA 1CVIA 3BHIA 3QEBZ 2A84A 3TGLA 4UHJA 3G8YA 1K88A 3AY7A 4AG3A 3CGWA 4BNVA 1JYEA 1HLFA 2P3QA 2WILA 4BECA 1Q84A 4R0MA 3DEJA 1AG9A 4WNAA 1DWPA 1NF2A 3RS7A 5K3EA 2IEDA 5C1BA 1G3RA 2GRAA 4G5GA 2I65A 5DDIP 1B15A 1VZ2A 5JFGA 3WLHA 4RHTA 4ZDIA 4QOHA 1P2VA 2P0AA 5HYVA 4IZOA 1G8AA 3WWDA 1QDUA 1E2DA 1MEJA 1H94A 2I0FA 2VJMB 3DDHA 2BHNA 5C0OE 4BMZA 1KU0A 2WNHA 2ASVA 1S2NA 1TT5B 4TMTA 1GZ7A 3WB0A 2CMKA 4W8OA 5DGCA 4CLOB 3SYNA 2DUMA 2J87A 2OUIA 4LGYA 1DC7A 5ESWA 3MM4A 3NIGB 1A9QA 2FPPA 5DHQA 2OORC 1RXEA 2ZJAA 3RSSA 3UAXA 4ZOLA 2O8BB 4HDCA 1LW7A 2WK1A 5GJVC 2QR3A 1F12A 2P9TA 3JQPA 3LXRA 2PNFA 1CJSA 3HDGA 5J59A 3CF4A 1V35A 2BDUA 4M60A 3S2EA 1U1EA 5LLDA 3IP3A 2HXSA 4A6DA 2JEOA 1T9GR 3NBXX 1A5SB 4JLVA 1VE9A 2Z8YA 3TQTA 2YHIA 1ZIXA 5T5QA 1VSTA 3EARA 1Q1EA 1KIAA 1RQ7A 2WUVA 1W8DA 3ANNA 2AKAB 4HGOA 4EY8A 4JOBA 4O1HA 2XAUA 1AC5A 5ALJA 3V4VB 3PNVA 4FFBA 3JU3A 3FSJX 3K53A 4YO7A 3SZMA 3T4PA 3ZHYA 1EINA 4N39A 1MEOA 2CFOA 1P0IA 4QDJA 1FEZA 4U4AA 4GSYA 5FOVA 4BMVA 4JVLA 3FMPB 4TS1A 3REOA 1PEKE 4R68A 3B6JA 3ZY5A 4BNFA 4IHJF 1H1LA 1XWFA 1Z22A 4GOJA 3WLRA 2XZOA 3WMXA 4F9TA 1EIWA 4IOKA 3UMVA 1UK8A 2DWCA 5BXQC 5BRNA 3EEIA 4IJVA 1W581 3GFQA 4BNIA 5I8WA 2DR3A 5F35A 4D25A 3RUEA 4ZZ3A 1EAMA 3CUYA 4FGZA 4ZDWA 4N12A 4DQVA 4CWAA 4UNRA 4E3WA 5AW6A 4GT1A 3HBFA 5EINA 1TDJA 3JQ7A 1NW7A 2IQ5A 3N8KA 3DYVA 2LCIA 3FB4A 4NF2A 5D84A 2VPQA 4IIJB 1EVQA 2X6RA 1NVEA 2IX3A 3PEFA 4JJFA 4K05A 4NU8X 1YVDA 3IEUA 1EFRA 1NMQA 2HYDA 4DIUA 2Q49A 2QLJA 3VVLA 3T3MB 2VH5R 1JECA 1XMPA 3DPIA 5JH7F 2C7OA 1POWA 2VRCD 3E58A 1U3TA 4LY6A 3SCZA 4ZYLA 1NF8A 4EUKA 3DXXA 4EGAA 4U39A 1UBCA 3E5NA 4AJLA 2NNWB 4QPPA 5EJMA 1HDOA 3PDIB 3KKLA 3LYLA 4JELA 3W5UA 4C3OB 4D6PA 1DJNA 1DJPA 2VNKA 3C8DA 2PXAA 1R37A 4G1FA 1MPXA 3MUFA 1YU9A 4GX0A 4GQBA 1H2FA 3EIFA 4OQLA 5EWMA 3V55A 1WD7A 1Z45A 3ETCA 2J0QA 5IWAB 1IOLA 2CMDA 2PZKA 2ID8A 1EUZA 1N9GB 1NQ5A 2EF0A 2GKSA 2QL6A 2Y3IA 3BRSA 3GZNA 3NXKA 3OZUA 3EN0A 4U3JA 2ZLBA 1C1DA 4A27A 2FJPA 5AJYA 3D54D 4D0RA 1T29A 2CW5A 3IT1A 1MB3A 4NBWA 4Z2AA 3WGZA 3U4AA 2P41A 3B20A 4RVCA 1HT0A 1KI8A 1LBEA 2W2LA 3U4DA 2FG7C 4YV1A 4KOEC 2RBEA 1V16A 2HSDA 3QVJA 2H3EA 3Q9UA 4ZVRA 1ZHOA 1GRCA 2A0XA 1KNXA 1AQIA 3BEOA 2ZQ5A 2OFFA 2C9DA 4PG4A 4BKRA 1H1TA 4WCDA 1YUNA 4Y9TA 2GK6A 2VQEB 4ARZA 4X20B 3R40A 2P9QA 2W6JD 3DOIA 4G67A 3GUCA 5K8TA 3BXZA 4IUBS 2ZYVX 1TC1A 2CDAA 1EXNA 5EMJA 2WMYA 1KZ4A 4JDUA 5FL7D 3CA8A 1W5EA 4DUGD 1OAKA 1ZD5A 2B69A 3GEPA 3N1UA 2W2MA 2ZVQX 2EHJA 2R1TB 3OM0A 4MV1A 1I7NA 4UUOA 4B8WA 5JD5A 5KX5B 2NT3A 3O91A 3TL3A 4M1ZA 3FR7A 4IPTA 3SKVA 1SXJD 1S01A 1C3JA 1D09A 5KTYA 1Y37A 3UMMA 1RS0A 5CDTA 1YJAA 5LBIA 2PPLA 4C0KA 4EHAA 3CO5A 1QB8A 3V34A 4BO3A 3UMRA 2YYZA 3HA2A 4OLFA 1DIHA 1N2CB 4TKVB 5A6VA 1E3MA 1PR4A 3JVEA 3HR4A 2VZEA 3HCFA 5BN4A 3PGKA 3NHSA 1NU6A 2JFZA 3I83A 3ODGA 4MWZA 5TVKA 3VTAA 5AQ1A 3OMLA 3GLHE 4GPBA 1Z8DA 4KXXA 4RZXA 1BEUB 1N2CE 4F3YA 2XADA 4C22A 5CB4F 4Q1BA 4RPCA 3ZZUA 4IWYA 1N6NA 4HXGA 2KLHA 3F7NA 4NESA 5KDOA 3PUKA 1N6PA 3FZQA 4HWSA 3MXOA 2DY0A 4JBXA 2AQ8A 4JXKA 4URUR 1WPRA 1Y4UA 1RJDA 2HLDA 3VJLA 3BRWA 4HNUA 5HRCA 2HIAA 3J81k 5DBEX 3GVCA 1WXGA 4J0QA 4P4TA 4C4ZA 4TN5A 2CE7A 3G49A 4O4LA 5A2QA 3B5JA 2JB9A 1P29A 3CF0A 3DE0X 1V6CA 3MB5A 3SJBA 5JANA 2E82A 1A72A 1I4WA 2P6MA 4JHXA 3A6LA 1QLHA 2BBOA 3R6LA 4DMHA 4B44A 3NU1A 1V95A 1W49A 2NADA 4WLEA 3U9TA 1XCJA 1K5GA 5CX1A 2XCOA 4N0DA 4EKIA 1MG0A 2E0IA 3MPUA 5G3ZA 4YNBA 1JXQA 1QP8A 2P2ZA 2WFLA 4UOQA 4EHDA 3ETLA 2BFWA 2XCRB 2GNAA 1EHIA 1H0SA 3K0HA 1CUHA 1ARZA 4IHJB 4PYKA 2CSUA 5MGNA 2VK1A 5EEGA 3HM2A 1CQJB 4FBLA 3CV3A 4POOA 1MO5A 3IH5A 4IH9A 4U7JA 5SV2A 3WICA 2AMFA 3BJMA 5FWXA 4J0FA 1RBMA 1WPGA 1QIIA 2OCLA 2E48A 3G9TA 4KCGA 3KB8A 5HF8A 3MINA 3IJEB 1AUXA 3HB5X 1WABA 1DTWB 4OO3A 4QLAA 3BB3A 4GKJB 4YACA 2HLNA 3AJEA 3RYIB 4ZJPA 1FOEB 4KN8A 3UAVA 2WUWE 4F4FA 1M1UA 1MEEA 3B6MA 2LTAA 4L5CA 2VUUA 3FFXA 4MW4A 3WL8A 1E0AA 3OKCA 2OQRA 5C4GB 4CM9D 4L7VA 2Z1MA 4LOIA 1UJ4A 4Q03A 4FQ8A 3S99A 2FQQA 2FFBA 1N6HA 1NONA 1U8YA 1V37A 2ZB4A 4X7RA 3W78A 5I7FA 1JTVA 1Y5IA 1SCQA 3MD0A 4DR7B 4KHZA 4BO6A 1JI3A 4EA9A 1F51E 4CQMB 1H3EA 1WCWA 3KUDA 4BVLA 4CVNA 4HC4A 3PSHA 1EP9A 2G71A 1JAYA 3BKWA 3PC4A 2QX4A 2J4FA 5JYEA 1R8JA 1N1GA 2WA2A 1HBJA 5I9LA 2XB2A 1QYDA 3AIIA 4MRMB 4HH0A 1NA5A 1R7RA 4YJ3A 5F1PA 4H4DA 3LT4A 1K9VF 1UBTS 1WY5A 4R7ZA 1YHZA 3ZWNA 2RGYA 4Y7CA 5IH3A 4E2FA 4NSNA 1S7GA 3ZCVA 2WPDA 3L93A 1XZAA 1JT2A 2JDID 3GFPA 3I6MA 3OOJA 4ZOCA 5KCZA 2C9ZA 3A1NA 2B6HA 5DYNA 4UM5A 5ESXA 3EQ2A 4Z4HA 1RPJA 3RIYA 4CLRA 4F85A 2WIGA 4MUKA 3RFUA 1Z68A 3Q3IA 5BSVA 2GCPA 2NTVA 1JIXA 5PGMA 2OB2A 3CW2A 4ZDKA 1FNSA 1QONA 2IFTA 2K6GA 4AMBA 6AT1A 1CU1A 1KC1A 4Q37A 4DARA 5JU6A 4TRRA 1N2CA 5DYTA 2B8EA 2CJPA 5B36A 4CEJB 5CIYA 3JD3A 3DTVB 3T9CA 1VP3A 3CE9A 3C97A 4Q15A 4EYQA 4F6LA 3HYSA 1KIFA 2QI9C 3HKBB 3FWZA 1JG3A 3PNOA 3UTCA 3CF6R 4Q9AA 2FZKA 5DBGA 4BZQA 1ZK2A 5C46F 2FWMX 3GARA 1NQAO 2B99A 1IB6A 1M6VB 5DSTA 2OAQ1 2JAHA 3OZFA 4U2EA 2QS9A 3BWYA 2PUGA 1MOZA 2ZBQA 1E0KA 1R4AA 1R3UA 3GO4A 1F4VA 1J21A 1ZAKA 2JAPA 4Q4DA 1G2QA 3TLKA 2WU8A 2FP4B 3E22B 4S1OA 5EQDA 2V0CA 4G4SO 3IQGX 3QBEA 2XMQA 1A3CA 2WSSA 2J09A 2WFZA 3KT8A 2CF5A 4JFRA 3C43A 3M1LA 3UMJA 1X9HA 1IBRA 4NCHA 2XXAA 5BN3B 2FR0A 1NBHA 5KYGA 4GLLA 2NUAA 4HATA 5HM6A 5TQ0B 5HBRA 1JKXA 4LC9A 3PUHA 2OYSA 1X7XB 5ECDA 1R0XA 2VR1A 2H51A 1T4GA 1RC1A 2HFJA 4HNAB 3DSRA 1TVKA 3TOSA 2A94A 2H1IA 4IEFB 3ZDZB 4ZYWA 1XPUA 2A1TR 3GZ4A 3K1JA 5TARA 3QF4B 1ZQ1A 2VP6A 4MVJP 4PZPA 4D3YA 3AQIA 4Z4GA 2HSJA 2MU1A 4DV5B 2JD2A 1P4AA 2ZROA 3GZNB 2PSDA 1XU4A 2XMSA 1D2CA 1XCGB 1EEXB 3VISA 2B1GA 4L8VA 4BC0A 3TN7A 4A0HA 3S2UA 2H2IA 3K8QA 3K4HA 3OFND 1XKLA 2OXRA 3K9GA 4L9AA 3SM3A 2PD4A 3W5VA 2NACA 5K8IA 1N7HA 2JCVA 4H16A 4TLEA 3HXLA 3PL1A 1I24A 4G37A 1ZU4A 1RZ3A 4FYIA 4Z99A 5FR1A 4XYEA 4TLLB 3LDFA 1U2TA 3QW2A 1OVMA 4O63O 3A2MA 4X1YB 3WRYA 1QV6A 2M6LA 4FB4A 3L6RA 4PLVA 2A14A 3LW8A 2R7MA 1KJWA 3A2LA 1JB1A 2C00A 2PTGA 2I87A 3BGDA 5F9MA 4CQLB 1ISMA 1PKXA 1XZEA 2ID9A 3ASZA 1XZ8A 5G41A 4ASUA 5FTKA 2UDPA 5U4QA 2D62A 3RTCA 1J23A 4ZALA 3UK7A 2CBGA 4PG5A 2YW9A 2O8CB 1F06A 1LVUA 3EA4A 3Q0TA 4PAGA 1QQAA 2GM9A 2PX5A 3CPJB 3VH1A 2OR3A 1WVMA 5L7TA 4X24A 1JJIA 2QA5A 1VCOA 3DCNA 4LNAA 4MARA 4DY4A 2PLNA 4D57A 3SJZA 1G5TA 2FZEA 4K6CA 4RY9A 3QVGB 2ZWIA 1KS2A 1QPBA 1UJNA 4RY0A 3JZFA 2IPAB 1BGVA 5IN5A 3TLCA 3DEHA 1YFJA 3WYEA 4DJFC 1OFTA 3FTNA 4KBFA 2BGGA 2B2XA 2R79A 1BDMA 4G07A 5HF5A 3C5WP 3VAYA 1KJJA 2OCAA 5HMMA 3WYAA 5IKEA 1MIOA 1J2JA 2CF6A 3EGOA 4K8OA 4KQWA 2ZDHA 3QLUC 4J76A 1JQDA 4P31A 5DSZA 4H08A 1DJOA 1GG2A 3KLOA 4MHSA 4Q7LA 3TO5A 3AW9A 1V8ZA 3ZGVA 1MAVA 1GKKA 2BI8A 4BNNA 4BWGA 4DSOA 4F86A 4H1WA 3ESZA 1ATZA 1VJ0A 4HVLA 2FZ4A 3FKQA 5IM5A 1NW8A 2X5XA 3L92A 2VQ6A 2FFHA 5A1JA 3ZHTA 2QT9A 3EISA 3KELA 3SHOA 2NU9A 4DR2B 4MAAA 4B4OA 3TCNA 3VR6H 2F8MA 3TVYA 3IEKA 4GP7A 4FJ0A 1L5GB 2QRPA 4BP1A 1NBMD 1Z18A 2VSQA 3N0WA 1RAAA 4EL0A 1UINA 2VNSA 2IUTA 4UOZA 2GZHA 1GZSA 1JXOA 2ZB3A 2ZBRA 4JJGA 4PCLA 4YCBA 2CLFB 2AG0A 2IA5A 2JKVA 4NHEA 1G6Q1 2JPDA 1JWAB 1VB3A 4FIDA 1NTOA 1VPWA 1JU9A 5CEEA 2K7ZA 3W4KA 3IIJA 4CYMA 4U8HA 2WSYB 3GBVA 4Z7JA 5EXDA 2J7PA 2O8FB 5EMLA 1PKEA 1QKKA 2JCSA 3W3AA 3S29A 1ZRSA 2ROQA 2JNWA 4CG1A 1QCDA 3BK2A 2HSWA 4I3HA 4AX4A 3AI7A 5CUQA 2FGJA 2CT8A 1WOMA 3HB1A 4CLDA 1U7ZA 4WFKA 4BWFB 4WKBA 4AJNA 3PFCA 4TWZA 2NX2A 1A8SA 3E9DA 2BEWA 5B1EA 2IHZA 4HMOA 1ONOA 2GWHA 4WNCA 3DXZA 3ISTA 3H18A 2OHFA 1F17A 5IRCD 2RI0A 3KQOA 4LNHA 3D2CA 2JATA 2CL6X 2J3QA 1REQA 1BXZA 2XUJA 3HK2A 3BXXA 4UHKA 5K6AA 2K7FA 4V39A 1DGQA 1OZGA 4RDHA 5CEFA 1Y3FE 2EBHX 3NHMA 4R9SA 2I71A 2BZGA 4D8UA 1BKSB 4E5UA 2GVZC 1VHWA 4LC0A 4EPXA 5BQ3A 2OV4A 4UNSA 3B89A 1A97A 3MVEA 1LQ2A 3MMZA 4M8KA 4QJBA 2HSGA 4I14A 1SCUB 4EM6A 3B1WA 2XUPA 1K6JA 2BKLA 4LQLA 2H2DA 3TTYA 4PS0A 4BQEA 1EX6A 3GLGA 1MZVA 1B6RA 1XC7A 1OFIA 2AC2A 3UGJA 1H4SA 3R0QA 1EE2A 1PEDA 3W6OA 2GFQA 3BMCA 1MRSA 2VDVE 5FWNA 4QHYA 4N6OA 1HF3A 4O2RA 3MT9A 1E9SA 1SHLA 1SXJA 4R05A 2IDZA 5K0TA 1NFRA 5LZ9A 2QPLA 1G7RA 2DFDA 1N1DA 2FUNB 2VDKB 2YZGA 3BJIC 3BXOA 5I3ZA 2RC5A 2CXXA 4MVJG 1ZINA 2ZTUA 3R9IA 4E03A 4BOYA 2C1XA 2K5UA 4I1VA 5FPSA 3G82C 2DH6A 3BE6A 2PNJA 5K0SA 5KI6A 2W6JA 3X1WA 4JLJA 2XTAA 4R5HA 1QHIA 3RC9A 4JVOA 2CUZA 2ZK7A 4MQEA 1OPXA 2IKSA 2AA3A 2CVHA 4LWOA 1ZD4A 2MYUA 1QVRA 3K9LA 3PDJA 1DIGA 2ATIA 2FUEA 3ZE8A 3JPWA 1M3SA 1TVMA 2R8BA 3KUCA 2XCSB 2OHIA 4H3KB 4BUJA 1BXKA 1DKNA 1PT9A 1G21E 2J3EA 3SJUA 5LOVA 1RZRA 4Q0MA 1CY1A 4MQ5A 1L5HA 4UHCA 2PXXA 2WVGA 1RBYA 2Z30A 3ZGXA 3L2OB 4UZSA 1I4EB 3LUBA 1GLGA 2QMOA 3LYAA 4UUNA 1CUBA 1CXZA 1DMSA 1M34A 1XRLA 1ZESA 2Z2JA 3MAAC 3S8EA 4RPJA 3EG5A 5K8VA 3HPQA 5FTJA 4C88A 2HGZA 3K9BA 3OLWA 4KE7A 2PT5A 1P5FA 4FOTA 2NU9B 3MSCA 4NC9A 1KJQA 4KKVA 1QP0A 1PR1A 2ZSFA 3L8DA 3MWDA 4LNUB 4BFZA 4EENA 2TRSB 4C7XA 5HTKA 4KUHA 4I2NA 1YIDA 4E0BA 3V1TC 4HGQA 2FN4A 3QXGA 3SXUA 4RJTA 3RUFA 5BY2A 4BGDA 1TM4E 3NR2A 2PMBA 3QU5A 4P7JA 4C5BA 1J70A 1MW9X 1PJAA 1G20B 1VIYA 2ZREA 1XQVA 1DDIA 1NT4A 3AETB 5HS6A 4C7VA 2QRNA 3OLYA 5DLQC 4Z1OA 3EHDA 3T4UA 4GG1A 3FI0A 4ZQIA 1A9XA 3CLRC 5TSDA 2ZJ0A 4QJ3A 1SR8A 4K9LA 1U7WA 5M04A 1QV9A 2OXTA 3CPEA 3KKPA 3CT4A 1E2NA 4ZPJA 4P5EA 3TZLA 4CN8A 1DKUA 1PJLA 3I6BA 4X63A 1Q7TA 1CY2A 3THYA 3Q7EA 2QVCA 3Q88A 4HMPA 1N6IA 3PFKA 5DP2A 3AU9A 1E2EA 3OZCA 3WIVA 1C80A 3DEAA 2R44A 5HILA 3L0BA 2J6CA 3UWKA 5E2BA 4EG6A 3HXQA 3UWMA 1R66A 4P36A 2C2HA 1SIUA 1AUPA 3MMSA 2PUVA 3PWKA 4S2EA 4UBLA 1SU4A 2CNWD 3JD1A 4EUEA 4Q4JA 1IG3A 3JD0A 3S3TA 4D9CA 1XJ0A 2CNWA 2Y1CA 2PTHA 3A9UA 3W1EA 2GJKA 1P4HA 3EB9A 1E9DA 3NVAA 5A04A 1LTQA 1T9BA 4JB0A 4F97A 3WQSB 4Q02A 1FP6A 1I5RA 3F5SA 4KMRA 1PZNA 4GE0A 5AKIA 1ZIDA 2C4WA 2ZE7A 4OHUA 3GZTB 5UKDA 3TZEA 4NVRA 4RA9A 5BOSB 1RC0A 5I4KA 1DADA 4CF3A 3PJRA 2AJCA 1T8WA 1NMZA 3H5IA 4UEJA 3KS9A 3FGOA 2E6KA 5KYWA 5SYAA 2JVKA 5BMVF 3L7AA 2GPYA 5AHXA 1FK8A 3C8HA 3UJBA 3VRHA 3ND7A 1Z3IX 5SZJA 1AVTA 5FXMA 2IYSA 1Y6JA 2PR2A 1EBUA 3PUYA 4BFWA 4HK4A 3IIIA 4Z0NA 4E1BA 1EWQA 3DOJA 4J0HA 3WP0A 2DY1A 3DMPA 4S1WA 1BA2A 4IDBA 4MGEA 4OUDB 4TKLA 4NARA 1XAJA 2QRKA 3NHWA 2H5JA 1PJ4A 1T1RA 1T8PA 7ADHA 1SZPA 2YZNA 3OCWA 5FV4A 2DVMA 1IL0A 4L4RA 1HSOA 4ZCLA 4LJ4A 3SG0A 1QG4A 4H0NA 3CSSA 4JT4A 1J8FA 4TMXA 1TO2E 4PZDA 5ICCA 3ADBA 3IYLW 3EOAI 4KLRA 5AI5A 3TKLA 5CDFA 5D8DA 5JBIA 3L18A 2NUPA 4CG3A 4TVSA 1LFDB 4ASUD 4MRPA 5KSYA 1Y1TA 4Y6GB 1F6WA 1B16A 2VCEA 2CZQA 4O4HA 3RHSA 1AKUA 4D80A 3FTEA 4I66A 3MUOA 3QLUA 2BMFA 3OTGA 4MR8B 2BFOA 1KMHA 2A0KA 1JA9A 3FOZA 4NBNA 2CMGA 4MOWA 1B8NA 4KPYA 2ZUSA 4ZANA 2NV2B 5K7SA 4RGYA 3HGMA 1A4RA 4LJ9A 5K0GA 3GP8A 3KOZA 4CM7A 4RVHA 2BF7A 3O95A 2PY6A 3PNBA 4TVBA 5LIRA 3IPCA 3K1YA 3UJ3X 1YJCA 3OE7A 3T5CA 5JV5A 1ZW6A 1XHFA 3QUCA 4UUPA 3RU2A 5M3BA 3W2GA 4D79A 3HC7A 2DPHA 3UCFA 1SKMA 1N3IA 1W1UA 1I01A 2DPMA 4EG0A 5HJ2A 1GTG1 1F48A 1GPAA 1WBJB 4L74A 4L22A 4ZPXA 3WE7A 3ZYZA 4NPAA 5BMOA 2BEVA 1GLNA 2IGBA 3G5LA 1JEAA 5FAXA 1TJ5A 1V7QA 5CLHA 3KT6A 1JALA 3BDVA 4P6VF 5F78A 3W2IA 4ANFA 2JVIA 3OO0A 5CLJA 1E4OA 1U0TA 4M0FA 4CR8A 3IC5A 2QEQA 3IAM1 3THRA 4P3OA 3DLBA 1WZUA 3V8VA 2FN9A 3N5KA 1S2OA 2H29A 4EG3A 3MLAA 3O75A 3P9YA 1FUKA 1P0PA 4OB6A 4B6OA 4YJKA 5WRFA 1HY3A 3U7RA 2AR7A 4L15A 5C32A 2NYVA 4CTOA 3DNMA 3PC8A 6PFKA 1DO0A 4D41A 2ZRCA 3P52A 3ORFA 4RKEA 2ONJA 5A5EA 2J31A 2YV3A 1TTHA 2HDNB 3H3XA 3OJOA 5EP4A 1Z35A 1NN3A 4PX3A 1P1FA 1FZQA 5AVQA 1YA6A 1JAIA 1IQ0A 2VT6A 3KSBC 2CJWA 5IUKC 3AUTA 4AUEA 1A4XA 1Q0HA 4YRRA 2UVDA 3LY5A 1CT9A 3DMRA 2O48X 1HA3A 3I9FA 2GVDC 3TFOA 1V45E 3MWJA 4TZTA 4JUCA 2EKLA 4QT0A 5A2GA 3AVUA 4UNNA 2O7QA 1CR6A 4K3VA 4K7JA 4MTLA 2QXYA 3WA7A 2WTUA 1LXCA 1DSSG 1VQ1A 3OC0A 3QSGA 4KMMA 2BY4A 5J5CA 3W90A 4ARUA 4BO8A 4D92A 3TZKA 4I4TB 1KA9H 1PNQA 3LC2O 2XB9A 5EIFA 4ZA2A 3NFRA 5DOZA 1Z17A 1SC3A 2RGEA 4WV3A 2YZMA 2XY4A 5F5NA 4AAYA 4WN9A 3ZDCA 3GJ8A 3PC2A 2PVCA 4RK7A 3REFA 3VU0A 2C5GA 1EG7A 4M88A 1FX0B 1LS1A 3T7DA 1M0WA 1SKBA 2NYRA 4ENPA 4E1VA 2F1RA 4X84A 2J5XA 4QQRA 1PQ4A 3UYLA 4NJMB 4RABA 3T4XA 2EG9A 2JGAA 1PNTA 3GCGA 4MSUA 5BXYA 1XNQB 2BH9A 3D5EA 3WGMA 1U0RA 2MMCA 5JMTA 4WGFA 2J0UA 2XF2A 4TLCA 3CVYA 3Q8KA 5CFPA 1N2XA 3WSWA 4V0QA 3H1FA 4KFRA 1L7PA 1PJ3A 1SXIA 2DLNA 2PBZA 2EWMA 5IDVA 5TF4A 621PA 2VDJA 5BN1A 3QFCA 4UM9D 1DAFA 1T13A 4KYVA 4ZVPA 2IYPA 1TKRA 2VFAA 4JBYA 4L1KA 4PHGA 2BDEA 1F2TA 4J16A 3BHMA 4OI0A 3KQHA 1VLQA 4BNYA 3B60A 1PGPA 4NJOA 4MPTA 1Z0FA 4MX8A 1A0OA 1I4OA 2W22A 4QBHA 4RCVA 5KVCA 3CZMA 1CERA 1JLLA 4KQIA 1NM5C 1P7PA 5JFOA 3QVTA 4EPRA 3TDNA 2Y1GA 3NAZA 2ZJ6A 3VDQA 2REOA 2QORA 1WLSA 1L4UA 3NANA 1UOPA 4JYPA 4TTTS 4Y2GA 3SYMA 3GVHA 1N8SA 1AKNA 2SCUA 1UDWA 1FTYA 2MDTA 2Z95A 1NXTA 2A30A 4JX8A 1OH8A 3I9KA 3A25A 3QPCA 1JWLA 1PLKA 2JLVA 4CG0A 2WP8J 5DNVA 3GLQA 4KX3A 1HNXB 1INLA 4V2IA 4NEGA 2XCQA 4XJXA 4D46A 2F9FA 2ZAYA 1SKQA 5HF9A 4LCJA 4GKKB 2ZSUA 2IY9A 1CUUA 1SXHA 5JY6A 4TKVA 1MQAA 2P77A 4L8WB 4RENA 4XFJA 1VL8A 4IX1A 3TR5A 1XDBA 5CLIA 4YEDA 5JMWA 4FFMA 3TE7A 1VKNA 4FKZA 5BR8B 4I8IA 3NOQA 1XD2A 2XBMA 1TECE 1DELA 3LWBA 4OQNA 4KDRA 1KVSA 1HFWA 4LV8B 3IQEA 3H9BA 5EJ6A 4CIDA 4Z1MA 3UH0A 3ZIUA 4I5GA 3TQCA 2G83A 2HPHA 1LQUA 1JLMA 2P5UA 1G9TA 3THYB 1R0ZA 3DEIA 4M53A 3ZWWA 3LCUA 4OIMA 1OW3B 1ZPDA 5A02A 3DB1A 4XI9A 4X5OA 1Z0IA 4RFVA 2WHEA 1PT6A 3JZDA 4UVEA 4YIHA 2GFHA 2Q6IA 3NIDB 4LDAA 3KUXA 4X60A 5E3JA 4IQ4A 2PGXA 3PR1A 3G2NA 5L51A 2ISSD 4O25A 2W7TA 1F60A 4YAWA 3U48A 5KWVA 4CKEA 4EGSA 1RLUA 1T2EA 4MVXA 2M6SA 2FK7A 3INTA 3L9WA 4LXYA 2VDWA 3LLUA 2VNIA 2EJUA 4K5QA 4EX7A 1QYWA 3SXUB 2CC2A 2FQXA 2GN9A 2HMTA 1LDMA 2IU4A 3M4ZA 4ZC1A 1UDRA 3PGJA 3WJAA 3WMFA 3BZUA 2C3YA 5HF6A 1AA6A 3ZVNA 1NDQA 3THXA 2C5FA 4B87A 1FP7A 4CKZA 2D8MA 2MTBA 3ICOA 1RQLA 3OA0A 4LYDA 1DCTA 1F20A 1TJYA 1UK9A 2R11A 3CE6A 4U7PB 1T24A 2HHLA 5K3FB 3OUUA 2XKKA 1ORHA 1SG0A 1VKJA 1N9GA 5EJ7A 1YDHA 4EY5A 2Z43A 5KQSA 1HE4A 5EWLB 3TSCA 5JNSA 2NXEA 5F77A 3ONVA 3TAXA 5JAIA 1U7DA 5GPBA 1Q22A 4H2DA 1X7GA 5EHQA 2Z8YM 4XIJA 4B3MB 1T3TA 4ZQGA 2IODA 1EGQA 1VI5A 2Q8PA 4A1FA 1TW3A 2A3NA 1QGED 3VO1A 1NPTO 2WHXA 2HA4A 3G0CA 1R0WA 1KJYA 2F1KA 5AM1A 2ZBPA 3L4SO 3AKDA 4YLYA 1YQDA 3HU2A 4QXPA 3NP9A 1V39A 1IXSB 2FWAA 5E6RA 4GICA 4M46A 1M1ZA 4Q05A 4UCQA 3NNDA 5HSGA 2J3MA 2OCBA 4B2PA 2WIFA 1EGVB 5JXHA 2DP4E 3A4LA 3L7YA 1M0EA 3H86A 4X65B 1OXTA 1P2DA 2FMUA 1A9OA 2VSFA 5JJBA 2EFHB 1FPMA 3WLJA 4ZT6A 5FL7A 2A86A 1WMSA 1KEEB 2QTGA 4PNZA 5DM4A 1N6RA 1SCAA 3KXDA 5FD8A 5DRYA 1TCUA 2FGKA 2H9AA 2IE8A 3FB1A 4KWEA 1I2ZA 4K9PA 1K4MA 3BQMB 5C9ZA 5KKAA 3I2GA 4YMTA 2FKNA 1U4NA 5EPOA 3KEOA 1I94B 3QPBA 2DWOA 1LF0A 2AJTA 3P9KA 4O4IA 3D2BA 1MABB 2C58A 1RXWA 5EZ6B 5JXWA 1GN8A 1UBJS 1Q6ZA 4JI1B 2BEUB 3ZE6A 2EFDB 1V3VA 2D3WA 2JJ2D 2XKBA 4Q19A 1U1FA 3NONA 2VOJA 1R0CA 1FVHA 1ULTA 3IAEA 3JR3A 4UEOA 4QG7A 4ETWA 2OV3A 5JZMA 3GLGB 2QM7A 3P2EA 4HDMB 1G20A 1LPBB 1BEEA 1LV7A 3VV3A 5JJIA 1M8FA 3U26A 1O7JA 2XB8A 4RORA 1G8PA 4NPCA 4ALLA 4D0GA 1Z4MA 3LQKA 2NN3C 1Z62A 4XVCA 2EGUA 3FG9A 3M3DA 1X2BA 5BSFA 4FEAA 3VSEA 2BEJA 2BN4A 4G36A 1FFXA 2Z4TA 3W5AA 2WU1A 4CL3A 3VZQA 1ZUNA 4NYMR 4GSLA 2D1TA 1X38A 2ACVA 2AFHB 5GGXA 5DWVA 3Q8XB 5F33A 1NRJB 2GCEA 1SIOA 4AI6A 2GCGA 1UL1X 2ZE6A 4YONB 3GCDA 4GZ6A 4NICA 4PZYA 3GIDA 4D9FA 1ENOA 2ORYA 4RJIA 4MPPA 3T0FA 3GGGA 1Z5OA 3HJCA 2VC2B 4B8ZA 1BYUA 1GUBA 3FTFA 1NVDA 1KOFA 1ZS9A 2Y9PB 5IYZF 1EFRD 1KHHA 2I22A 3DV0B 4PYIA 3ZEIA 4BMDA 1CJCA 2A1UA 1XMJA 4FEGA 5CB6A 2XGMA 1OMOA 2WYWA 3IBGA 3BHJA 3HBMA 4UEKA 3E53A 2WF5A 4KGVA 1BHQ1 2ZRPA 3OIYA 1Y82A 4UTRA 3HFGA 4ZQCB 1JEEA 4QEKA 3KD3A 3ISJA 3OY7A 3X1JA 2JIOA 3Q5GA 5LUBA 1MNAA 4FWIB 3ZLVA 2YICA 3HVKA 3U1BA 4CXMA 2VHTA 2GD1O 2BM9A 2XWJI 3SP1A 5JCJD 3UMYA 2Q9BA 3OF5A 5AOBA 1C8BA 3EIWA 3L0OA 4ZGWA 3S2GA 1C50A 2FX2A 1DQNA 1XDSA 2ZRDA 4QPCA 4L72A 1YL5A 4BQPA 2YH2A 2EBFX 4MIKA 3I09A 3GEGA 2CXOA 2JAWA 1OOEA 3DOCA 3NWEA 2H1RA 3AI1A 3WZ2A 4BBAA 5AM0A 1JHXA 1N9ZA 3G2JA 2GJ8A 4Z4CA 4KQ1A 3D2AA 1NY5A 4TMYA 1ULHA 1RXSA 4TPKA 4AT1A 4M87A 2CY0A 2QQGA 3AT1A 1CJUC 1IN1A 1YQTA 2VHQA 4LWZA 1HEUA 1SBNE 3FYTA 4V1CA 3ELDA 3B6ZA 1NURA 3H6HA 4NBSA 3HY4A 4HKTA 3I72A 2FSIA 1XMQB 5G1OA 3U31A 2WSMA 4FFSA 3QVSA 3RVMA 5DHPA 1AHPA 1L5SA 1PFGA 5L3QB 2IX9A 1DCKA 1GQOA 2HK6A 1L9XA 5I9BA 2PBLA 2NV0A 3IT2A 4QRDA 2FMFA 4R7TA 4WZ6A 2XIQA 2AN5A 5IM4F 1C9DB 1VC2A 1LSJA 1KVRA 4I4IA 3LX4A 2FQWA 4Q1VA 3NTOA 1YBVA 4L02A 1X7WA 5IP5A 3RS8A 4WBSA 1L7BA 3VR5D 3X1KA 4PANA 4Q9JA 2X8LA 5IC5A 3W2EA 2H2WA 5TJHA 3WC4A 3OWHA 2YYYA 4LZOA 3JQ9C 4ND8A 3GWGA 1QP7A 4PXSA 1AURA 1CRWG 3NM5A 3W5BA 2W6OA 4B3RB 3A3YA 2WJAA 4Z3DA 4LJSA 2J46A 4BMXA 3R3ZA 4NMWA 2BI4A 4DCPA 4J75A 3ZWYA 3SZ3A 4MQEB 3VKUA 5HFNA 4CNBA 4JIMA 3NLLA 2JKZA 1R9MA 1BE8A 3SQNA 1SPBS 4X1YA 4QUIA 3DKKA 3RUIA 1TEXA 1WP4A 2D00A 2YV5A 4UDYX 3ZJYA 4LIPD 2Q5IA 4QPZA 3LKDA 2C4TA 4DRXB 5B5SA 1E3WB 3A1WA 5AVUA 1ZI9A 2PD6A 3GGPA 3UAWA 2PH3A 3P9RA 3SHVA 4DR5B 3UYKA 2OBXA 3VZCA 2AWOA 3T5GA 3CVXA 1A2BA 4UHDA 5E7IA 1JI0A 4HN2A 1JNXX 1U5CA 2EYQA 3BMCB 4ENWA 5KUTA 4PC6A 2X2PA 3B9QA 3TM5A 3GNSA 1NDHA 2JFFA 1Q15A 2NZJA 3MWLA 2HCBA 4KK3A 4RXMA 4OP1A 3PXDA 4R9VA 3WLMA 1C81A 4GC9A 4V1CB 2G17A 2XT9A 3ZC3A 1I7SB 4NZNA 3ZV4A 1Q1AA 1RRMA 4B33A 2A5LA 5IULC 5K4HA 4ED9A 2ZB2A 1ADBA 1XZLA 5MN6A 2XXJA 4OU5A 3OJWA 1ZN9A 2GZ2A 2HF2A 3L7NA 5A3VA 2VF7A 4F45A 5J9FA 2IH5A 1HXHA 4PC3A 5F12A 1QORA 1TMGE 1XMIA 3T9BA 3UA3A 3ZNNA 4KR6A 5G4KB 1E8NA 4R1NA 4HR7A 1XMOB 1Q7EA 5BT9A 5KTOA 3TNYA 2WKWA 2VJOA 1SIWA 2ZVDA 5EKSA 5TPWB 3GUVA 4DM4A 1FU8A 2ONKA 2HADA 2FZWA 3IRUA 3KZCA 4X3CA 3DC2A 3O4FA 4EUSA 1LRKA 3SVTA 1CUAA 1Z0AA 2I80A 1FDTA 2MSNA 3PHHA 2LZ0A 2P9FA 3P9QA 4RCYA 3LBAA 3HN2A 1RRCA 1JSLA 2O8CA 5F7JA 2CB9A 2Z2KA 1V1MB 1XCOA 4UDNA 5KJ1A 5LQNA 1Q77A 4B6QA 2CJYA 5T67A 3K6SB 1QNFA 2V7VA 4FLEA 1M6NA 3AGPA 2CVPA 1NI4B 3JQBC 3OI7A 2PL1A 4L4SA 3NC0C 1Q83A 4AO7A 2VRCA 3TH5A 4UU0A 1S2MA 1RRVA 3K32A 3NVMB 4R2MA 4AN4A 4DYVA 3K73O 1S2IA 2CUNA 2LPMA 2PA3A 2R84A 4H3HB 4CZ2A 4RTMA 2OB1A 3H5AA 5LFAA 4HAUA 4YCMA 1EJBA 3O94A 5D1NA 5EIXA 4KR3A 1D0IA 3R3HA 3WLPA 3INRA 4DOMA 3D31A 1U7OA 1FYWA 2Q6LA 1X8XA 4FEEA 1XF9A 1XYVA 2WSIA 2ZETA 5LMNB 4KV7A 4TUYA 1FQOA 1CIJA 4YPFA 2DECA 1E2FA 5EE5B 2XOXA 4L3WA 5CDHA 1COWD 1PUIA 2JJQA 3N6RA 4HGPA 1JPVA 6Q21A 2FG6C 3DKVA 4HNAA 1SVLA 3UXYA 1PG5A 5A3RA 2H7VA 1EDEA 5A9SB 4B3GA 3W4JA 3L0SA 1BAPA 3JPYA 4OBEA 1QE3A 2H00A 2OG2A 2QX6A 3WLOA 1XLWA 1RABA 1MOSA 4MUGA 3NDPA 2TMDA 1GZ3A 4WZAE 1B8OA 2JH8A 3JQFC 4L5IA 4XYMA 4LF8B 4Q7JB 1OI7A 1WKBA 3NEJA 3PKZA 5K5EA 1V4BA 1ETHA 2WYHA 5FULA 1LLUA 1CSEE 3FBGA 2DUJA 3A6EA 3CUTA 5DXJA 5KC9A 3LHKA 4MVWA 2V1UA 3DT8A 5CXUA 2QL9A 1T8TA 4LXUA 4DTCA 5HKOA 1YHNA 4PZEA 1HDRA 1X15A 2R65A 5HK9A 3G1TA 4WX2B 1ZITA 3BQNB 1BO6A 3ZHXA 1H2ZA 1P3JA 3HZHA 1HT2E 4C29A 1X7ZB 1YB5A 3WB1A 3PCXA 1NMYA 1TOAA 3KQMA 3EMDA 2FCRA 2I3BA 5EJAA 5K05A 3G2PA 3TBFA 2DUNA 3C3WA 4A2CA 1KI6B 2O2JA 1HFEL 2A67A 2EFJA 1FDWA 2Z5GA 1DG3A 3B3JA 4IF4A 4LJ6A 4WDQA 4XVQA 3VC3A 1Z2AA 2V1XA 5CD1A 1TIBA 2X0KA 2GZSA 4YFVA 2HXGA 2M6RA 1FFGA 1M1YA 3QKRA 1HLDA 1RDFA 1SKAA 1TYEB 2YC2C 5K0NA 1YVRA 3SQDA 2PXCA 1F8GA 3ESDA 5F4ZA 2F1HA 2HNBA 3KTDA 4AUMA 1P18A 2QYOA 3ACBA 4J07A 4OHXA 4J9VA 4TTPA 1OLXA 2UVQA 2FSUA 3B1YA 1XZCA 3RSOA 3AV3A 2QG4A 1WB4A 1I33A 3ZHZA 1G8KA 3IJPA 3WNBA 1AM4D 2DCMA 3RC3A 5LYJA 2QUHA 3BYZA 1DOHA 1NC3A 1CUZA 3VZRA 1GPDG 1VCNA 1TVKB 3R7FA 5B30A 5K8LA 5BN5B 1YVPA 1WNTA 4MQBA 1XLTC 4Y98A 4WQMA 2JFNA 4G86A 2REQA 4OFWA 1NNSA 2QVZX 4JBLA 1KY3A 3N2GA 5JCXA 3NRBA 5F2OA 3T5DA 4KIJA 1WHTB 2GI4A 4NZMA 5CGQB 1Q0TA 2MR6A 4H1HA 1FXWA 3FMGA 1X1TA 2D7DA 1IRIA 1ZGZA 4PGMA 4QLOA 1N0HA 1XG5A 4EW2A 2LRHA 4P83A 4R54A 3LT5A 1TVCA 5C8YF 3GBPA 5KMGA 2XCUA 1PI3A 1M1NA 3PTZA 1RJWA 5FPHA 4AWBA 2YWHA 5AVWA 4WLUA 2PEYA 2V6GA 2FPIA 3GLGE 3BZWA 3CLTD 2ZYWX 5EXEA 3NYQA 4M9CA 3VNBA 5C4MA 5E3HA 3GVPA 4DJ5X 2HHAA 2JEYA 3QPDA 3W2FA 1XEFA 3CR7A 3NKLA 3LFTA 1T6BY 2WQ7A 1V1JA 3M6VA 3F96A 3I64A 3Q12A 4WMLA 3WKDA 4RACA 4I55B 4YGXB 4TYQA 1I7LA 2X9LA 2XVMA 3VO8A 2Y1OA 4CM8A 2AR9A 4JL6A 3RJ5A 5B2ZA 3AFIA 1KY5A 3IKJA 1JKMA 3DLAA 3EEBA 2ATEA 1VGRA 3QFTA 1ABFA 1YVEI 3ZLTA 4NU6A 3M70A 1D2GA 2VAPA 3WQBA 2IVZA 4HUTA 2VJBA 2VWQA 3W9YA 1G5QA 3B3QA 3M3PA 4QUDA 5AW0A 4IRMA 1Z36A 5IZCC 1LA2A 1P39A 5I7UA 4RL6A 4BDSA 2J9YB 3MRXA 2I91A 1GLVA 3D3NA 4NXMB 2O8DB 3ABSB 4RF4A 4ZO7A 3MT7A 2PMFA 4XYGA 4EHHA 4DBLE 1IY1A 1Q21A 1P17A 4WH0A 7REQB 5DU2A 1FYVA 1L5FA 2Y0PA 3L7MA 3LPAA 1L4GA 1ZD3A 2BGTA 4GLFA 4FYWA 4KIGA 4FX5A 3GNTA 1NR1A 1RFGE 4NCXA 4GLOA 3WYGA 1V1RB 2ZUUA 4KX5A 3VMFA 1CRZA 2Y2UA 2YJNA 2QTBA 3H9CA 1KJ8A 3MJRA 2RGBA 3KVOA 4KO8A 3D59A 4LRUA 3X1XA 5FEUA 1UF9A 4MRMA 4HLQB 3B8HA 5AOCA 2ODAA 1UAYA 3WIEA 2Z2YA 1GNRA 1KARA 1FYEA 2QIPA 2VN8A 2XUIA 3AFHA 1U1DA 2B4YA 3OVMA 2EIHA 2CXQA 3PR2B 1TEHA 3ZU2A 2HSZA 4JB8A 1IPEA 1NATA 1WHSA 3AXTA 3Q41A 3ZJ5A 5LMCA 1O97C 2AUNA 4CQMA 4IICA 1GR0A 2CJXA 4GGOA 2EBWA 3CSUA 2QR5A 4UATA 2AF4C 1IK4A 4BMOB 1P2FA 2J32A 2A8YA 1ABEA 5MFPA 5HE8A 1YBAA 1HDIA 1XLUA 2X4LA 2AZ4A 3F5DA 5B6PA 4E07A 2CEKA 1M2FA 1GAJA 3N8GA 4IL5A 3S55A 3NYIA 1L3BA 2NMVA 1S2DA 4EMUA 3ZWKA 5IJ0B 3ZJUA 3D6MA 2GF2A 1Z2OX 3NT5A 3PIIA 3ED5A 2H85A 2V7TA 4Q4JB 4IOLA 3TLXA 4B9EA 3FKSD 1A9PA 1SU6A 1AKMA 1B6SA 2DTDA 4IGIA 4CMCA 4ZHQA 2PUBA 2EC5A 1L5RA 2PCJA 3OEWA 4UREA 1A2QA 2HSEA 1SO8A 2QAGA 4PLWA 1SMKA 4PX9A 3O8OA 4QLBA 2PIDA 5HQ3A 1XPOA 1TJPB 1Z28A 1G9XA 2NVBA 1G20E 2ZRJA 3T6KA 1TNDA 1C0PA 3TKYA 4UTNA 2PSFA 1X86B 3P4UA 5JO9A 1AKRA 2AJBA 1CG6A 2J5RA 3VOSA 1YUBA 2CJWB 2ZYAA 2ZYHA 3KEFA 3D81A 4OAPA 1IZ7A 5G4LA 4KLZA 4E14A 1QPZA 1IN8A 4YJFB 3HKCA 1PFKA 3ON5A 3V8EA 2UZ0A 3M3HA 3A70A 2D6FA 1FUYB 4CMGA 3DONA 1HK7A 2RGWA 2VEOA 4KPUA 1P2GA 2A1IA 4ML3A 1UQRA 4PYQA 3USZA 1XNRB 1EUDA 1RAEA 1A7JA 1BFDA 3D1JA 3PPWA 4G8JA 4WXMA 2RI6A 4QFBA 2X2EA 1ZNYA 2ZXFA 3B53X 4TT3A 5TEVA 4UFNA 1ESCA 2V5VA 3ABOB 2XDWA 4HAZA 3NVDA 1CF2O 2PZGA 4LYHA 2OLKA 3GAFA 3OWOA 2IU6A 2YQ4A 3L6CA 3GJ4A 3ORHA 4LK2A 1U7HA 4V0ME 5EVCA 5FFMA 5CA0A 2CSXA 4OK5A 1A5TA 4AROA 2Q6VA 3CY6A 1CUCA 3CU5A 5IPFA 5JD4A 1WUJS 1DFIA 1L1FA 1RWPA 1NUSA 3TMKA 2RD2A 1OLXB 1TKAA 1U63A 3PBKA 3VR1A 4B3FX 3IPYA 5J4LA 4UPEA 2B5VA 2FPPB 2FFQA 1K2VN 3ZD7A 1JFLA 1N2EA 3RYHA 1C9MA 1QC5A 4J7UA 1N2HA 4ZYYA 5LJIA 3AZPA 3EH2A 4GI5A 2QUIA 5FA8A 3FYHA 5KIAA 1MPTA 4MW0A 2HAEA 4ZGBA 4XRGA 1T2NA 2FFRA 3EGVA 4R9UC 4AMVA 1QJ4A 2YCLA 5C8YB 4ZQEA 4HNTA 5KOJB 3ENKA 4W9MC 3AW8A 3WXMA 3FZGA 5KNCD 2PZFA 1KBZA 2H4YA 1C1XA 2GZ1A 2VJCA 1YQ9A 1SBZA 2ZJ4A 3KD2A 1U8TA 1G5HA 2O3UA 1LDNA 4G5FA 4G4SP 1UBLS 4O4HB 4YDRA 2F8SA 1D8AA 1W29A 2JIRA 3ILVA 1U28A 1VKZA 2ZWVA 5IM4A 1V8DA 2RH8A 1D7AA 1E1MA 4HX2A 3BDAA 3GFGA 3ZY2A 4OQZA 1C0EA 5L4SA 3QKSB 4W82A 5LQSA 1JE1A 2JFGA 2K4MA 1GDHA 4FJ1A 3ZIDA 4Z1MD 3LNTA 2IVFA 5AW1A 1W5SA 1XVTA 1Y34E 3HWSA 1UOOA 3AR8A 3SKXA 1OXXK 1GT91 4MWGA 1MAUA 3DQZA 3PD1A 1F2UA 3AC0A 4OUDA 1KQNA 4Z4FA 1PWEA 4OK6A 4DDMA 3AF3A 3IQXA 2QX9A 3M1YA 3TMAA 2BM1A 4TT3D 1ST3A 1BGWA 1R6XA 2XUQA 1ZUWA 1P9WA 2AEMA 3JATA 3KUKA 1U3VA 2FSVA 5BR4A 3VYVA 4LRXA 3WLTA 2G09A 4LHXA 4RV5A 4PGFA 5DKFA 3DHNA 1ZICA 2Q6TA 2HU5A 3D3JA 3IBYA 4RZUA 4DV0B 1W36B 3TL6A 4DNQA 2ZJBA 1MR3F 5JDIC 2JAXA 4BEVA 1P74A 4HWKA 1V96A 1W59A 4Y18A 5HRUA 1AXGA 3WL6A 5HZHA 3KZVA 3HCPA 4JXXA 4PIVA 4QQKA 4CV1A 2HZBA 3HCBA 1P77A 2WWFA 3GIWA 4DNOA 5IZ4A 4C7OA 5JLJA 4Y1RB 4G0NA 3FUVA 1QRTA 2OZLA 3QXSA 2PGJA 3G0IA 1MAAA 1SCDA 1YJXA 3CZ5A 1V8FA 3NBMA 4HH3C 5ADWA 4WBNF 4FBGA 5ANRB 1H69A 2WKQA 1ZD9A 3FKSA 3NG1A 3KX2A 4K9OA 1VLHA 1KI3A 5FOSA 1EK1A 4DZZA 2A5DA 2WBLC 1RZUA 2EL7A 1JXMA 4G3XA 2GN2A 4KI7A 4LE1A 3TSWA 1CCWA 3P0RA 3SLRA 4DRYA 4NEHB 5JARA 4BLQA 1Z6XA 5DNCA 4XUDA 4DR1B 3C7CB 4N5DA 4B7XA 1EWTA 1TD9A 3NCTA 4OMCA 4MI9A 1JDUA 1DIOB 3LI2A 3E5MA 4RD6A 2OYCA 4YGYA 3KJQA 3QEJA 4HNQA 5K2OA 1EQUA 1KO4A 4JJ6A 5BRJA 4O3MA 1EUCA 1N2SA 1TYBE 1N7IA 2JGKA 3R77A 3U4QA 1K89A 4RE6A 4PFJA 3VPDA 2QMQA 2C7GA 3H9EO 1IU9A 3KDPA 1L7XA 1PR0A 3BUSA 3PE4A 3DMTC 5AUOB 1CIPA 2WZCA 3ZVLA 1DLIA 4M3NA 2BGLA 2JI7A 1ILWA 1O95C 1Y5LA 3BMQA 1NBWB 4W9RA 4DQLA 1ICIA 3GELA 4HP8A 1KSFX 4IEIA 1QE5A 3JW8A 4HB4A 1FA9A 3HYTA 1XRQA 1XXLA 1ND6A 3HI6A 1VKOA 3OM1A 4TMWA 4TLDA 3TLMA 4BIMA 1JEYA 4D6XA 5EUQB 5D1HA 1IZZA 3QG5A 3ZTYA 5FA6A 1J8DA 3CBGA 3EF0A 2ACWA 1XZFA 3QHQA 3G5MA 4H7IA 1V6SA 3UKDA 1FFAA 2FPXA 3DE4X 1Z7GA 3LBFA 4TMZA 3RVSA 1E1YA 5FOQA 1O5TA 1QO9A 1FDVA 2CDCA 2EZ9A 2IRWA 3TW0A 2NQTA 1PK7A 4B4KA 5FUMA 5BQXA 1B14A 4CM1A 2X0NA 2Y1XA 4NBKA 1B0PA 3FPCA 2C95A 3AF1A 3MCWA 3I6IA 3N0XA 3DVAB 4F5WA 3ILXA 1V48A 3ENNA 3UVEA 3DFMA 3IIMA 4UD6A 3F3YA 1T91A 5ED0A 3H11A 4RSRA 1Y3CE 4UM9B 1O6FA 2O2DA 3H1AA 3PFFA 4AJEA 2A5YB 4B84A 4KVZA 3V8NA 5FA5A 2JFYA 1F2DA 3GFOA 4YI5A 1ULAA 1I6MA 2HT6A 5CH3A 1PZMA 3N75A 5SICE 3NNSA 1O5OA 2GPNA 3AONB 2YOGA 3FYUB 4R41A 5F52A 4QVKA 5EOVA 1WRBA 1J2TA 1UJ2A 1R27A 4RELA 4OJQA 4ALKA 2A1UB 2F67A 3TDMA 4B0PA 4QJIA 4KXWA 3A4MA 4XFDA 1CRQA 1JN0A 5DCYA 3BD9A 1OFHA 3WQRA 2AMJA 5KCMA 3PI6A 4C78A 5I7HA 4WLOA 1LDYA 3DEFA 4FGLA 3DAFA 3W9SA 4CF4A 1OZAA 4TWRA 4Q9HA 3TINA 2ADFA 1B8PA 1NQWA 2BVNA 2O7RA 2PRIA 2ZCUA 3K8YA 1QGDA 5THXA 2O59A 3ZLUA 4LJ8A 3JCZA 4G9EA 1JA1A 2PUAA 1EX7A 3E05A 4C7OB 3UK2A 1EP1B 4K6KA 2OMKA 3QWFA 5FLEX 5CB8A 2YIVX 3C1AA 1SOUA 3AOEA 3AFMA 3O03A 3TTWA 4D4IA 5H81A 1SCKA 1CNMA 1IFXA 1H8HA 5TMBA 2OPHA 4XPIB 1GCOA 4JT9A 1GQQA 5BWLA 3G13A 2I8AA 1AUVA 2L19A 2CVZA 1XZNA 5CNJA 2WB2A 3THXB 2XRZA 1GQYA 3L7KA 4YASA 3RASA 3QQ5A 3TPFA 3VO2A 3C7TA 2J3IA 3TRIA 4DXAA 4KYIB 3VAAA 2DR2A 5DYYA 1B6TA 5FORA 1PJCA 3D8HA 2VQ3A 3HB9A 4QDXA 5IMSA 5JRDS 3D43A 3RJMA 2NUAB 3UNXA 1Y5RA 2E4VA 3KCQA 3IA7A 3L8EA 1SUAA 4PZCA 1U65A 1TIPA 2P6PA 1KVUA 1M6EX 2EZTA 2WTAA 3GAAA 2ZB7A 5ALDA 2HPZA 3W5CA 2W6ID 1XEWX 2OAEA 1UPFA 3AERA 4NOKA 3UHJA 5BW5A 2IU0A 2B0JA 4PYMA 3G9QA 3C87A 4LMAA 3DWGA 1GD1O 4BEJA 1CTQA 1CWUA 3Q9NA 5CLGA 3HJBA 2FY8A 1E9EA 4WKNA 3DW1X 5KVSA 4B4VA 3B7PA 1CPYA 1FMFA 3CXUA 5LL6P 1F14A 3JASB 1BU8A 3HRIA 4UM7A 3PEWA 1JMKC 2KPOA 4AN0A 1TIKA 1E60A 4J0EA 1W36D 2FLKA 4UPDA 3V2HA 1CKEA 4HB2A 1XD2B 2PT9A 3HKBA 1JJ7A 3QBTA 3FPJA 3COZA 2E2WA 3LCVB 4MNTA 3G7SA 3DZJA 3HEBA 3Q7IA 4I9NA 4MVJE 5FTMA 3SF8A 4AJ1A 3DKPA 4F93B 4RTSA 2KQUA 1H4VB 2W42A 4ZYXA 4MGIR 3UA4A 1LRLA 1VG0B 3Q7TA 4I4LA 4NULA 5DULA 3R7WB 4J4TA 3QOFA 1I2MA 5IABA 2VSNA 2XBUA 1N3LA 1FJXA 3HDTA 3VQTA 4XTCS 3SX4A 3GAMA 4K9SA 4U2CA 3VPAA 2IEYA 1N7JA 2Q5EA 2VEDA 3EVCA 4X1OA 2OD7A 1CZKA 1WAMA 3AR6A 3EIEA 3O8DA 4EHFA 3KYCA 4HAIA 4B34A 5JS7A 5LMUB 3A9WA 1VPVA 3QLEA 4OLHA 4QRIA 1ZMBA 2F59A 3ZOZA 4ZK2A 1PT5A 2RAUA 4IFTA 2QRVB 2WE7A 1RMYA 1SVIA 2IP4A 3CLUC 4S24A 3VR4D 3FUXA 1QCCA 4RH1A 2WUFA 4GMXA 3DHYA 1O3YA 4A0RA 3LO5A 4XEUA 4AP9A 4PQGA 3V8BA 3VDMA 2WJIA 3WZLA 5DK6A 3RAJA 1WETA 2VYVA 3M5DA 4URYR 1VBKA 4BTLA 2J9GA 3GGJA 3HCWA 5AKHA 3STWA 4OI2A 5D3ZA 5CAEB 2BUAA 5AHRA 2H08A 3GFRA 4IRXA 1MIOB 4FDAA 4ZO8A 5HMLA 5G0WA 4RWZA 4LJ7A 1ZQ9A 3GEHA 5B7GA 2JI4A 2A7XA 4KQ9A 5ALEA 3GBSA 3UPTA 5BSGA 1RI4A 1WW2A 3JALA 3VHLB 1J99A 3LQYA 4WADA 3U5TA 3AG5A 5JJCA 1UT6A 2A0UA 3LCRA 1GKLA 3TMYA 3ETGA 1NUAA 2XYPA 1YULA 5KC8A 2PSJA 1NBME 3I12A 1IDOA 1D07A 1ZHFA 3AVPA 4U8GA 5E0KB 2JJ8A 4F91B 5U1PA 4II7A 1MRNA 3ZY4A 2Z5LA 3FF1A 3ZZ1A 3T1VA 3SDSA 1B23P 4Z53A 1U3GA 4R3WA 1PX0A 1V3QE 3ESCA 4YRJA 2PJUA 2YWEA 3NHKA 4KZPA 3AUFA 3B1VA 2HM7A 3RYIA 3T3HA 3EZGA 1CYEA 3FJOA 4MCAA 2LXNA 5ECGC 3ZXUB 3EUWA 2YHAA 1F1JA 3RM3A 1PHPA 1F6BA 3H2BA 1SWWA 3M49A 5FCDA 3S7TA 4YCAA 3RUPA 3KB6A 4PS1A 3CLVA 1JFFB 4NZPA 4RY8A 3HADA 3L4BC 4OYRA 3TSZA 2C0PA 2DC1A 3V9AA 3DZDA 2A57A 3ZWBA 1IHXA 3A0UA 3H7AA 2IHYA 5ECYA 5FPTA 3TL2A 3QSYA 1SUFA 4Y1RA 3IVRA 4GOKA 4TZ6A 2F8LA 1TPYA 4ZTUB 1ECGA 1MT0A 3FN4A 1VHJA 2KS6A 3X2SA 4NG4A 3UJ7A 2FUCA 3BC1A 1SAYA 5ESDA 1UAGA 1DCFA 2EX4A 2JGJA 2NQ8A 1SA0B 4GX1A 5CLLA 4YIKA 3TEJA 5CBPA 2BHSA 3NJ4A 4LXGA 5CX1B 3T3GA 5JNUA 2EV9A 3P2KA 1YU6A 1ZJWA 1KQ3A 3U81A 1VJRA 1M7HA 2Z08A 1ZN8A 2ODTX 1U3FA 3IQDB 3C98A 3IT0A 4LYYA 2ZSBA 3I61A 3P0EA 5LD2C 4EUNA 4TS4A 4FGSA 3GJXC 1EVEA 3I8OA 5HKKA 2DJ5A 3GDWA 1DAMA 3MN1A 3WGGA 5EHGA 1JBEA 5LU8A 4U7DA 2ZAGA 1BN6A 1EVYA 4EHBA 1AKWA 4CUZA 3OEYA 3LE8A 2PSSA 1XDWA 2JA2A 3N7TA 3AILA 3OQJA 4KRXA 2ZJ5A 3RQIA 4G24A 4GWKA 2I4RA 4WCFC 2C03A 1JLSA 3AVVA 1VE7A 2XWPA 1IEQA 3FM9A 2VZ9A 1QU3A 1UPTA 4O4IF 3VTFA 5LXTB 4MW2A 4OQMA 1GFZA 1D4AA 1ZYUA 3T7JA 5KQPA 3NMUF 5IHPA 2VCHA 4U6SA 4RANA 4J43A 3UMSA 3CEJA 2AOXA 2WU3A 3SF0A 2IXFA 1T1JA 1DARA 3E7DA 4N7BA 4F6CA 3N8DA 4YS6A 2QUBA 1YJQA 3T7IA 4B3XA 2Q5CA 4DCJA 4EPWA 3O21A 4JJ8A 3SEZA 3L3BA 1KMHB 1O77A 4NCJA 1GA4A 1U2GC 3L79A 3PHJA 1YJ8A 3K35A 3BSYA 4AM8A 3GN2A 1PZGA 1U2EA 4H17A 5DEOA 5E9QA 5C7YA 2HHJA 4MV4A 1DIRA 3QPUA 4LE0A 1X7YB 3AVWA 1E1RD 1RWKA 1UM9B 2DGDA 2R97A 3BRCA 2ZPTX 4DJEC 1NWHA 5FAKA 3FBWA 4HDRB 1X3LA 3PE3A 4QU5A 5KDLA 4YRZA 1CUJA 3RWMB 1MIHA 3O8LA 3WMGA 2QN1A 4Q4AB 3DO6A 4XXHA 3RU9A 3W5DA 3R0ZA 4ZVTA 5HCUA 4DC1A 2CL7X 3N2GB 3E9EA 2EIXA 5JROA 3GLVA 3A6HA 4D3DA 4BVBA 4HQRA 4EX6A 3EA0A 3QA9A 3CW8X 2J7PD 3L40A 5EHZA 4MUHA 4OSEA 3VSBA 3CS3A 1A1VA 2X22A 4FGJA 3K0BA 1RQ2A 4H3SA 5ELLA 1X0XA 2BFFB 3E7PA 1ZY2A 5CNIA 1MBZA 4TKUA 1U3UA 4DV4B 3RAEC 3EUAA 1TD1A 1RI5A 2W58A 3CKMA 4MEJA 1E0SA 4X1IB 1NN1A 1SY7A 1QZ3A 2PZLA 4F60A 4GOND 4QBGB 1KGDA 2IXGA 2ZWAA 3ET4A