4NBTA

Crystal structure of fabg from acholeplasma laidlawii
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
239
structure length
239
Chain Sequence
KKLEGKVAVITGGAKGLGQAIALAYAEEGAKVIAGDLGDLTYSHPNVEGMYLNVTDVTGVEKFYQSVIDKYGKIDILVNNAGITKDAMTRKMTEAQWDAVIDVNLKGVFNLTRLVGPQMQTNGYGSIINISSVVGVFGNIGQANYAATKAGVIGLTMTWAKEFALKGANVRVNAIAPGYIMTDILKTVPQDLLDKFAALTMLNRLGQPEEIAKVALFLASDDASYVTGQTINVNGGMRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and Structural Studies of NADH-Dependent FabG Used To Increase the Bacterial Production of Fatty Acids under Anaerobic Conditions.
pubmed doi rcsb
source organism Acholeplasma laidlawii
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase
total genus 89
structure length 239
sequence length 239
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2013-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4nbtA00
1ISGA 4J91A 2G1UA 3BXXA 4Q3DA 2G5CA 4XRGA 3RUHA 3BZUA 4PZCA 1QP8A 4L4RA 3ZWXA 1BW9B 3GMSA 1EQ2A 1Z7BA 3QJ5A 2CNBA 2PZLA 4EITA 5T67A 1VL0A 4MVJI 2BGLA 4W99A 3JQEA 1F12A 2EG9A 2WD8A 1HE4A 3GLQA 3BTSA 4XCVA 4RVGA 1XU7A 1YONA 4Z3DA 4W82A 4BKUA 3CTMA 5FI5A 4W9NA 1DRUA 2YHIB 2VWGA 4CLRA 4EEZA 4E2XA 3VDQA 3W8DA 3C7DB 4LRTB 4OKNA 1BDBA 3F47A 2GZ1A 3R3JA 4L74A 3PIIA 3EDMA 4Q3EA 3BTUA 4DLBA 4CMBA 3H9GA 4F6LA 1EVZA 3B1FA 1KOLA 1DLIA 3AUTA 4ID9A 4UUOA 4IIVA 2QQ5A 4R5MA 3FF4A 3HB4X 2PNFA 4AL4A 1PZFA 3U5TA 1X13A 3PHHA 2O2YA 1OMOA 1MB4A 2BF7A 3JQGA 4CM3A 1T2EA 1BXGA 3PEFA 1FDWA 5I7EA 3SJ7A 1L7EA 2X86A 3RUAA 4CMHA 5IZCC 4FQ8A 1R6DA 1VM6A 2VUUA 4JLWA 4QO8A 5IN5A 1Y7TA 2J5RA 1NHGA 1RM0A 1F8GA 1A9ZA 1F8FA 1M75A 1KERA 2Y93A 3RQSA 3OETA 1HT0A 2QRLA 4PLFA 3JQCA 3JD2A 1I2BA 4CR7A 3I9KA 1QYCA 4E30A 2IDZA 3FWNA 4FS3A 2D5AA 4J1QA 1BG6A 1DO8A 1LLDA 2V65A 3WXBA 2DLDA 3ONEA 4O0LA 1U4SA 1R0SA 4PG5A 4NBRA 4BVAA 1LSUA 3GHHA 4YT4A 1HZZA 1V35A 1H2HA 3PLNA 2HMSA 1M6HA 2B5WA 4ZQEA 5L40A 2RIRA 1OOEA 3C24A 3I83A 1T1SA 2X8LA 4I5GA 3OEYA 3DXFA 3OJFA 4XQEA 4UAGA 4DYDA 3IL2A 2O48X 3WS7A 2IXBA 1ISJA 1NQOA 1T4DA 4XYEA 3S2FA 2QZ9A 2D3TA 1A72A 5K9ZA 3KRTA 1BVRA 3WJAA 4IIUA 1LRLA 1HDZA 3T4EA 2IEDA 1TXGA 4FW8A 4PLVA 4C7JA 1CWUA 4Z9XA 4J7XA 3S2IA 1YGYA 2B0JA 3E5MA 4GSKA 3GZNA 1HE2A 2PTGA 2PV7A 1CF2O 2HMVA 1LUAA 3VH2A 1ARZA 4E2YA 4A2CA 3GNSA 1DC6A 2NUAA 1NR1A 3VZRA 3E48A 5G0VA 3MOIA 3OMLA 5GMOA 4XR4A 1CDOA 4L4SA 2DM6A 3GDGA 1RM3A 4QTZA 1VE9A 1CIVA 3U4HA 3BMNA 3L4BA 4BNZA 5ITWA 4U5QA 2EERA 3PQFA 1HDYA 3PGXA 1P1IA 3PWSA 2YDXA 3T7CA 3B6ZA 3GH3A 1JW9B 2EW2A 5A04A 4E5PA 1ISHA 1HE3A 3A14A 4E13A 3KSDO 3QW2A 3L07A 1HYHA 2ZTLA 3GT0A 2BHLA 3P7MA 5CPFA 3HHPA 3IUPA 3WGHA 1J4AA 1UUFA 4EGFA 3QQPA 2EHDA 3C3XA 2P4QA 1BHSA 4C4OA 4JN6B 4FPXA 2FRDA 5G0SA 4CMEA 3IJRA 4WGGA 3OEWA 4B4WA 3JSAA 4W6ZA 3TFOA 1YOVB 3CUKA 3IP3A 1I10A 1YDWA 4HXYA 5G4LA 1LXCA 2XF8A 2C2XA 4DL9A 3VOSA 3L9WA 1E3EA 4URFA 5F1KA 4YJFB 2YHUA 2UV8A 4BGVA 4N5MA 3KZVA 1X1TA 5AYVA 5LDGA 3E9MA 4O63O 1C1DA 2Q2WA 2ILTA 2YQ5A 4GMGA 5G2OA 3FNGA 3WSVA 2IYOA 4FFPA 3CZRA 3CEAA 5B4VA 4M54A 4EZBA 2JHFA 2Y1CA 3RI3A 3NT4A 4J2OA 3CXRA 2NTVA 3VHRA 4FFMA 2BFMA 1JA9A 3O9ZA 2FOIA 4CLEA 1P3DA 3GZ4A 2VHVA 3TF5A 3PHLA 2E49A 3WG9A 1ENPA 3QWIA 3QRWA 4I8XA 3WLFA 2WEKA 3JQBA 4AJ1A 3ROKA 3ZHBA 1DIRA 4II3A 4II2A 4RPHA 1OC4A 4QECA 1GPDG 1BTOA 4NHEA 1XQ6A 2OMEA 4BL5A 8LDHA 4HNGA 4OHUA 1GFSA 3WQQA 3HDJA 2G76A 2NVBA 3DZJA 4N7RA 4YACA 4KZPA 1ZEMA 3UVEA 1EK5A 3INRA 2JJYA 1HL3A 4I9HA 1P44A 1F14A 1VRWA 4KUGA 3DMTA 1IHYA 2G82A 4FSHA 4UEKA 3LC7O 2TMGA 3ETEA 4B3HA 4XD2A 3N74A 2BFPA 4TZKA 1YJQA 2O2SA 5EJ2A 1LNQA 1SZJG 3AW9A 4CLOB 2NVUA 2Z1MA 4U6QA 3I9OA 1T2AA 3ZWAA 4P4GA 2OORA 4R01A 2V6MA 4J43A 2BLLA 2AW5A 5EQDA 3WICA 1ZFNA 1F17A 4YRAA 2VYND 4K9DA 1I24A 4QQRA 3SC4A 1GV0A 5JY6A 5U1PA 1JKIA 1T26A 1NR7A 4DPMA 4RZHA 4AJPA 4ITUA 3VVBA 4MP3A 1KIFA 2QG4A 2B4RO 4BGUA 2YDYA 3DBRB 2GZ3A 5TC4A 5CDUA 1H6AA 3I4FA 4ZQGA 2B37A 4FN4A 1K2WA 4LK3A 1C14A 4BNWA 4KOAA 4Y6PA 5L45A 4YB8A 5EL0A 2UAGA 2PGJA 2P9GA 5IDYA 1ENYA 1GUYA 1YXMA 1ZO8A 2ZIZA 3DHEA 4DIFA 1GQ2A 4TMFA 3VPXA 3A4VA 2AA3A 5DULA 3LK7A 5JS6A 2O3TA 2ZQYA 5F5NA 3FTPA 1ZZEA 3FBTA 1RM5A 4IS3A 2EKPA 2GO1A 2WSBA 3QWFA 1YQDA 3JQFA 3KVOA 4OSOA 4CLOA 2XXJA 3DHYA 4YRDA 5KNLA 4E2WA 1LLCA 3DBVO 1OI7A 2JFGA 2AEMA 2P91A 3JD0A 4BNMA 4E32A 1ZCJA 5ICSA 4RCVA 4CM8A 1J49A 2CVQA 3SLGA 3NTRA 1ZSYA 3FHLA 3KYDB 3DMTC 3RKRA 2GNAA 5G4KB 4DC1A 3IKVA 3LVFO 2HKIA 2IE0A 3NT2A 3WQSB 3U4DA 2O23A 4FJ1A 5JSFA 2SCUA 3GAZA 3TZ6A 2AQ8A 2I67A 1LDEA 3FBGA 5EESA 1EVJA 4YQYA 4AFNA 5BSGA 4CM4B 2ZB3A 4AJOA 1U3VA 5DP1A 3ZU4A 1ZVMA 3BMQB 1XIVA 2XPCA 1S6YA 1N9GB 1U28A 3TZKA 3C1OA 3TNLA 5ES3A 1EBUA 4Z6KA 3O03A 4BO3A 2NU9A 1CQIA 1IZ0A 2C7VA 3QIVA 3B1KA 2ZB7A 3GRKA 2ZB8A 4Q3BA 3NT5A 3AU8A 1VI2A 3K6JA 1P1RA 5CDYA 3RFVA 3PXXA 3M2TA 4FFRA 5EQFA 3WGYA 1DC4A 1KETA 2NACA 3ZZNA 1P31A 4MVJA 5BT9A 4JX8A 4KWHA 5I9LA 3MWDB 1H6BA 3VH3A 1B16A 4IMPA 3GOHA 3DAFA 3VZQA 2DAPA 4FC6A 4XJSA 3ROPA 4DC0A 1KVRA 4P22A 5IN4A 2UDPA 4NBWA 4WLOA 5TNXA 1L1FA 1ZXLA 4R54A 4PGFA 5JAQA 5AXBA 1SCUA 4PRLA 3KSUA 2DKNA 1RYDA 4BO7A 2ZB4A 3N7UA 3DAGA 4KTTE 1YS4A 1SB9A 5KVVA 4BV9A 2WTBA 3PYXA 5IJZA 2R2GA 1QMGA 2HLPA 3DB2A 3GK3A 2ET6A 3DO5A 3GUCA 4Z0HO 4IZHA 3H5NA 3UCFA 4KQWA 3OJ0A 3HWRA 5L7YA 3ZHYA 1A7AA 4EJ6A 4W7IA 4F3YA 3W4IA 1QORA 1B8VA 2Y67A 3KTDA 2W8ZA 1Y8QB 4CMCA 1ADFA 3HZZA 4CR6A 4W7HA 3KEQA 3K73O 4UVEA 1ZSNA 4RDHA 3Q9NA 3RWBA 3FRJA 3VAZA 4O5OA 3WGTA 2Y05A 3A1NA 3E5RA 5DBIA 1WMAA 1Y9EA 4BNFA 5L9AA 2FR0A 4Z0TA 4HWKA 2X0JA 3WX0A 4NFHA 4BKPA 3AOGA 2VZ8A 4TZTA 4ZD6A 4XQGA 3WB9A 3ABIA 3D4OA 5CEEA 4LSMA 3JQAB 2GN6A 7ADHA 1TT5A 1YBMA 1QG6A 3UAGA 2FZWA 1I5RA 3H9EO 2BI8A 2TMDA 4DA9A 4UUNA 3ZV5A 4YT8A 3PYLA 3JQ8B 4DLLA 2W2KB 5ITVA 2IZ1A 9LDTA 3HUDA 1R4MA 4CL3A 1LU9A 1W73A 4ND5A 2QRJA 3R3SA 3QWHA 4MJLA 1N7GA 3QVXA 3LSYA 3R1IA 4CR8A 2VOJA 3DFUA 1X7HA 1ZNQO 5TX7A 3LLSA 3QSGA 3WMWA 3M6IA 2B83A 1JAXA 4P4NA 1WDKA 1NVMB 3UF0A 1SC6A 3NKLA 1LDNA 3A28A 1OZAA 2QYTA 2RHRA 3IS3A 1PQWA 2ZYDA 4NNJA 4ZQFA 3BMOB 4BMVA 3ADOA 1MX3A 5T5QA 4FB5A 3L0DA 1Z74A 4EUHA 1HLPA 4UEOA 5JC8A 3MJVA 3ETGA 3NV9A 1B8UA 2YY7A 1ZK2A 3P2OA 5KOIA 4EUEA 3LT2A 5IXYA 2I3GA 3Q3CA 4CV0A 3U09A 2I65A 2X58A 1Z6ZA 5AXCA 2W90A 4BB5A 5IXSA 2D4AA 3HFSA 5A03A 4MO2A 3DZKA 3RC1A 2PK3A 5B4TA 5THQA 4QXMA 3NGLA 4JP2A 3V1YA 3JD4A 3OIDA 1WXDA 4MIYA 1QV7A 3DBHA 2B36A 1XGKA 1GQQA 3F4LA 4WNIA 4AJHA 4IJWA 1PJ4A 4PLHA 4CM7A 2D5CA 3K2BA 5JXWA 1NBOA 5L4LA 4LSWA 1MLDA 5HA5A 1ONOA 1Q2XA 1E3WB 1NNUA 3DEYX 1Y81A 3SEFA 4J9UE 1B7GO 3GN2A 3ONDA 1QR6A 2Q1WA 1HSZA 1YOVA 3TL2A 3E9NA 3GNTA 3N58A 4LISA 5COBA 3ZW9A 4KUHA 4R1UA 4E3ZA 2VYNA 3ANNA 2CDBA 3F9IA 4JQCA 1D4FA 1XLTA 1XA0A 3ZWBA 4EUFA 3BMOA 1NFFA 5T8KA 3W1VA 3W8EA 5A5FA 4CLDA 3F6YA 3RFTA 3EYWA 1VJ1A 3V2UA 4MIOA 3KUXA 4ZHSA 5I8WA 2OXIA 4WLEA 4G2NA 3WFJA 4EEXA 2GD1O 1GU7A 4MVJM 3UFXA 4KTVE 3PK0A 3D4PA 4XEHA 3PWKA 2C29D 3VDRA 1B26A 2VZ9A 1U4OA 3WWYA 3GVHA 1YB5A 2UYYA 2WE7A 3NJ4A 4D44A 4CLHA 3C85A 4MVJP 3NGXA 4OIMA 4P8RA 1PR9A 5G0UA 5KJCA 2BMAA 1PS8A 3K9QO 2EF1A 2HCTA 3EHEA 2AQHA 3A9WA 1MFZA 1UZNA 1H93A 2AMFA 4BMNA 4OXYA 1LDBA 3RVDA 3WMXA 1YWGO 4GGPA 4DMLA 4CMKA 3FCOA 4IXWA 2ZTUA 3KLMX 4H16A 2GR9A 2VYVA 1YKFA 1GTMA 1Y5RA 1DXYA 4MKZA 4B8ZA 4CJXA 3PDJA 1E7WA 1N1GA 1DAOA 1B15A 1ISFA 1FK8A 3PZBA 2X22A 3HB5X 3ZNOA 1I3KA 2VN8A 3RKUA 5K0ZA 1MUUA 4QX6A 4RF3A 3WJ7A 3WOHA 1N92A 3KETA 2C0CA 4OL9A 5BSEA 1NPDA 3AU9A 3GDOA 4AJEA 1MXFA 1PJLA 3GEMA 4QT0A 5TF4A 2O7SA 1VKOA 4MVJH 5EMHA 4CMIA 4YAJA 2GRAA 2PGDA 2X5OA 4IJUA 4TWRA 4DPKA 4CODB 4CPDA 4CMGA 1HRDA 4ZQBA 4ESOA 4J0FA 2PKQO 4ZRMA 5A9SB 1GZ4A 1ZK1A 2AE1A 2VHZA 3AUUA 2A94A 3UGKA 3DBRA 3WIDA 2B4TO 1P1FA 3JQ9A 3JQ7A 2I76A 5ADHA 1FDSA 2YYYA 3JYQA 3ZWYA 5G0TA 2H5LA 2X7HA 4IPTA 3ZCXA 2BRUA 1QYDA 3RJ5A 3S55A 1E3LA 1OFGA 4DUPA 2FN7A 3H2SA 4BHTA 3C1AA 1DJNA 1NP3A 3BMQA 1U3TA 4YTEA 4GWKA 2EW8A 4D42A 5IFLA 4BO4A 4M1QA 3ASUA 4KMSA 4J4BA 4XYLA 2IZ0A 1YE3A 2VRCD 1ULSA 2A92A 5AXDA 3JYOA 5ILGA 3Q1LA 2FMUA 4GI2A 1YBAA 3L9XA 3ZH2A 5EINA 4DPLA 2ZYGA 3BHIA 3TJRA 1Y8RB 3MTJA 4ND1A 2NM0A 2B69A 1LQUA 1DHRA 3OHSX 1DFHA 3D1LA 2C2YA 1BXKA 3BTVA 2VWQA 5JAIA 4YVFA 5DCYA 3ZNNA 3GAFA 1Y5MA 2GGSA 4XJTA 1E5LA 4K26A 4BNUA 5A9TA 2ZYAA 1IL0A 1KY5A 1UDBA 4BNJA 1ADBA 3DMYA 3OM9A 5TT1A 5BR7A 1YO6A 5MGBA 1DIAA 1U2DA 4WUVA 3R6DA 5A9SA 2EXXA 5JCJA 3DR3A 2X0IA 5JO0A 4YAIA 2X1HA 4R1TA 1AN9A 3KO8A 1UP7A 2GDZA 2VWPA 1SOVA 2EP7A 2FSSA 3GUYA 3A06A 1PIWA 1D1TA 5ER9A 5JBIA 2FSVA 5I7SA 4RVHA 1N9GA 1Q7GA 3TOXA 2JFFA 1YDEA 5A1TA 3WYBA 3H65A 3U49A 3GNQA 3DZBA 5DCUA 4PG4A 1PL6A 4I5FA 4J4HA 4NFYA 4FDAA 1Y8QA 2AE2A 2AEFA 1GUZA 3LYLA 5KKAA 1DIHA 3KLPX 1CETA 1RKXA 2F00A 2ZKLA 1U3UA 1X0XA 3OA2A 4AVYA 1ADCA 2RH4A 4GL4A 2D1YA 2Q1UA 3FNFA 5H81A 4FOSA 2X5JO 2DFVA 2BFOA 4MDHA 4ALIA 5GZ1A 1RM4A 2HJRA 3UKOA 4WLNA 1PQUA 4J1SA 5KIAA 3U0BA 2ZJ1A 3AM4A 3I9LA 3JYLA 3TSCA 2PD6A 3WTBA 1AHIA 2Q1SA 3ZNQA 1U7TA 4J90A 3V8BA 1NXQA 2JCYA 3BYZA 3GVXA 4GX0A 1B2LA 1DLJA 3RROA 4BO8A 1UP4A 3PQEA 3JQ8A 5F21A 5JYDA 3UUWA 2H1SA 3OIFA 1AHHA 2RHCA 4CQLA 4L73A 3KEOA 1SOWA 4TRRA 2X0NA 1HDGO 1YQXA 4BGIA 4S1VA 3GVPA 1LQTA 1O95A 4BO6A 3L6OO 4XDYA 1H9BA 1GZ6A 4NZ9A 1QSGA 4YEDA 3H5RA 1ENZA 2PLAA 1LEHA 4YAEA 5AXAA 4JJIA 5DOVA 2LDBA 2HSDA 5A02A 3ITKA 1V3UA 3LT1A 2D8AA 4XIYA 5GZ3A 4RVFA 2FR1A 3AOEA 4CLRB 3ZV3A 4XWYA 4IJVA 3WTCA 4WCFA 2NADA 3ENKA 4HFNA 1VLLA 1JLLA 3M1AA 1X0VA 3VPHA 5T8KC 4U7WA 1FDTA 4L75A 1L7DA 2JCVA 1I3NA 4GKBA 3WDSA 1IPFA 2WE8A 3OICA 2LDXA 3D3WB 2HK7A 3D7LA 3IUSA 4F45A 2PKRA 3ZV6A 4B4UA 3Q6IA 4YWJA 3E82A 3D3WA 3VH1A 4D3SA 2PGLA 4D0RA 4J4TA 1GCOA 5BSHA 4DMMA 3DOJA 1R12A 2IRWA 1I8TA 1VKNA 3HNPA 1DFGA 5DDIP 1U2GA 4ZGWA 4NI5A 1I2CA 2O7QA 2EEZA 2WM3A 5JFOA 1S7CA 3H3FA 4ALMA 2DVMA 5I9NA 1X15A 3OJOA 2W2LD 3HDYA 1R4MB 5TJHA 2NSDA 5I9MA 3ZWPA 1GADO 2GASA 1U7HA 1FMCA 2OGUA 1RJWA 5CFZA 3PWZA 4ND2A 1ULUA 5AQ1A 2J3IA 1E3WA 2WYUA 1JVBA 2DBZA 4ALKA 3PFFA 4HV4A 1KVQA 1ZW1A 4MVJD 4CM8B 1EFLA 4MKXA 4WE3A 3ZU3A 4YJDA 4BB6A 1HDXA 1HDCA 4JCOA 4IDEA 5FI3A 3G3EA 3GRPA 1H0KA 4AJKA 2NTJA 2Y0CA 1P74A 2IZZA 4G5HA 1SEVA 4QFCA 4XGNA 3GN1A 1YB4A 4RPJA 4EI2A 4IM7A 3EZYA 3F4BA 1PGJA 5G0WA 3ZWMA 4E6PA 1LSOA 3MOGA 5K6AA 3RC2A 4GKVA 4S3MA 1KS9A 4OXNA 1WAMA 5I8ZA 5JDCC 1KEVA 4R51A 3IMFA 3ZW8A 1UP6A 1QLJA 3NTOA 5L53A 3B70A 4YPOA 3INTA 3B20A 3BMCB 1KEUA 4RORA 1BW9A 4MIEA 2CSUA 1DFIA 3F3SA 1UDCA 4RL6A 4CL8A 4NU5A 3PGJA 3PP8A 1MV8A 3FPCA 3OIGA 3QVWA 4BKOA 4WCDA 5JYEA 3I5MA 2DBRA 1A71A 1CQJA 4DREA 4Y6RA 4RVUA 2D2IA 1H2BA 4D3FA 5CHEA 2RCYA 4D0SA 3K2EA 1XSEA 3EW7A 1YBVA 5JC1A 3L77A 2GN4A 5IDXA 3DL2A 2V7PA 4PVCA 3PHJA 1GYPA 1T1RA 4YDRA 3MJEA 4JXKA 1KVUA 1T24A 3E9QA 3ROMA 4GMFA 3GGGA 4U8GA 3X2FA 4YQZA 1G0OA 1R0KA 2Z5LA 2NQ8A 4J6FA 4R5HA 3FN4A 4UUPA 5KVQA 1ZIDA 2DFDA 1PU2A 1GYRA 4Y9DA 3OQ1A 3ZV4A 5DT9A 4A7PA 1T4BA 1JWAB 1W0CA 2O3JA 2GPTA 2WYWA 4KP7A 1HYGA 4RJTA 3EMKA 3E03A 5K6AC 4RVSA 2DPGA 2X0RA 5L51A 4IQ8A 2QX7A 4I08A 2DBVO 3ZDFA 1EZ4A 3JQ7B 3ANMA 4CV3A 1HDRA 4D41A 3D3EA 4R3WA 1Y9AA 5TT0A 3RASA 2OP0A 4YJGB 3KYCB 5I7FA 1V9LA 1LJ8A 4LMRA 3U62A 2WD7B 1YQGA 2NNLD 4Q3CA 3LU1A 4X54A 5KKCA 1MG5A 2YQ4A 2C07A 1R37A 4B4OA 4M8SA 3IOYA 1KY4A 4AICA 1O9BA 4PRKA 4Q9NA 1XG5A 4WEQA 5L3ZA 8ADHA 2VTEA 4FBGA 2AXQA 3DC2A 1TT5B 1DIBA 2Q49A 3ST7A 2Y0DA 1LC0A 1LC3A 3BMNB 4XQCA 3UW3A 2VQ3A 3HFGA 2BGMA 4BNIA 4B4VA 2RAFA 3PQDA 3HN7A 2EP5A 1SPXA 5LDHA 2A4KA 3PDUA 1E1NA 1GQYA 1NPYA 1PJTA 4OQYA 4NG5A 3SLKA 4PCVA 4BQPA 2J3JA 1HSOA 1K89A 1O94A 2Q4BA 2YV3A 4OSPA 4DTIA 5CDSA 1U9JA 5ER6A 3KB6A 4HUJA 3UICA 3PHGA 4XGIA 5A9RA 2NV6A 1EUDA 4D3DA 4XYBA 1ZK3A 3PFWO 4QUKA 1GEGA 2O3QA 5THKA 2DBQA 1E7MA 1CYDA 3FPLA 4BNYA 1D1SA 1R16A 2WYVA 4DQXA 1ZK4A 4HADA 3OA0A 2JD2A 4NBVA 4H3VA 1WWKA 3QV1A 3OQ6A 3WFIA 5L95A 2X5KO 4K6CA 2C54A 5L7WA 1QYVA 1I33A 4G81A 5JMPA 4ND4A 3Q9UA 3IP1A 2E48A 4M55A 4Y67A 4N5NA 4Z9FA 3ZWVA 4BGEA 4E31A 4PN3A 3HDHA 5L7TA 2C82A 1MXHA 4H15A 4P38A 1XEAA 3D5TA 3HQ4O 3H9JA 1Y6JA 2I3AA 4DLAA 1P33A 2WJPA 3LF1A 5FWNA 4Y6SA 3CH6A 3HDQA 5TRTA 4BNGA 4FC7A 3EAGA 4P4LA 2VOEA 1EEHA 4PLGA 1NQTA 4LVUA 5EN4A 3EUWA 3IJPA 4R16A 1DRVA 1X1EA 1MC4A 3H9QA 1YL6A 3O8QA 3UN1A 3TQHA 1E7RA 1V3VA 3S2EA 1F0YA 2Q99A 3P5SA 3L6EA 1UXHA 3SJUA 4ZVVA 2CY0A 4NJMB 1VSVA 1HKUA 2GERA 2GN9A 3HN2A 4IBOA 3FR7A 1A5ZA 1XDWA 4WEOA 2WWRA 2YV1A 3VTFA 4CQLB 3EC7A 4Q3NA 4WKGA 1NAHA 4L76A 2IEBA 1MFPA 4CV2A 4GH5A 1LSJA 2Q1TA 1O0SA 3K96A 4MKRA 1TI7A 1DDOA 3WBFA 4PG7A 2JAHA 4ALJA 2NVWA 1V6AA 3ROQA 4WLVA 4Y98A 5JY1A 3CMCO 1PEDA 4KQXA 4E5KA 2CDCA 5J23A 4MINA 1C1XB 1UXJA 1W6UA 4YAKA 1GD1O 4XIJA 4EDFA 1HYEA 4IXTA 1QLHA 2F1KA 5G4KA 5HRUA 1P45A 3MEQA 4WCFB 2G0TA 4QSMA 4I5DA 3JQBC 2VNAA 3NX4A 4CM9D 4YBZA 1XHLA 2J6IA 1TA4A 3Q2IA 2E4AA 4UVIA 2PY6A 2FWMX 5HBRA 3SXPA 4PLPA 4CUJA 3PJEA 1NX6A 3ON5A 2O50A 3IC5A 1GCUA 1N8KA 1X14A 3QVOA 4MVJG 1G1AA 3ORFA 3W4KA 1AXEA 1AXGA 3NTQA 1UR5A 3IAHA 1Z73A 3VVCA 1NTOA 3MJ4A 1T2DA 1GEEA 5JDCA 2NLOA 3JQ6A 3MWEB 4CMAA 1E3SA 2PD4A 3AOEC 1JTVA 3TFQA 2UUOA 3PRJA 2X9VA 4YR9A 1K5HA 1DRWA 4TRJA 4MVJF 5FF9A 1XCBA 3IKTA 4MOWA 3PZRA 3ZN2A 1I0ZA 2JAPA 4WASA 3FI9A 1E7YA 4BMSA 2NVUB 4OOEA 1NYTA 1TT7A 5IZ4A 2I99A 4AJLA 3G1UA 1PS9A 4IMRA 1Q7CA 1SEPA 1C0KA 2Z95A 4BKRA 3BA1A 1XR3A 4M86A 1PJQA 2EWMA 3SBOA 2HQ1A 3CIFA 4YRBA 2FP4A 1D8AA 4DWVA 1KC1A 1TLTA 1BVUA 3MTGA 1I30A 4IJKA 1E1KA 4Z9YA 2YFQA 4F6CA 4IUYA 4DGSA 4BQRA 4RPKA 3R0IA 1VL8A 3K31A 2VRBA 3TWOA 3LT4A 4ONEA 2BGKA 1P9LA 2B4QA 1E6EA 1LBEA 3I6IA 4KDEA 1UAGA 4B79A 3M2PA 1LDYA 4D46A 1AUPA 3TRIA 2W4QA 5B4UA 2NTNA 1V8BA 1E0DA 2AQKA 2Q3EA 4PZDA 1NWHA 1Q0QA 2PH5A 4R1NA 4J7CA 4RLHA 1EK6A 5JPIA 3WBBA 3Q0EA 1GDHA 2CZCA 3G79A 3K8ZA 2UUPA 1ZUD1 4ZICA 1Z82A 2FZEA 2I5PO 2VTDA 5A4DA 5IDQA 1WP4A 5TS3A 1XU9A 3QHAA 2FPIA 5JAMA 1ZXBA 1LSSA 3JQFC 4OOFA 5H82A 2PA3A 4NK4A 2C7GA 4KUEA 1WPQA 4I9NA 4TVBA 1B14A 3EVTA 3RCBA 2ZTMA 4NR0A 1C0PA 1GAEO 2Y1DA 1DJQA 3AI2A 2ZJ0A 4ZN6A 1PX0A 4N54A 4CMEC 1KEWA 3E18A 1WZIA 4HNHA 1EBFA 4Y8VA 1PQPA 1IY8A 1LLQA 1HWYA 1RWBA 3I4CA 3VZSA 3ZGYA 2ZCUA 1BGVA 4E5NA 1U8FO 2X9NA 4BO1A 1K0UA 1UXIA 2Y1EA 1DSSG 1HEUA 2ZCVA 3CZMA 5KWEA 4HKTA 3JQGB 3OF2A 2NWQA 3QVSA 3ZU5A 3WLEA 4PLZA 4CLXA 1DEHA 4EJMA 1G6KA 2CD9A 1MC5A 2EJWA 4BO2A 5L4NA 1IYZA 4U6SA 3VZPA 2PKQP 1B3RA 1DB3A 1E5QA 3CMMA 1E7QA 5DZSA 1N1EA 2EKQA 3S8MA 2PWZA 4NMHA 3AFMA 1ONNA 2WD7A 5A5EA 3INGA 2HU2A 3DZHA 1VC2A 4NU6A 1WDLA 3AK4A 1DAPA 5LC1A 4EW6A 2Y0EA 4LCEA 1V0JA 3V2HA 5ENDA 5JNLA 4FJ0A 2JD1A 6ADHA 3L4BC 3QP9A 5DOZA 4HFJA 4WJZA 3TZQA 4WOJA 5DCWA 4BNLA 3IIEA 3JCZA 3RBZA 5F3RA 4K6FA 4NJOA 3ZWCA 5JO9A 1GL3A 4XB1A 2Q50A 3UHAA 3DQPA 1NWCA 4RPLA 1PJSA 2I9PA 3LQFA 1MGOA 3DZIA 4F46A 3VPFA 4OAQA 1EVIA 1SAYA 5GZ6A 3UH1A 1TB4A 1U1IA 1E92A 2W2LA 5CDTA 1CERA 5ICMA 5IG2A 3DOCA 1NFQA 3UXYA 2VHXA 3ASVA 2Y66A 4L9RA 3ICCA 4HFMA 1LDGA 1B8PA 3FR8A 2P5UA 1Z75A 1Q7BA 2YW9A 2FHSA 1DOHA 1CJCA 1VPDA 2DQ4A 3JYPA 1YB1A 2I6TA 3AUSA 3U4IA 4J49A 4RF5A 3ZHZA 5COQA 2DC1A 2VNSA 1QYXA 2VZ0A 5DBGA 3KYCA 1E6UA 3AI1A 3TDKA 1CRWG 1WLYA 1ORRA 2C5AA 1IUKA 1M6WA 2EGHA 1C0IA 2PD3A 5F1OA 1OAAA 1PL8A 4WLUA 2GYYA 4A26A 4FFLA 3IDSA 3L6DA 3VC7A 1H94A 4EYEA 2QHXA 4BNNA 5KCZA 1VJ0A 3QA9A 5HS4A 3WWZA 3OJEA 4J7UA 2PZMA 1M2WA 3QWBA 1WMBA 3V5NA 3OECA 3K92A 3CPSA 4LRSB 2HMUA 2FPGA 1K3TA 3FSRA 3ZNPA 3DBHB 4XB2A 4BO9A 1UDAA 4HBGA 1UH5A 2D0IA 3PTZA 3GFGA 4R3NA 4B8WA 2DUUA 3AJRA 3NUGA 3OBBA 4IY1A 4O1MA 4RVDA 4M87A 2I66A 3GA0A 3P19A 4HFRA 4FOOA 4GBJA 3AUAA 4WECA 3EZLA 2Q2QA 4CUKA 1E7SA 4GGOA 3I23A 3KXDA 1E77A 3GY0A 2J5KA 4NPCA 1K6JA 2O3RA 5ENVA 2JHGA 1R0LA 3D5QA 4FD3A 4RO0A 1GY8A 4CM6A 2P9EA 5CEFA 2CUKA 4PFJA 4N5LA 3W6ZA 2DUWA 1PGPA 1YL7A 2OO5A 3G1TA 4XGKA 2ZK7A 3F46A 3JD3A 5A05A 4BUCA 4NBUA 1NHWA 3W8FA 4GLOA 4DVJA 3GQVA 1ZJYA 3P2YA 4DIBA 4DQUA 2OP1A 3BHMA 4CM5A 5TJ9A 5HS6A 3WGQA 3U4CA 5CAEA 4YJHA 3AY3A 5DNAA 1CEQA 4AJ2A 1N5DA 1TEHA 3GF4A 1K6XA 1KVTA 3GPDG 2FR8A 4BV8A 2OBNA 5DBFA 1J6UA 3PJDA 1WW8A 1BDMA 1JWBB 2H63A 3WNQA 4E4YA 2IYPA 1SBYA 4EJ0A 4PLWA 1XYGA 4YCAA 1KYQA 3RBVA 3M1LA 1H6DA 1EDOA 1KC3A 4HP8A 5IAAA 1TVEA 1I3MA 4WLFA 1LLUA 1E6WA 1JVSA 2HK8A 1SO8A 3WIEA 3JV7A 3O8QB 3DAPA 1IHXA 3NDRA 1P0CA 1ZMTA 5JCXA 2Z1NA 3LZ6A 4CM4A 5U4QA 1UAYA 1DC5A 1ISMA 3OSUA 4FJ2A 2HMWA 4JK3A 4CUZA 5KVSA 2VWHA 3WGIA 3RFXA 4K28A 2YV2A 2X23A 2AG8A 4QFDA 1O89A 3GR6A 4LCJA 2BD0A 4IS2A 4OJNA 1IZ9A 3GGPA 3NYWA 1PSDA 4N18A 5I7VA 3TL3A 4ZRNA 1GR0A 1EFKA 5ILOA 4MP8A 5KTKA 1H5QA 1Z45A 4RV9A 3UCEA 4YXFA 3VKUA 4W4TA 1NQAO 2Q45A 1WNTA 2HMTA 5HWSA 4FGWA 1KBZA 4OYRA 3RUIA 4A27A 4RF4A 1XKQA 2HAEA 3QLJA 1DHTA 1PWZA 1WVGA 2A9FA 2HK9A 2RBEA 4WK6A 3WGZA 4AJ4A 4L8VA 4IDBA 4BO0A 3OP4A 1ZBQA 1J0XO 5KJ6A 5KJFA 4JJGA 3I52A 3I1JA 3JQ9C 4DRYA 1PS0A 3JYNA 9LDBA 2DT5A 3RC9A 2HO5A 1E3JA 2H9IA 4R1SA 4RQUA 1NFRA 4PLTA 1PZHA 3HADA 4KWIA 3IQDB 3GPIA 2BFAA 1JAYA 1BXGB 3MCVA 4J0EA 4A0SA 3HE3A 2OUIA 1D3AA 5CDGA 1BXZA 1LA2A 3ADPA 2XXBA 2XAAA 3S2GA 5JDIA 1A27A 5U9CA 4OH1A 1Y8RA 1JQBA 1PR3A 5LCXA 4NBTA 1SMKA 2CFCA 5B1YA 3I9NA 4ROSA 3H3JA 2P4HX 1T2CA 2DPHA 1A9YA 3DTYA 1E3IA 3E8XA 4TKMA 1FDUA 1QXSA 3QE3A 4XYMA 3GFBA 1C3VA 3NEPX 3RUFA 2C20A 4IQGA 4YYZA 3GG9A 2IXAA 3EY4A 4CQMA 3AI3A 4TRMA 1NPTO 2AEJA 4ZU3A 5JW6A 3RUEA 2E6UX 1H6CA 1BSVA 3QWAA 3NDJA 2W2KA 2EJVA 1U5AA 4K1LA 4OMUA 4GSLA 4JIGA 4WPGA 3DHNA 2P5YA 4J3FA 3VKVA 5IF3A 2Q46A 2H6EA 1PJBA 1P0FA 3T7EA 1ZH8A 4B7UA 1R4NA 1UJMA 2QRKA 4GQAA 3K5PA 4BNKA 1HF3A 3HSKA 4J2HA 1R66A 5BNFA 1V3TA 3EK2A 1HETA 1Y1PA 1ZJZA 2VHYA 2EV9A 3CINA 3H7AA 4RGBA 3RU9A 4BIIA 4BOYA 2O3UA 5DN9A 4IDGA 4DQVA 3GHYA 2GCGA 4HY3A 2X6TA 4E2ZA 3AFNA 3GVIA 1IB6A 3C7AA 1JKFA 3H4VA 1IE3A 5H83A 2GF2A 4LN1A 2WMDA 3KSZO 4TKLA 4Q3AA 1NM5A 3C1TA 3D4NA 4MVJE 3GG2A 4IQ0A 4WNCA 3JTMA 3AM5A 4I9UA 2JKVA 3RSHA 4INAA 2EKLA 2G17A 2J3HA 1Q0HA 4KDFA 4RF2A 5F5LA 4D79A 3TOZA 4C7KA 5CG1A 2ZATA 1EE9A 4ZQHA 2NU6A 4FGSA 3ANLA 3DDNA 3UOGA 1G0NA 5KJ1A 4IZIA 1W8DA 2A35A 1ZEJA 2DTXA 4IDAA 2QW8A 4B3JA 2DU8A 2Y1FA 1O5IA 1OBFO 2VT2A 3ICPA 3JQDA 4IDFA 4QO7A 4J1NA 4M49A 2EIHA 3FNEA 4J16A 4L0QA 4AJNA 1LX6A 4YAGA 1LDMA 4RQTA 3VTZA 3DWFA 3RU7A 1RYEA 3PJFA 1M76A 5C7IO 3TN7A 1R15A 4GPD1 3DFZA 2GZ2A 2E82A 5MDHA 3MJTA 4YT2A 4ND3A 3PI7A 1EDZA 1YH3A 4JBHA 1MG0A 5AOVA 4PG8A 5FEUA 1IULA 2J3KA 4E0BA 1N2SA 4HX5A 2QIOA 1SB8A 4GVLA 2GN8A 3BTOA 3GGOA 3LDHA 4A73A 3ITDA 3K30A 4YJFA 1ID1A 1X7DA 1BWSA 4M89A 2Q4EA 1C1DB 1NVGA 4ZJUA 1XWFA 3WQRA 4B3IA 2HUNA 5TLSA 1H9AA 2FPPA 4R4JA 3FNHA 3GVCA 3JQAA 1PZGA 4IDCA 3F1KA 1FDVA 1I3LA 2CMDA 4ALNA 2P68A 1SNYA 2J8ZA 3ZWOA 5BQFA 4IDDA 4R9RA 5T64A 3E1KA 5EIOA 5JDIC 2DTEA 4W9NC 4BNTA 1PTJA 2BH9A 4IGEA 3RC7A 2YFHA 2Y1GA 1A7KA 3COSA 2CF6A 4ILKA 1NQ5A 2Y99A 4J1TA 2BKAA 5F1PA 4GWGA 1GYQA 2VT3A 3BMCA 1OC2A 1QKIA 2UVDA 1HTBA 2V6GA 3DZGA 3F1LA 5C3MA 4GX5A 1PJ2A 2X4GA 3NRCA 4O6VA 1GUFA 1HE5A 2V6FA 3O38A 4R41A 3RIHA 3WGOA 4E21A 1O8CA 4E5YA 1QYWA 5B37A 4IGFA 3AWDA 5CEJA 3SVTA 1KVSA 4PVDA 7MDHA 3PLRA 3F5SA 5CP8A 3LF2A 1P77A 3B1JA 1X7GA 3JD1A 2JD0A 4PLCA 2R00A 2OHXA 4G65A 3NDIA 5EERA 4JROA 4FCCA 2YZ7A 1FJHA 2HDHA 5JMWA 1A4IA 3GC6A 1EVYA 2JL1A 4NH4A 1JU9A 2HRBA 4LVCA 4B7XA 1T2FA 3FD8A 4PZEA 3DOOA 1GV1A 3QVTA 3S1LA 2O4CA 3WGGA 1Q0LA 4RDIA 3W6UA 3MJCA 1PGNA 5CG2A 4UVDA 3GMDA 5FFFA 1F06A 2YJZA 4NDNE 5AVOA 3WNVA 3ENNA 4JJFA 1HLDA 4YJHB 3RUCA 1I2ZA 1JDJA 1UZLA 1HDOA 1YJ8A 3C8MA 4E33A 1ENOA 2Y68A 3U3XA 5IDWA 4Z3KA 3CE6A 4UREA 5TSDA 3ULKA 1IPEA 3SC6A 4XQ9A 5L4SA 5CPBA 4NFSA 2VHWA 3X2EA 4A03A 1K6IA 4PG6A 1PZEA 3G0OA 1GZ3A 1UXKA 2WDZA 4OQZA 3GZNB 1ZSVA 3DBLA 4LW8A 4BS9A 3KV3O 1ISIA 2CVOA 3DBLB 4OXKA 4R9SA 2IODA 4RPGA 4GX1A 3HJAA 1ZMOA 1AGNA 4OGWA 4JBIA 4JNKA 3PPIA 4BNXA 1VL6A 4TROA 3EGOA 4OKIA 2CF5A 3BAZA 4DYVA 2P9CA 4MP6A 4OM8A 3ZU2A 4BKQA 5JCJD 1J5PA 1WZEA 3BIOA 4AJJA 4XZ3A 3KHUA 5EPOA 1EUCA 1U5CA 3PIDA 1P1HA 3O26A 4TSKA 3I9MA 2OBYA 3OJLA 4RZIA 1LTHR 1N7HA 1LI4A 2B35A 3DONA 5C5IA 4GX2A 5TQVA 4CMIB 4TRNA 3KYDA 6LDHA 3G49A 3WYCA 4XYGA 3WSWA 5A3JA 2CVZA 4GAEA 4CQMD 2GUGA 1ZK0A 3I6QA 1BMDA 3V1TC 4XR9A 3NAQA 1JN0A 4WCFC 5A3VA 1E1MA 4DBVO 2BELA 1M66A 1C0LA 3RAJA 3WR5A 2P2SA 1ML3A 3E6AA 3ZWWA 3FTNA 4UVGA 3RD5A 4A10A 1XELA 3AY7A 1PGOA 3H6KA 3OH8A 4UUMA 2OZPA 2BI7A 5TGDA 4JBGA 5FYDA 3VH4A 4YT5A 5A06A 2HRZA 5HTOA 3LLVA 4NIMA 3V1UA 1MA0A 1UXGA 4Q39A 4GVXA 1PWXA 1VSUA 3L4SO 4H7PA 3I9JA 4BNVA 3H8VA 2PZJA 3V2GA 2AQIA 1T25A 1HXHA 2PR2A 3DZFA 2O4UX 1VJTA 1O6ZA 4WOKA 3DTTA 2B5VA 4DXHA 3QY9A 4NQZA 2W98A 2YUTA 3U9LA 2OOSA 4UULA 3H9UA 3C7CB 1ZKMA 1AE1A 2HJSA 2GLXA 4CV1A 3TZCA 1PGQA 3G17A 1Z7EA 2O3SA 1A4UA 1UZMA 3STHA 3D64A 1NAIA 5KVCA 2C5EA 1W4ZA 3Q11A 4CQMB 2VYVD 3CSDA 5GY7A 3LC1O 2QYSA 4TQGA 4XA8A 1Q1NA 2NU7A 4AJIA 2R6JA 4XX0A 3TZHA 4DBZA 3PVZA 1NASA 1P1JA 3GDFA 3VPGA 1I01A 1U8XX 1DC3A 1NVTA 1PL7A 1ADGA 4TVOA 4U0KA 3KBOA 4PLYA 3H2ZA 3BHJA 2RH8A 1R4NB 4E5MA 2C59A 3F5QA 4LGVA 3KYBA 3SX2A 3ONFA 5TIIA 4U0JA 4Z0PA 1DBVO 4YJGA 2DTDA 4NK5A 3ZHXA 4E12A 5T6BA 3JQAD 1I32A 4JGBA 4YA6A 2FY8A 3KOUA 2OFPA 4A5OA 4I5EA 1D7OA 3TPCA 3VPSA 1YRLA 3GEGA 4IINA 1QV6A 2NQTA 3RUDA 5JLAA 4R69A 4CM1A 3ETDA 1YL5A 5IZCA 3EVNA 3PYMA 2GSDA 4FIZA 2NU8A 2J5QA 2X9GA 3OFSA 5COAA 3FWZA 3HG7A 4JP3A 3ZWNA 1MP0A 2E37A 4QEDA 1E1LA 4BO5A 5JE8A 1GPJA 4XKJA 3RBXA 5B12A 4D45A 4XDZA 1B0AA 2VUTA 2V6BA 2OL4A 3ZI0A 3O4RA 4GLLA 5DF1A 3AM3A 2PFGA 1HZJA 3CKYA 3GEDA 4ZA2A 1FXSA 3KM0A 1LRKA 4NJMA 5KJEA 1QRRA 1LRJA 1DPGA 1YVEI 5DP2A 1RPNA 2PH3A 1B3BA 1WDMA 4J9VA 1EMDA 1EQUA 3UCXA 2CDAA 3W4JA 4L4XA 5BNIA 5JAZA 1FF9A 4AG3A 4CMJA 1XQ1A 3PJGA 2VCYA 5C7LO 3NJ8A 3WYEA 4D43A 1ONPA 5C7OO 4B7CA 1KEPA 4FFNA 5C37A 4ALLA 4I1IA 2ZQZA 4UEJA 5BSFA 3MZ0A 2PZKA 2JCXA 2QZZA 3MJSA 1U3WA 3T4XA 2XOXA 1P1KA 2Y1OA 1C1XA 4MPDA 2POQX 4FFOA 2R00C 4OO3A 4R68A 1PJCA 4UVHA 3Q2KA 1PJ3A 4RLSA 2YHIA 2AG5A 4O59O 4PIVA 2JFHA 4D7AA 1IOLA 4DIOA 4EBFA 5HM8A 2AHRA 3D0OA 5BNTA 3LC2O 4XRRA 1DIGA 1M67A 2VRCA 1EUZA 3AY6A 2Q2VA 1I36A 4FR5A 1JKJA 4LMPA 3RJ9A 3LT0A 1EE2A 2VUSA 1BRMA 2ZTVA 2EGGA 3H5AA 3I3OA 3OQBA 4BNHA 2D59A 3PHIA 5T57A 4CM9A
chains in the Genus database with same CATH superfamily
4FFSA 2IHYA 3AKEA 4YV1A 1LNZA 1GN9A 3H99A 1X2BA 4CVNA 2DBYA 1RRPA 1T5DX 2FF7A 2IGBA 4JLDA 1UMBB 3A6KA 4H18A 4JQZA 2FKAA 3GMSA 3A4NA 4FQ5A 4N0MA 1TUGA 1CJKC 4QHYA 1E2JA 3V34A 2J3QA 3PFIA 1OYYA 2YXEA 2G83A 3UZUA 2FFQA 3CJRA 4HYYA 4LTNA 1F12A 2WZCA 4KQ6A 4M46A 1T8PA 3UWSA 2YMQA 2ZU0C 1XCOA 1FTWA 3BILA 4O4HB 5ICCA 4NARA 3IPRA 3WI7A 5GM2A 1MZVA 4GI3A 3CTMA 4M3NA 4UBNA 4ZDKA 2Z08A 2A9JA 4RJJA 4W9NA 5IC4A 1JG4A 2YHIB 4QQ8A 3ZJVA 3C7DB 1EWKA 4QOJA 1GLNA 2C3YA 3F47A 1U2SA 2BWJA 2XZTA 4E51A 2CKDA 1KO5A 3BTUA 5DNCA 4CMBA 1TZMA 3H9GA 4F6LA 2J09A 4PC3A 1CRPA 4ZAWA 1EVZA 1BRTA 3J81k 2FPPB 3TZEA 1RQXA 1TQ8A 4ID9A 5FOUA 4UUOA 2HNBA 2IT1A 1SC3A 1AV7A 2J9GA 2QTTA 3DLPX 5FTKA 3U5TA 1EA7A 3LX5A 4FIDA 1D4AA 3X1XA 5J3JA 1OV4A 1Z7WA 4U9IS 3TRKA 1H4QA 3NHKA 4ARAA 2Y1LA 3DE0X 3JQGA 3LDAA 5EKSA 2AOUB 2NT4A 1LNSA 3PEFA 4P4SA 3CUSA 3R76A 4JJ6A 1L7EA 1JBKA 4YCMA 1R6DA 2VUUA 2PUCA 1T4MA 3UUEA 2IYQA 1ZD3A 3ESQA 3RC3A 3VYSB 2IYVA 1XJ5A 4QDKA 4V39A 1A9ZA 1F8FA 3G8AA 4AG6A 1E94E 1WUKS 2Y93A 3HH8A 3OETA 4D74A 4IOMA 1D09A 2QRLA 2RK3A 4PLFA 1VB5A 3G23A 2ZM5A 4CR7A 1QAMA 2IDZA 5EE1A 4FS3A 1SXHA 4N3NA 4FZRA 1QQBA 3JVVA 4J1QA 1WXIA 1WCXA 2V65A 4K9QA 2ZRGA 2R5WA 3E7DA 1NGSA 3JPYA 1OW3B 5EWJA 3I2YX 4YP1A 3B3AA 1R0SA 4NBRA 3GHHA 3LBYA 4RQAA 5TMDA 4B31A 3CUYA 2WFAA 1M6HA 2AK2A 2H4XA 4L28A 1VMIA 4ZQEA 4EM6A 2PXHA 1R74A 4F92B 3DV0A 1Z6YA 4A8HA 1U3GA 4EI7A 4YPFA 3OEYA 3DXFA 3ZWKA 2J3DA 3BGWA 4UAGA 1NBEA 5H4HA 4HT3B 4DYDA 4I50F 4LXIA 2PL3A 2ZUCA 4KIFA 2IIBA 4RPCA 4YRTA 2FYTA 3S1SA 2ZIWB 5A4KA 1D1PA 4MO9A 1LRLA 1HDZA 1VIVA 3U3DA 3QVJA 2IEDA 2H1VA 2UYCA 1N2CB 2HPVA 3RANA 4PLVA 4XCQA 2XBMA 4X8LA 1W2HA 4Z9XA 4J7XA 4UOEA 1YQUA 4QUJA 5K8VA 4KR0A 4Q3OA 1YGYA 5KDDA 2B0JA 1YB2A 3LX4A 4NCIA 5LQMA 1KEZA 2JGRA 3TNFA 3RUPA 3R9XA 5DX1A 2WQ7A 4CFYA 2HMVA 4BEVA 4PONA 3WK9A 1YCDA 1IEVA 2AMJA 4G85A 2H5IA 2V7UA 3KTOA 1F9EA 1NBWB 3QKSB 1NF8A 4MUKA 4N9WA 5LOVB 3SWWA 3ERCA 3GEEA 3GNSA 4DR6B 2NUAA 3OC0A 2H54A 3GBSA 1NR1A 1UK8A 2WJWA 3E48A 4GT1A 4Q4AB 4BNFA 4ED9A 5LOVA 4E5UA 5GMOA 3ESRA 2BIFA 3A6EA 1Y3AA 4O2BF 1KYWA 3SKYA 3DDUA 4KQHA 1X1CA 5EFZA 1CIVA 4P84A 3WLPA 3BMNA 4I4IA 2GBPA 3THXA 1IN6A 2C96A 3GJZA 4U5QA 4YUVA 5JHGB 2INGX 4EH1A 3IVCA 4ID3A 2UUAB 4HTFA 3L7NA 1BU8A 3FYCA 1FE8A 1P1IA 2YDXA 3IAM1 3B6ZA 1K97A 1O94C 1JW9B 2EW2A 2Q3LA 4E5PA 5I9SA 3DMFA 4LYFA 1PLJA 1T4CB 4E13A 1QLWA 3KSDO 1CZRA 3HDTA 1ORWA 3D6UA 3JZIA 3PNKA 4WBNA 4QIHA 1YHYA 3E7PA 1M72A 1G18A 2B4KA 4M1SA 3HHPA 5AI9A 4ZAZA 1UUFA 4E88A 2WOJA 3B13B 3R7AA 3WP1B 1SU6A 3AGPA 5LVAA 2O2EA 3AT1A 2XVAA 4CMEA 1NZJA 2QTBA 4I4TB 4B4WA 3NEAA 2BGRA 1QYRA 1RQRA 2H3HA 3GZTB 1QBKC 2YOHA 3QXSA 3RIYA 4DMFA 1A96A 3CUKA 1GZDA 1I10A 5ESXA 3T0FA 5KC9A 2Q9AA 2R8EA 5JDIC 2XF8A 2PSHA 4F8EA 5TARA 3P9SA 3WLHA 1C3JA 4Q7JB 4DL9A 3DCNA 4JA2A 3L9WA 4GPIB 2QRVA 1BNCA 5HUJA 2D0PB 2QA5A 5TPWA 3RARA 1NVWQ 3IUMA 3SIPA 2HEGA 3T3EA 1OGIA 4BGVA 1PSZA 1XJ0A 2QRVB 1L5HB 3E9MA 4DF3A 4O63O 2Q2WA 2P1DA 2ERCA 2IDKA 1QTIA 2XEDA 2IYOA 2XTMA 1L5HA 1O0CA 1UDRA 3OX4A 4FFPA 3AJAA 3CZRA 3EEBA 2XECA 5B4VA 1AK2A 2FPSA 2X7XA 3K1YA 2JHFA 3HFJA 2GRUA 1K66A 4FFMA 1C81A 4S12A 1JA9A 1Y7LA 2H85A 3MRSA 4MQ4A 2HJHA 3A1DA 5LYYA 3DJFA 3PLAE 3EXG2 2IJGX 1JG3A 3C6BA 3CC8A 4GP6A 4HEQA 5ED0A 4Y2TA 1GKYA 5B53A 4I8XA 3S68A 2ZYVX 3WLFA 4D3ZA 4PWYA 4R7TA 3O4GA 3UTDA 3ROKA 5JJKA 3EVBA 4OU5A 1ZGZA 3V4OA 3WRWA 1NOIA 5DYTA 4ZCTA 1OC4A 1X38A 3MF4A 4G9EA 3PRKE 4QECA 4AXBA 3LUDA 1SXIA 1GPDG 2I4RA 4KXQA 4NHEA 4RA9B 1LWOA 1IDN1 1U1DA 2AJDA 2A1IA 2VJOA 4HNGA 3HDJA 1XXLA 1Z0AA 4LYJA 4N7RA 1G9TA 1JPJA 3OWXA 4KLZA 1ISRA 2JJYA 2WIDA 4IIJB 5EE5B 4XI9A 3U26A 4IDPA 2XCRB 4EHKA 2FSHA 1EDEA 2MR6A 1G291 1YMVA 3GLHB 3IHLA 4KUGA 4PC2A 4RFSA 3WMFA 2CJWB 2FSGA 4YLEA 1T9CA 1E9CA 4U9UA 4WKNA 3G2KA 3AV0B 5HE9A 1E9DA 1E9EA 4QBGB 2F9MA 4R2LA 3PL5A 2ODAA 1LNQA 3AW9A 1MAUA 2BFBA 3IDOA 4BUJA 1EXDA 4JI7B 3TAHA 3GH1A 2PAAA 2XUDA 2NZVG 4P4GA 1IPHA 5D01A 2OORA 1U3CA 3NVAA 1FU8A 1TMGE 2AJ8A 1O6CA 2ORED 1NVAA 2OV1A 4J43A 1PFVA 5IUNC 5K8CA 3LOUA 3TRDA 2E4YA 1YC5A 2BFCB 3N0VA 5D85A 5E9JA 4YRAA 2J0QA 2RC6A 4P83A 3Q9LA 2IIQA 3UJDA 4DADA 1QPGA 1GV0A 1MJ5A 3UIEA 2O57A 3L7AA 2HWYA 4RZHA 5DK6A 5K6RA 1DTWA 3MT0A 1RLUA 3EMVA 4ITUA 3AEKA 4IVNA 4MP3A 2AC4A 3T15A 1EJ2A 1ZUNA 5LD2B 2YDYA 4E94A 2IX9A 2PGOA 2GZ3A 5HKKD 1H0HA 1QHIA 1G5RA 3ASZA 2JLXA 2AIRA 3OLXA 2BFDA 4Q5IA 2Q6VA 4W1RA 4CEHA 1ILEA 3B1VA 3N53A 2OB1A 1C14A 1QHHB 5KSOA 3PQ4A 3D4BA 4Y6PA 3C3PA 3WB2A 3WIOA 1B00A 3MAAC 2JEZA 1DELA 5K7SA 4KPYA 1ENYA 1T13A 3E0QA 1ZO8A 4C0WA 1D9XA 1GAQA 1UMDA 3DHEA 2C8VA 1G8AA 1TKRA 4DIFA 2D5LA 3PG5A 4RXMA 1TM7E 2XDQA 4ARIA 4XIIA 4C03A 4YRCA 1KH3A 2XVYA 1ZCFA 2ZQYA 3D4LA 5K99A 3FBTA 9GPBA 4O4JA 3GIDA 2B98A 5AW6A 3TM5A 1JH9A 1CBUA 2CLKB 3Q3HA 3VKWA 2VTVA 2WQZA 2M6LA 2GO1A 5KNLA 4MGYR 2ALJA 5JMTA 4KMMA 1DAMA 1JHVA 3UG6A 2HJVA 3GD5A 1A69A 3DBVO 1OI7A 1QNLA 3D3NA 3LW7A 4G1VA 2JFGA 3TOCA 3R7NA 4BATA 2P91A 2XDAA 1TYAE 4OXIA 4E32A 1WZUA 1YUMA 3WJ2A 1HTWA 1KDTA 4PN7A 4RCVA 3U6KA 1ZLYA 3C3MA 1KI8A 4UUQA 2CVQA 3EB9A 3O91A 1KO4A 1H4VB 1ZSYA 1WVIA 2IEAA 3EEQA 3DMTC 3KYDB 3QFTA 1MB0A 2WABA 3BJMA 4DNOA 1V71A 1IIRA 2X8WA 1ADYA 3UGQA 3UQYS 2ZSAA 3WQSB 4QJ3A 2O23A 4FJ1A 4HAYA 4QUBA 1X1QA 2AF3C 4FK8A 4WBXC 4DMCA 1Q11A 4N9QA 1BD3A 5J9FA 3QELB 4RHTA 1KP3A 4JLBA 1XZLA 2AQ8A 4D3YA 2ONKA 2V59A 2XYPA 3TTVA 4IGIA 2FXIA 2JGLA 5J5CA 1GG8A 3GNLA 5JCOA 3BKXA 3UXHA 5CLFA 2ZB3A 4H6XA 1U3VA 1EHYA 1ZVMA 1XIVA 4XFDA 1MJFA 1V1MA 1JIXA 3RO7A 2UXDB 3Q41A 2Y0BA 3C1OA 4MA4A 4URXR 2XNCA 1UBCA 1J09A 3CRMA 1EBUA 1N6HA 4Z6KA 4BO3A 2YWRA 4N7BA 1CQIA 1JFVA 1U2RA 3E3LA 3B1KA 2ZB7A 2H2AA 3EXAA 4AMUA 1CZNA 2H1RA 5BVHA 3JY6A 4Q3BA 3NT5A 1VIYA 1XL1A 3K6JA 1YE5A 3RWOA 2HREA 2FWRA 1P1RA 1G8PA 1NN0A 3CH7A 4HAVA 4RSGA 5M5BA 1CJTC 3PXXA 3UBMA 4RIIA 5D84A 4P5PA 1KJZA 2G5PA 1PFQA 2GNOA 4L16A 4L6AA 1AF7A 2VPYA 2XT6A 5CITA 5C8DA 4X3OA 3RNOA 2FWBA 2YNMC 2H4YA 4MVJA 5HJ7A 3BF8A 1K8RA 2XB4A 5BT9A 4G41A 5BN1A 1SVNA 4JX8A 4YJ3F 4EYSA 3OFJA 1J1IA 5J4LA 1I1HA 2WSSD 3U7QB 1FFHA 1CVRA 3DTNA 1Q16A 3MWDB 1H6BA 2YYSA 1W59A 2NUPB 5FAKA 4IMPA 1UOEA 3VZQA 2AN1A 2P2NA 2DY0A 4Z0NA 1IXYA 3VPBA 4P22A 2VDWB 1S9DA 1SFRA 4WZAA 4BJ1A 1GRQA 3UBTA 1T0UA 2PO7A 4C88A 4WLOA 1ZXLA 4R54A 2JFQA 4PGFA 5I7HA 1VQ1A 5JAQA 1J8DA 4L50A 3O8DA 4PRLA 3LE8A 3R5FA 2DKNA 1E79A 1S2OA 3BUSA 1THMA 3DNMA 3KHTA 5DBEX 3F6EX 1R8SA 2ZEJA 3G2HA 1YS4A 4KTTE 1WY5A 2HD4A 2XCSB 3FGNA 4NICA 1E6CA 2NAFA 1L8OA 2BRUC 5IJZA 4GZ5A 1QMGA 3DB2A 2QX8A 2EAUA 4N4AA 1ONBA 1I5EA 2W6NA 4UCXA 5D1NA 5KYXA 5FNVB 2LTAA 3UCFA 1PUIA 3OJ0A 4X1YA 5C32A 3TAUA 2A5YB 3PC6A 5IT4A 1A7AA 3DBOB 1T1GA 3KLNA 4V3BA 4ZQIA 3W9BA 4CG3A 4EJ6A 3UJCA 3BT7A 5SYAA 1FY2A 1I1NA 3IEMA 3AVXA 1Y0BA 4LC9A 4QJIA 3DVSX 3Q15C 2O0JA 5LBIA 1ZU5A 5C9ZA 4W5JA 4S1NA 5EE9A 4CR6A 4BE7B 3KEQA 3IYLW 1GFWA 1WEKA 3DP9A 1SA0A 1ZSNA 3NHRA 1FFWA 3T9DA 3PQ5A 1IZYA 3CZPA 4LJ5A 3WGTA 1R6UA 3E5RA 4TQAA 1EWVA 4QODA 4Z0TA 4HWKA 2X0JA 1P2GA 3WX0A 4D9MA 1SKBA 3AOGA 2VZ8A 2GKOA 4TZTA 1PR4A 1T3TA 1CJSA 2W7TA 3CNOA 4ZD6A 4B5KA 1PUJA 2YZGA 3T9AA 5CEEA 1DQZA 2QDXA 5MFZA 3JQAB 2N1MA 4GRIA 1A3CA 4ZANA 3BGSA 7ADHA 1YJAA 2HF9A 1WDTA 1IMOA 4FHEA 3TEFA 5FUMA 2QBYA 1EFVA 5ICFA 3O47A 5TY0A 3TW4A 5J40A 1AQLA 3W5JA 4F2HA 4DLPA 4MWOA 2W93A 5DLQC 1I5RA 3H9EO 3VHXB 1WOMA 4UUNA 5I01A 4N1AA 2VCEA 4DLLA 3KQQA 1JECA 2FFAA 2VDNB 2ZR8A 3ZK9A 2QLMA 3P2EA 4KR9A 1PVVA 3L04A 2G77B 5BSKA 3HUDA 3NH6A 3QNWA 2VUIB 1LU9A 5AW1A 5FBHA 3P2JA 1M1NB 4EFLA 3QWHA 1ZKDA 4OQEA 4BV3A 3K70D 3KFLA 1YIAA 1JQJC 3R1IA 1ZJ5A 2HM7A 1P5HA 4HNAA 4Q4HA 4ZAYA 4D41A 2VT6A 3GIWA 3AIKA 4U4AA 4DQDA 5JZOA 1TUEA 1AA6A 2ONCA 4WN9A 3RVMA 3UF0A 2OFWA 3E1GA 3NKLA 4F1WA 4C1NA 2Q3DA 1EFPB 1JG7A 4B81A 2C3OA 2FZLA 3IS3A 3LAWA 1RC0A 3U7RA 1XVVA 2ZYDA 3M9WA 1N1MA 4XLLA 1PD1A 3G9ZA 4LMBA 5CT6A 4YHBA 2G7MC 2NV2B 4ZQFA 5E0KB 1C7JA 4M0MA 4C0HA 4BMVA 3ZDZB 1DKUA 1MX3A 3ILSA 1BJRE 4C2AA 4EB3A 2QROA 1KFJB 3URMA 1Z74A 4DMRA 1O4VA 3MJVA 1XEFA 3ETGA 3NV9A 4DM3A 3P2OA 5KOIA 4O1HA 3U09A 4PFKA 3UJ7A 1V3QE 1YZ3A 4MUXA 1GUBA 1NATA 1MV5A 3VU8A 1SHTX 1UJBA 4N6OA 3A0UA 1T3HA 4OQXA 3CSSA 4MO2A 3DZKA 4GUAA 3RC1A 4FR0A 3RGWS 2FW8A 1E0KA 1U9CA 2BM1A 1UC4B 1JEOA 2QL9A 3M6MD 5THQA 3ETJA 3QG1A 3NGLA 3ZQUA 4YDHB 1SKMA 4I6JA 2QPAA 3B85A 2QLTA 1IN8A 1EGQA 1VDMA 1Y7HA 2F59A 4V38A 4MIYA 3ZE7A 5DTMA 4JA0A 1OVMA 1HGXA 1YR8A 2IOFK 3DBHA 5LD2C 4H7IA 1T4CA 2B36A 4ZHQA 4I8DA 1EWTA 1GQQA 3F4LA 2PX6A 3TS1A 4AJHA 4ARVA 5AI0A 3V4SA 4HX9A 2A78A 1ODJA 3JWHA 1KJ8A 3K2BA 1O57A 5CT4A 4UHJA 2C1ZA 2OCGA 3CNBA 1MLDA 2O2ZA 3FYUA 2XVMA 3L7JA 4LSWA 1ONOA 2A1TS 3DO8A 2REOA 1Q2XA 2UZIR 5DH9A 3DEYX 5BV1A 1Y81A 3I5XA 4J9UE 1B7GO 4JQOA 1X6VA 4UM8B 3T3GA 2Q1WA 3AQ4A 3ZK7A 3E9NA 3N58A 3VR4A 2Z5GA 3E2PA 4EKDA 1N34B 1SWVA 4R1UA 3D59A 4Q9KA 4E3ZA 1KDPA 3KOYA 4FCTA 1M7HA 1E2EA 3EXG1 1CK4A 3L7DA 1KK1A 3F9IA 3P4UA 4ITVA 4FM9A 4DA4A 4M83A 2J87A 1ZH4A 3LL7A 4QBFA 1HDIA 4LJLA 5FULA 5LZ7A 2GK3A 2HYDA 3AR6A 3DPUA 3QENA 1J9ZA 1FFXB 1NFFA 3FFTA 4H1UA 3W8EA 5HJ5A 5I7UA 4NYMQ 2PBRA 3A1EA 3ICVA 3RFTA 4D4JA 1MB2A 3EYWA 4LZJA 3WNCA 1VJ1A 4RH0A 3L46A 3DCIA 3V2UA 3SI7A 4MIOA 5BR4A 2OHJA 4WLEA 3WFJA 4BLVA 4EEXA 2GD1O 4QA9A 1JNXX 4AB1A 4MVJM 4AO7A 2I4TA 1U0EA 1ES9A 2AX3A 2V7EA 1KOGA 3PICA 1YS9A 3D4PA 3T5PA 3ELDA 1AVTA 4EUKA 2Y2UA 5C80A 5LKAA 1U4OA 4MULA 3WE7A 3WWYA 4C06A 3GVHA 2AN5A 2YASA 3R41A 5KHAA 4DT1B 1AH2A 1YB5A 1DT5A 1P1BA 4RD4A 4D9FA 2WE7A 2JH3A 3NJ4A 5L3QB 1IVSA 4FR2A 3AYZB 3C3CA 4JKYA 4E6EA 1QP0A 2C4NA 4QM7A 3LWDA 2ZBQA 3U48A 1JPVA 5E6UA 1E0JA 1GO2A 2V6IA 1ZUWA 5KJCA 4EYQA 1PS8A 3K9QO 3SSAA 2GZDA 2B3TA 3EHEA 4BJHB 1H93A 5ED4A 1E1CB 3F96A 4TT3D 5IS2A 3RVDA 3QBTA 4ENQA 1DDIA 1ND5A 2AJTA 4JQSA 3WMXA 4BJ5A 4DAOA 4CN8A 4CDMA 4BQFA 3CX7A 2KM1A 5JFGA 3JRWA 4DMLA 1OWOA 3UYLA 2GA8A 2Q5IA 1Z12A 1KJJA 3KLMX 5AM5A 2KLBA 2CJWA 4H16A 4CJXA 4DJFC 1GTMA 4KK4A 4B8ZA 4GR4A 4NVRA 1OAKA 1JUDA 1USKA 1DAOA 1B15A 2C8KA 2ZVPX 2OENG 3BCSA 3EGVA 3PZBA 5K3OA 2QRHA 2VN8A 2ATXA 1KQNA 2A1UB 3PX2A 3M81A 2QGFA 4LCBA 3D1JA 1MAAA 3KETA 1QHEA 2Z2JA 1FFAA 5BSEA 3IV9A 4EZEA 4Q4JA 3KQWA 3GDOA 2RGXA 5CW2A 1JTFA 4IILA 4RWZA 4WL0A 1WL8A 1V26A 4MS4A 1X1AA 4PX3A 1AV6A 5JSQA 5HOEA 5KNBA 2PGDA 5L9AA 4PO9A 2ECKA 4I9FA 2BGWA 2D0DA 2QJOA 1UDXA 3K9NA 2VJLA 4IJUA 3RFUA 3CLTC 3V80A 2H18A 4EB8A 5JHHB 1CY0A 4J0FA 3T3PB 3UEOA 1M6NA 3PVSA 1RXIA 2IUTA 4TKUB 3BDAA 1U2DC 3DLCA 4B3XA 4TTTS 3WGKA 2AE1A 2VHZA 3B36A 4H1TA 3MFYA 3DBRA 4PTLA 5AVRA 3NYIA 3JQ9A 4MVWA 1Z35A 1WHTB 3KJEA 1UKVY 5ADHA 2YV5A 3RHTA 3NXKA 3ZWYA 5G0TA 2H5LA 2PKWA 3L8ZA 4EG8A 2BRUA 1SKUA 3S55A 1BIFA 1OFGA 1QK3A 1XCJA 2FN7A 3KJFA 3QF4B 3C1AA 3DBIA 1DJNA 1QG0A 2D2EA 3DF7A 1K7CA 1ZVJA 2QTCA 3QYFA 5KYNA 2C2ZA 1TF5A 4LSZA 1TA9A 3CRQA 3H2YA 3IQEA 4GWKA 2OQIA 4IH1A 4F4IA 3IAXA 4BO4A 4AK9A 4M1QA 3UENA 2UYGA 4PXSA 2Q21A 4J4BA 3D6NB 4KLCA 1ULSA 3PXAA 5HIMA 1FU7A 5ILGA 3Q1LA 2V4UA 3NTVA 2V97A 4FXOA 5F7JA 1KRHA 3W2FA 4AZTA 3ZH2A 2ZYGA 1LK5A 3GZJA 4Q3LA 4MHSA 3TJRA 4BLOA 1JIVA 1KARA 3EIXA 5BP7A 1YTLA 3ABZA 1E2MA 4W5WA 4BRWA 5CXUA 4LRUA 4AYWA 2JGKA 3D1LA 3C3WA 1BXKA 2A9PA 5IMSA 3SF8A 3BTVA 1AZWA 1BVYF 2A9QA 4YVFA 5D1HA 3NH9A 2FE4A 5DCYA 4JP8A 1GTSA 2EC5A 2ZAGA 3ZNNA 1H9CA 3DM9B 5T3UA 2DUJA 4PRZA 1E5LA 4K26A 1TQ6A 4BNUA 1Q0TA 3KQTA 4PAQA 4QOEA 1KY5A 1UDBA 4K6OA 4PTYA 1ADBA 3IHKA 4ZVOA 3OM9A 3GL9A 1ZCZA 4IV0A 5HBGA 3T35A 3WYAA 3LZDA 5BR7A 5MGBA 2GPWA 4IRXA 2IYSA 1U2DA 5IF9A 1OHHA 1ZCBA 4X1OA 3S6JA 1RLJA 1T6XA 4L5IA 3IX7A 4B73A 2F1JA 3WSTA 5DGDA 1SVIA 2CLOB 2V8OA 3PS9A 4B17A 3GFTA 2ILVA 2PXCA 4XDHA 4PHTA 2HNKA 3KO8A 4CKBB 4TTIA 3LIIA 1KGSA 4UU7A 2FSSA 1LW6E 1CB0A 1SOVA 2VAMA 3GUYA 3NASA 4KODA 1JG6A 4R6XA 2LWIA 4YRZA 1QQAA 1J06A 3O94A 2VDKB 2VO1A 2M2IA 3BWVA 4RVHA 4YUYA 1N9GA 5ES4B 1Q7GA 3ABOB 4TLBA 4FZJA 2DH5A 2J0SA 4F0JA 3WYBA 2E5LB 5AICA 4DABA 1P7WA 3GNQA 3DPIA 2XRFA 1C9YA 3DNFA 4M99A 3N3BC 1PL6A 4BKMA 1WB5A 2CNWD 4NFYA 1RXUA 1U11A 4GNKA 4MPJA 4B6PA 4L8GA 5KKAA 2IOFA 1PBNA 1DIHA 4YRRA 3TQRA 1CETA 2F00A 3TVDA 3V4LA 4AVYA 3A10A 2QRQA 1Z4MA 1XDBA 1BOOA 3G5TA 4D02A 1TM5E 2VPTA 3QV2A 3S0JA 3M8KA 3W5UA 2AVNA 4JZKA 2ONYA 4QRIA 2X5JO 4X94A 3DLTA 3SG0A 5BXQC 1RM4A 1W36D 3HC7A 2PZEA 4UBMA 3MJDA 4J1SA 5KIAA 3KUUA 3VTKA 3TSCA 2NUPA 2ZR7A 2I1WA 1H5NA 7ABPA 1AHIA 1W1IA 2IW3A 4AQYB 1ZJWA 1OJLA 1P5FA 2N0SA 1YD7A 5CLHA 2WKRA 3DO6A 2JB9A 3M5WA 1W30A 3VVMA 2GEFA 3AR9A 4GBGA 4QLOA 3R3ZA 4EYKA 3ANYB 1UMBA 3UUWA 2CJFA 1JDNA 2R1VB 4QXAA 3FWHA 4CQLA 2CVPA 2IYTA 4HNVA 3NU1A 2VUHB 5JH7A 4L73A 2Q8PA 3MWLA 3PE6A 4HS4A 4OEHA 3I37X 4QASA 3QY0A 1LQTA 5KYXB 1J20A 4G63A 5CVVA 2WWVD 5AHRA 2CMHA 4YEDA 4QOGA 2BSQA 1CQPA 1TNDA 1GITA 2HA2A 2HSJA 4LKOA 5AXAA 4RU1A 4R84A 3NATA 2LDBA 2EWWA 4H7JA 4H77A 3R7SA 1X77A 2Q4DA 1SRRA 1QQ5A 1V3UA 2QX4A 4O4IF 2LZ0A 1LW7A 2I34A 3AOEA 3ZV3A 4GKJB 2IZ6A 1UBUS 5I4CA 3CEHA 3LP8A 2VDUE 1FFGA 1W85A 2Q8NA 4XPIB 3BWBA 4K46A 2YN2A 1WD7A 1CS4C 4U7WA 1TEVA 3R6GA 4H1VA 4L75A 4CDNA 5CBPB 2WV9A 5D3MB 1KEEA 4AD8A 4C21A 1GA1A 2LDXA 4FMDF 3D3WB 1ITZA 1D2RA 1EESA 3KL2A 1CY7A 5ECWA 3ZV6A 3VNQA 1KQFA 2Z2KA 3T3MB 1A7JA 4HNQA 1F6DA 1CE8A 1S01A 2AX4A 3TLCA 1NV8A 2X4IA 3IOEA 5BSHA 3FLBA 1R12A 1I8TA 3DEJA 3HNPA 1L5FA 1XCPA 1NNLA 1EK0A 3SHQA 2QVXX 2O7QA 2WM3A 1NW8A 2YJGA 3MBOA 4FMBB 1AHPA 1V5GA 3KXIA 1RMQA 1UK9A 4RV5A 4UMEA 5I9NA 2O8CB 1MRSA 3RRXA 2J3MA 5I9MA 4QSHA 3KK0A 1J0EA 4O33A 5JIBA 4DB4A 3F8TA 4K1XA 2YV4A 3EQ8A 3ZWPA 3CNEA 2YR0A 2VF2A 1PR1A 1FMCA 3RAGA 5DIZA 1Y8AA 3PWZA 3ELYA 3HY6A 3QPDA 3H18A 1EG2A 2J3IA 2OG2A 2WYUA 4FLEA 1T15A 1JVBA 4JLNA 1H2AS 4WV3A 2C0QA 3ELWA 5GGXA 4IW3B 4ZOLF 4JJKA 1NA5A 1M6VB 2IHJA 2ZULA 1OBCA 3NM6B 4ARZA 2OOKA 4MVJD 3ONVA 4DOMA 2HX1A 1BE0A 2OGWA 4ARZB 3OQJA 4BLQA 2NO6A 4GL2A 4F7WA 1AS3A 1GAWA 721PA 1EUCB 1CYEA 1J8YF 2JKZA 2IS4A 2OAP1 2IP4A 2V55B 1RYMA 1XA4A 3HCAA 2W2XA 3OD1A 4G0PA 5FI3A 3R74A 3G3EA 2R79A 4C4RA 1H0KA 3TJMA 3F6RA 3OZRA 4NZNA 4RQBA 5A0VA 2FCRA 5DLYA 1DOAA 4ETIA 8GPBA 1JXOA 2ZDQA 4G5HA 1SEVA 4E7PA 4YX9A 2R84A 3GN1A 3HU3A 4ND8B 2DWQA 3OESA 4G5XA 4UDYX 1H2YA 1QTNA 3EZYA 3ESAA 3MOGA 4RW0A 1T5LA 5GONA 4ZO9A 1WAMA 3AO0B 4QYTA 5JDCC 2AWNA 2JJ1D 4C14A 1SXGA 1ZMRA 3ZEIA 3W9UA 1N6RA 4I36A 3ITEA 3T0IA 4BFYA 2D7DA 2J07A 1SBTA 2DR0A 3CWCA 4YPOA 4IXMA 4U2KA 2GFHA 3GQBA 1TUBB 2A9RA 2O19A 3BMCB 3G9XA 1SBIA 4EFDA 1RYFA 1BW9A 4G5FA 5EZQA 2CSUA 4H7DA 4HWRA 3NUQA 5FWXB 3F3SA 5ALTA 4DFDA 3LW8A 4CL8A 4YRIA 2C94A 3FYUB 4NU5A 3PGJA 5JH7F 3FPCA 5ILQA 4L5YA 4XGQA 5JYEA 4TL8A 4KE6A 3I61A 3I5MA 4HMOA 3ZDRA 5DEIA 3C3DA 1H2WA 4DREA 1T4GA 4R2JA 2D2IA 3SY8A 2G5GX 3F98A 3I0NA 2OO7A 2RCYA 2JFOA 4IICA 3WLKX 4DLWA 1I2DA 3K2EA 1DO2A 1ESZA 4CKCB 1LCIA 1YBVA 2ECOA 2HY7A 3NHPA 4A16A 2WF7A 4PGHA 1H2ZA 3NIDB 2H52A 2C9YA 1BZYA 2WM2A 4GE3A 4MUFA 1C41A 5HKOA 5CRIA 3PHJA 3U60B 2NOAA 3I62A 4KPUB 5A3RA 4JXKA 2FK8A 1FMFA 1VOTA 1T24A 5DHPA 1XNRB 3L41A 1H05A 1C7QA 4D0NA 1JEAA 2BR5A 4YFVA 4AG5A 2Z5LA 5AUOB 4M1ZA 3M6AA 4UUPA 4KYUA 1GYRA 5EI5A 4F86A 1LPNA 4B47A 3ADCA 3F78A 4CEIA 4N76A 4OHBA 5ALHA 4JI0B 3EMKA 1VE5A 3E03A 1OIXA 4I6EA 1MORA 1OWPA 4CZ2A 1PV4A 3IFSA 4HSGA 1KK3A 2C8JA 3DYBA 3KKLA 2PZGA 3NJRA 3OM1A 2OBLA 5TMPA 3AESB 1W4CA 3P9YA 4QPCA 1HDRA 2Q0QA 4G09A 3D3EA 4AF8A 5DM4A 2Q27A 3FLAA 1U7DA 3C5CA 3RC8A 1TAHA 5I7FA 2GN1A 5G02A 3TG8A 1V9LA 3L6BA 1LJ8A 3GEIA 3TQIA 1FNNA 2H7CA 4URUR 1QIMA 3CVVA 3AP1A 3ET4A 5C8YA 4G26A 4PIPA 1VGVA 2RGUA 1W49A 2RBGA 1BGWA 2MINA 2XTJA 3H2HA 4LBYA 1ESCA 2YQ4A 3CO5A 4ML3A 3C8DA 1BC5A 5EHIA 4EMBA 4PRKA 1G98A 3LY7A 1J0AA 1M8GA 5L3ZA 3R5SA 4FBGA 3N8GA 2Q49A 4ASUD 4CG0A 3I58A 2F1IA 1OXTA 3H11A 3WLIA 2BZSA 3AERB 4GZMA 3LPLA 1NBIA 3STXA 5JI2E 3EOBI 5KTTA 5LDHA 1VIMA 2A4KA 3H11B 3PDUA 4KV9A 1GQYA 3O5AA 1CZHA 4OQYA 4OTZA 4BQPA 2J3JA 1YDMA 1K89A 5LPNA 3CLUC 1U9JA 1Q57A 1U2PA 1ZM4A 2V3WA 3OZCA 4HUJA 1LBSA 2VJAA 4YFYA 5ER6A 1BQ4A 3UICA 4DARA 2NV6A 1EUDA 2IPNA 4UHBA 4XYBA 3IP9A 3C7KA 1U4NA 4P81A 5AJTA 4U7JA 4Q7LA 4I3FA 1RCTE 1FFEA 5B6PA 1BQ3A 1NE2A 2O3QA 3LPDA 2QRZA 4W5TA 3J7AC 3O8CA 3NW9A 1MOSA 5K0BA 1D1SA 4DQXA 1VHQA 1ZK4A 3F97A 2QJFA 2WJHA 3GFSA 1EVKA 2A7XA 3LYAA 4HADA 4L78A 4TVKA 4CEJB 1USWA 2ZTSA 1HNZB 3Q72A 1XYYA 4DQKA 2X5KO 1K7FB 1X70A 5DHQA 2C54A 3NWJA 4X5OA 1T8TA 1G7TA 2I33A 1E2QA 3QEAZ 1U0FA 1CXZA 3DMGA 4I14A 3A3PA 2AZXA 5HCUA 3E8MA 4CG1A 1AG9A 3CY6A 4IDNA 4KPFC 1YI0A 3LOQA 4Y67A 3ZWVA 4BGEA 3NEYA 2V9ZA 3HDHA 2C82A 3TLAA 4H15A 3TNDA 2XDYA 3NRJA 5DTJA 3FDJA 3NANA 1CB7A 1EX1A 2M98A 3OI7A 1QP7A 4DLAA 4KSCA 1QDLB 3LF1A 4ZC1A 4S35A 2DY1A 1L7PA 1ZESA 4DWWA 1UBGA 3Q3IA 3N39C 3NHMA 3T5CA 5DISB 4C08A 4BNGA 4FC7A 3EAGA 1KDZA 1EEHA 5FH9A 2AFVA 2A14A 3B8HA 3H8JA 4CCWA 4AY2A 4A0FA 3JZMA 5LZ9A 2FUG1 2G06A 3CLSC 3LRTA 3RRZA 1P9NA 2ESRA 3KX2A 2EBHX 4Q24A 4X7BA 4TLCA 5E2IA 4COKA 2HWKA 1MC4A 3G5LA 3N2LA 4MYUA 4P34A 4N47A 3L8HA 4HXEB 4MUMA 5AJZA 3UN1A 4IIFA 2K87A 1ESMA 3HVUA 5KX5B 2Q99A 5KWVA 4HQKA 4MLDA 1KIMA 1GPAA 2R87A 4ZVVA 2C7QA 5HQJA 1HK7A 3N75A 2XSZD 4KNVA 4U6NA 4A2WA 2H11A 3BORA 2YBDA 5F2NA 3FR7A 1XDWA 4WEOA 1EK2A 3HYLA 3RLFA 3B38A 1Q0RA 1IEXA 2YV1A 1IWOA 1BEEA 1MX5A 3EC7A 4Q3NA 5M2QA 3VNBA 2VLIA 1XDUA 2XRMA 4NBLA 2ZVJA 1N0UA 2X3UA 2J45A 3HCCA 4P93A 4RTRA 1Q0UA 1W19A 4KNWA 4D9IA 2X9LA 1RZRD 1O0SA 3WBFA 2G0NA 4K9RA 4PG7A 1V6AA 3ROQA 3V8MA 1LPOA 1DCFA 1SGWA 3HUTA 1M0TA 4Y98A 5JY1A 5AESA 1OX5A 4KQXA 5IAJA 1E1DA 1KPHA 3ZCTA 1EFDN 4EIWA 4INPA 2Q62A 5AO9A 4X00A 4X6LA 4R1MA 3RYCB 4QYIB 4E4TA 4AY6A 3QBEA 1NL3A 5DTRA 2ZB2A 1GD1O 3L05A 4XIJA 4YAKA 2EF0A 2HIHA 1RC1A 1SIUA 3V33A 5HRUA 5K8UA 5LYJB 3LQYA 2AHOA 2NU8B 1RI3A 4HDOB 2G0TA 4QSMA 5DMXA 1L3IA 4PYJA 3WBKA 1C4WA 2WICA 4C6TA 4ZMSA 4MW9A 5B3JC 2CL6X 1SXJD 1XHLA 1VYVA 3Q2IA 4UVIA 2E4AA 4NYJR 1W5BA 5B2FA 5I4KA 5HBRA 4WXYB 5LP6C 4CUJA 2ZBRA 3PJEA 3N59A 5KYKA 1NX6A 4GZ3A 5MFPA 2X4LA 2RHJA 1N8KA 1X14A 1E2IA 2LW7A 3IC5A 2RGDA 4L6CA 1G1AA 4X93A 1HFJA 3S2ZA 4B76A 2PX4A 3PKJA 5WRFA 4E14A 3IAHA 3OCZA 3NHUA 4Z54A 3LCRA 1VBFA 2BMFA 1KJQA 5IC5A 1SCBA 3N5CA 5EIBD 4CMAA 5T4BA 2A33A 4JMPA 1EIZA 1UMKA 2H1CA 4TMWA 5EXTA 3TFQA 1WCIB 1MEJA 5HRCA 3R4CA 1YHZA 3WY9A 4MVJF 1F3OA 4E1BA 4QGAA 1HA3A 2QJRA 4ZI7A 3ZN2A 2IP1A 3B2QA 5BN5B 4N12A 4WASA 4CF7A 3KAJA 3M1YA 3MTIA 4LY0A 3FCUB 5CM2Z 4OOEA 1NYTA 1T2UA 1TT7A 2F4VB 4AJLA 1QG4A 2FPUA 3F0TA 4IMRA 4CU5A 1SOAA 1Q7CA 1SEPA 1QIKA 4GXRA 4LY9A 2Z95A 4DCCA 4M86A 1XR3A 3DTVA 1N3BA 1PJQA 2EWMA 2FKNA 5J2TA 2NUBA 2VP4A 4ER0A 1EU1A 2UYQA 3I34X 2P4EA 2HQOA 3HBJA 4DM7A 3SR0A 4C7XA 1GQSA 1J8QA 2I22A 1UODA 1KC1A 1TLTA 1XZ8A 3UB2A 4LHZA 1KNXA 4Z9YA 1E98A 4AROA 1N6KA 4DGSA 2J9FA 3I5AA 4LVOA 2YWDA 3VZCA 2H8GA 5AH0A 3TWOA 3QPAA 5EG5A 1FQOA 4ONEA 5EJMA 3V8RA 1ABBA 1P4AA 2J9FB 4Q21A 1P9LA 2B4QA 3I6IA 3RFCA 1QE3A 3D8HA 4UZSA 3UAXA 3X1JA 4HLUC 4PXAA 3GLFA 1H3EA 1LDYA 2TS1A 3O93A 4RHCA 4TMXA 1OXXK 3K20A 4Y1FA 3R9KA 4D46A 1WIWA 3UWOA 2DE0X 1RFGE 4QXOA 5ESDA 2AJBA 1V8BA 2VK1A 3OFND 1E0DA 2Q3EA 3C16C 4XX0B 1WU7A 3FOBA 4R1NA 1AQJA 1DBIA 1G5FA 1Z5GA 4JEMA 4RLHA 2GZAA 3K8ZA 4TGLA 3UOWA 13PKA 4Q1DA 2I5PO 2FZEA 4PIMA 2HCBA 2PA0A 5J63A 4EHNA 2QMOA 5HTKA 2HBZA 4YJ2F 3I6YA 1T9ZA 1E2UA 2JJ2D 3E05A 4MUAA 2YY6A 3LBNA 1KPGA 1ICIA 1ZXBA 5EKXA 2ENWA 1IAVA 4W5QA 5K4HA 3ETNA 5H82A 5AI4A 2PA3A 3WRYA 3QE2A 4TVBA 2EZ8A 1B14A 3PGA1 4YQEA 1A4XA 1UPFA 2JLYA 2GJKA 4ZI7F 1C0PA 3EFBA 4F5ZA 4N65A 2YWJA 3SDZA 4X1IA 2NU6B 1ABFA 2X0FA 3RJZA 1Y3CE 4M0DA 4MGIR 1PX0A 4N54A 5AVZA 3MB8A 1KEWA 3E18A 1Z36A 2V0NA 4KSYA 1RWQA 3WGLA 4XUCA 1NDQA 2PNJA 2B20A