4NC0B

Crystal structure of tcda-a2 bound to a26.8 vhh
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
124
structure length
124
Chain Sequence
VKLEESGGGLVQAGGSLRLSCAASERTFSRYPVAWFRQAPGAEREFVAVISSTGTSTYYADSVKGRFTISRDNAKVTVYLQMNNLKREDTAVYFCAVNSQRTRLQDPNEYDYWGQGTQVTVSSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Cell wall-binding repeat protein
publication title Structural Basis for Antibody Recognition in the Receptor-binding Domains of Toxins A and B from Clostridium difficile.
pubmed doi rcsb
source organism Clostridium difficile
total genus 33
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2013-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nc0B00
2G5RA 3TJHD 1T2QH 1A1MB 2PTTB 5CGYD 1H3GA 3HI5H 5HDBE 2XN9D 5C07E 2VDPL 3Q0HA 4OLUL 4ZFZB 2EYSA 2IADA 4ZUTA 4FQQA 2BCKA 1MVFA 4JLRB 2X09A 2CDEA 1ZHNA 1PEWA 2J8UE 1KEGH 1NDMB 1QLRA 1G9MC 2SEBB 4OCRH 3Q5OA 4QGYA 3L3GB 3SCMC 3VGHA 4CW1B 1G7JB 1RFDH 4WU5A 3P0VL 2PO6C 3K1KC 4JANA 1XGTB 2XV6B 4XMLH 1KCKA 1OSZA 2GT9B 5ERWB 1YEGH 1T2JA 2DLFH 5EO9A 1A14L 4L4TD 5C3TA 3VA6A 5CINH 3MRQA 3FQTB 1YA5A 3KPSD 2Q7YA 2HG5B 2CLZB 4J3XA 4P0DA 3BQUC 1FVCB 5FUOH 3MLXL 5EIIB 1T5WA 3GIZL 3H9SE 4OQTA 1K3ZA 1IEBA 4PB9L 3FO9B 1I8IB 3FN0H 4GLRH 3FRUB 1IM9B 1U8NA 1YY9D 3NCMA 1G0XA 4H1LH 2JIXB 1QRNB 4HMCA 1D5XA 2VNCA 1RULL 2A1WL 1GGYA 4PRDA 5HJ3A 3STZB 5BQ7B 3GHEH 2FHBA 4C58B 1KNOB 2X4RA 4DKAA 4XBGB 1KB5A 3UMTA 3HMXA 4WFHD 1IAIH 3VI3E 4PRAA 4YUEH 2BNRE 2OK0H 3VCLA 4OAWA 5TE7L 4PBVC 1BWMA 4P23B 1OLLA 3L3DA 2HJKA 4Y19E 3WJJA 3DO7A 1I8LC 3CXDL 4P4KC 4ETQA 3EDJA 4RFNB 4GAJH 3LKNB 3ESVF 1EEZA 3FQRA 2BMKB 4P9HH 5C0FA 2C3HA 3EO9H 2P8LB 4AMKL 2VLRD 5IB2A 1T04B 3W9EA 1CL7L 4KTEL 3OG6B 3V5DB 2JLLA 3PQYB 2RGSA 4RZCB 1RQ5A 4PTTA 2BXYA 3CC5B 3O2DH 1P4IH 3S8WA 4OFKA 1KPRA 3AUVA 2ICWA 1OL0A 4DN4L 1RUQH 1IL1B 5D6CB 4YDIH 2NY6D 4NN7B 3C8KB 5D93B 5FO8A 2BC4B 5I1GL 3VWKB 1ES0A 1E6JH 2A9MH 4XNZB 5LBSH 3RWCB 2JK5A 4Y5XB 3RVWC 1DN0A 4ZS7L 3OAYK 1KBGH 4PB0H 2OTPA 2FWOB 5TJWK 4R96A 3AY4C 1S7RB 5IJKA 5TFSL 1UM5H 3L1OH 3KYMB 3NCEB 2VDLL 3OHXA 2DBLH 4N5EC 3SJVB 3WNKA 2K7PA 5T3XL 1MNUH 1XH3A 5EB9A 5INDA 3TO4C 1A7QL 4FQXA 4FXKA 1DQDH 5DMIH 2BK8A 3S34L 4E42A 3F12A 3JV5A 2DIJA 5IMKB 2XZZA 5E7BA 1UB5A 4QXGH 1IAMA 3BYYA 4MNQA 3T1FA 1MJUH 3MRNA 3UTTA 4I0CC 1CGYA 4NHCH 5DUMH 5D2NA 5DC0A 5CP7A 4EUPH 5ILTL 3SY0A 4NFCA 4ONGH 4PP1C 1FLTX 3CDGA 3FB7B 2J8HA 5F6HI 1DQTA 4X80L 3SQBA 1ODAA 1B3JA 4NQXA 4BFEA 5CSZB 4NQDB 3PWUB 5IEHB 2LE9A 3S97C 4NM8L 3O3BA 3RNKB 1JPFA 2ZP0T 4O58L 3QPXL 3UO1H 5FO7B 4XVSH 4AQ1B 2ZJSH 4YDJB 5HHME 2P48B 1SBSL 4F3FA 1R5WB 4NKQB 3LQAL 4JN2A 5F7DA 2BVQB 5JTWA 4KZDL 4NKOB 1CDCA 3TZVA 1HE7A 3KXFE 1CCZA 4NSKB 4YHIA 4R4FH 4Z7QF 2ZSVA 1LHZA 3O6FA 5F71A 5KW9L 2GTZB 1N64H 5DTFA 3CFKA 1VSCA 5DYOA 4RDQF 5IKCB 2GSGA 3DROB 1CDIA 1ZEAH 1YPZE 1HQRA 1CFQA 4BFBD 5SWQA 3QDME 4ZFFA 1Q0YH 3OKKA 5C0IB 4XCFH 1U8OA 2PF6A 3DV4A 3E0GA 1K4CB 3RPKA 4JPKL 4CVXB 2PTUA 5EPMB 2NY3C 5L88L 1AI1L 5FYKE 1FCCA 4CMHB 4JKLA 1RK1B 5CZVL 3QEHA 35C8L 3ARBB 1X5KA 2VLME 3PP4H 5EZJA 4Q97A 3SE3A 3OAYH 2XWBA 3CCHB 3WFBL 4FQXD 4N0CD 4AENA 4HUVB 3PGCB 2G5BB 4HIIA 4DVRL 4LL9A 4JKPL 1A6PA 4G7YH 4MNQD 3MA9L 3UTTD 4PD4K 5L7XH 5FIEA 1G6VK 3ET9F 2Z91B 5CD3A 1OGAD 4MCYB 4YXLL 5I17B 3FQWA 3DV6A 4FFYH 5F3BB 1QQDB 4PY7A 3QCVH 2Q76A 3M07A 1N0XH 1MVUB 2O93L 2O5YH 1UKTA 1YMMA 3S36X 4MNGE 3UTOA 5I66B 2AVGA 5D7IE 2Y23A 3OGCA 4OZFB 4QNPE 1ZLUK 1W2KT 3ES6B 4UV7H 3MRJB 5JO5A 5CUSL 1P69B 2AABL 3VFRB 4LCUA 2Q87A 3BP5A 4GAYB 3OJVC 3G5VA 1NMAH 2GK0B 2OXGA 1M71A 1WAAF 5LWYH 1OTUC 3OJDA 3OPZL 2UV3A 3TZVD 2EIZA 3PGDA 4NNPL 2AQ2A 3D69B 4U6YB 3ZHLA 1I4FA 2J3SA 5GRUH 2NXYD 3FCTB 2R69L 4M7JL 1IEAA 1I7RB 5IVXA 3GMLA 2H32H 5KZCB 4Z0XB 1O7VA 3EHBD 3WEXB 4KTDL 2P5WE 3UTSA 4JFDA 3BISA 3MBEC 1EJ6A 3CDFA 4G9DA 4GH7B 3BEWA 2DS4A 5KVDH 3OAZK 1P84J 1KTDB 5TDOB 5C6WH 3BIKA 4PJEE 3RVXC 1AHWC 2CSPA 1CXHA 4NZUL 3VXMB 3E6HB 1IGFH 3RPIB 1CXKA 3BPLC 3VFVB 5CEYB 5EO0A 2ITCA 1U42A 1DLHB 3CSGA 2X4QA 3MFGB 4NQEE 3O11A 4ELME 2DQEL 3QFJE 2ED7A 2YXMA 4ZAKC 4Z7UA 1YMMD 1RZ8A 4J3SA 4EZMA 4NN5B 2ZUQB 2X1PA 1I9RH 4YJZL 4G6FB 1DBML 4HXAH 1TQBB 3E6FB 5C0AA 1WT5A 4LSPL 4GKNA 4M4PA 4UILH 2DQIL 4MMXC 4IS6A 1IQDB 3V0VA 3CSPA 3FO1B 3VRLE 2QEJA 3NGBB 1ZLUH 3LRHA 4YBLB 2R1YB 3I3EA 4LEXL 5I1JH 3SDAB 2HFFB 2NMSA 3D25B 2XKNA 5CGMA 1P7KA 5IIEB 2W59A 2Q8BH 4ONHA 4JY4A 4NQVB 2RJMA 3S7GA 4U6VH 5GGVH 2ED8A 3GMRA 4G43A 1RMFH 4FQHA 4OKDA 4X5XB 4JQIL 5DUPL 2ITDA 3GRWA 3I75B 4ODBD 4DKEL 4OSUH 4OQTH 1E4XL 4JFDD 1EZVY 1WFTA 1Q9LB 3DX7A 3LS4L 2DJSA 5FYKL 5HDQH 5DLML 4HW6A 4OLZL 1KT2B 4HS6B 2CUIA 1U36A 4TSBH 3ZKNC 3GSVA 1TZGH 1JFQH 3OWEA 5F7UA 3WXWH 3S4SA 5EC1A 1QFUL 4M43H 1CT8A 1KB5H 2P7TA 3HI1A 4HUUA 4QT5A 3HMXH 3U46A 3VXNB 3OAZH 1WF5A 1CDYA 1J1OH 2ZKHH 4I0PA 4AQOA 3DX9B 3RZCC 5BV7H 2G60L 2A6DB 3U4BH 4OF8A 1G0DA 1LO4H 2UZYB 3F8UB 5BZDB 1R3LB 1IM3B 2AEIT 2CRMA 5JA9A 1AFVL 4KHTL 2ORBH 4WU7A 4F33A 4ZS6C 4M61B 3WS3B 5TF0A 4MVBC 3VG0H 4ZMAT 1RJZB 3MLPA 4DQOL 4M8VA 3MRCA 3QI9C 3G04B 3CPLA 3Q6FB 3I6LE 4APQA 4KPHH 2FIKA 1RJYA 1BZ9B 5C0AD 4O9HL 1F4WL 3MRLA 5DJZA 1FV1A 2UWEF 4NP4H 1SM3L 4Q9QH 4QHKJ 3C9NA 2EC9T 4ZUTB 3VH8A 3F5WA 4FQQB 2BCKB 1FVEA 1I1RA 1JV5A 3E3QC 5CEXA 5DFVD 5E8OA 1ZHNB 4OFVA 4KGLA 4M62H 2XRAH 1VCAA 1Z3GL 1QLRB 5E8DH 2PUQT 3QUXC 1INEL 1NCUA 4Z5RA 3JVGC 2CXKA 2UWEA 1JGLL 1TQCC 1X5IA 2HT2C 5EUKA 4WUKL 2RR3A 2YA0A 4BUGA 4TUJB 5F72S 4CN4A 3ARTA 4WDIA 1L7TL 4F58H 5L9DL 5DD3L 2H45A 2R1WA 3AS3A 1L9MA 4Z7VE 2J88H 1G7MB 1PD6A 1L0XA 5EO9B 3V2AR 4QRRA 3L7EA 2VYRE 2PR4H 1A4JA 3RHWK 2VDOL 3MRQB 4WCYH 1MCPL 3E2HB 3FT3B 2WZPD 4MB4A 5E2UL 2Q7YB 2DM2A 5C08A 43CAB 5FDWA 1QSEA 1KN4L 5HHMB 1MHHB 1T5WB 2EH7L 4UIKH 3GM8A 4EI6B 1FNSH 4PJFF 1I85C 3QEGL 3MLUH 4DEPB 1OF2A 4EI5A 4JFEE 4UQ3A 5L2KD 2ZCHL 2YA2A 5IFJA 1ZAGA 4IRZL 3C60C 4KRMB 5JW5A 1JRHH 1DANT 2WM0A 4FP8L 2AK1H 1U0QA 4KH2A 2YC1A 1J8HA 4HIJA 3WHXA 1C16B 1ZS8A 3SGKA 1HCVA 4P5KA 4OCXH 2JJTA 3VCLB 3QDMB 1BAFL 5CMAB 1ZLVK 3WN5C 5KSBF 4FFWC 2HJKB 5HYIA 3DO7B 5E00A 1VFUA 4CBPA 4I3GA 3BMWA 1Y0LB 3U9PH 3AC0A 5DFTA 3BPNC 1SY6L 3TH2T 4YFLI 2FX9L 4WI9A 5C0FB 1N6QH 1BVKB 5IB2B 4WW2C 4KQ4H 5B3NA 1T1ZA 1MCJA 1FG2A 1C5DB 2RCSH 1J0ZA 2H1PH 1QR1A 5I1HH 1TNMA 3VXOB 4X9FA 4LQ1A 2VL5A 4YC2B 4R4BB 5JHDA 1AGFA 1KPRB 3ARGB 3GI8L 1J5OL 1KN2L 1N4XH 2ICWB 2PO6A 4FNLH 2F9BT 5C09A 4GBXB 4QRRD 2L4OA 4EBQH 5IB5B 1VFOA 5EFIB 1MRDH 5KVFH 3ALXA 5C08D 2JK5B 5MEQB 4J3UA 4X6BB 3VXPA 1MLCA 4ZUVB 1OCWL 4JDZA 1KIUA 4QHLA 5C6TH 1RURH 4TRPL 5E2WL 4G6JH 5EU5A 5CCKL 4EI5D 5JORB 3E1F1 4Z78B 3RU8L 3CD4A 5INDB 1RZIB 4OZGE 3FFDA 4FXKB 4E42B 1KTRL 1JHKL 4ENED 3F12B 2JKXA 5E56A 3AREA 2FSEA 1J8HD 2V5SA 2X4OA 3MRNB 4G6KL 3BGFC 4W4OC 4NHUB 1T4KA 3RZWA 5I73C 1OTSC 3SY0B 1E4WH 3MV8A 4GXVL 4JM4L 1BECA 3CDGB 4NKMB 2E7HA 3B9KC 4C54A 4KDWA 3DURA 4D9LL 4N0UA 2O5XL 4JM2C 4GUPA 4LCCB 5J13B 4OLVH 3KNBA 4M7ZB 5DHXB 2EZ0D 5AUMA 5CBEA 1JGUL 2H8PA 1BQLL 2ATPA 3ZT6A 4HZLA 1RZJH 1AO7E 4OZ4A 1ZLVH 2BSSA 1TCMA 3FN9A 3O3BB 1JPFB 5KVEH 1RU9H 4TVPH 5IMOA 1CI5A 1KENH 3O8XD 1EO5A 4D2NA 1N7ML 4MDIA 1YEKH 3BE1L 2YHGA 1FFOA 3B6SA 2ZCKL 5EU4A 1HQ4B 2W0KA 4FG6D 2C26A 4JN2B 5F7DB 3TT3H 5JHDD 3QFJB 1FNGA 3DIFA 4FQCL 2EYRA 4MXQC 3ULUF 4JFHE 4RA0C 1G7IB 4YHIB 3UAJC 3LSOB 5E8NA 4F7MB 2IQAB 3O6FB 5I74B 5EOCJ 5DQ9A 5GGTA 2W07A 3MBXH 4D0DA 2OLDA 5ADOH 5JLZB 3BXNA 4U1JA 4LEOA 4MNHA 4ACPA 2ADIB 2BNQA 1GXEA 1BOGB 1CFQB 1XR8B 3MV9A 4P57B 3JSSA 2EDEA 3OKKB 2G9HB 5F9JA 3DV4B 1UWEL 5JHLH 1MQKH 5FYJE 1T03L 4PRIA 5TGBB 3UJIL 1KG0B 4JHAL 4OUUA 3R8QA 5IBLD 1KCSL 1BWWA 3AY4A 4NO2B 3RVVD 3MOQA 3QIWC 5EZJB 4CL7A 1FAIL 1HH9B 1FDLL 2XWBB 1IC4H 3TESA 3UROR 1UH2A 3BGMA 2VIRB 3ARED 3ZDXE 5MENA 1YEHH 4ZXBC 5TPWL 5GXBB 2HWZL 4QHMA 2I07B 1INQA 2YD8A 1VPOL 3QHTC 4MJIB 4RWYH 4Y2OA 5EO1A 1P6AB 2H6PB 4G6MH 5CD3B 3EYSL 3MV8D 5D1QC 4NZDA 3VXUE 5MEOB 2W0FB 3SDDC 1HINH 3QZWA 3LKQB 2Q76B 2UUDK 1ZMYA 5D7JC 1FH5H 3ESUF 3HAEH 2WUCH 1XF2B 5EN2A 2OQJB 3BN9D 3OGCB 4UDTA 3VI4E 2B8OT 1F13A 2BP3A 3AB0C 1S9VA 2E27L 1X6NA 3VMOA 3D48R 1RIHL 5FECA 4Y4HA 1GGUA 2AEPL 3RWGB 2W65B 3GSNL 3PJSB 1JPGA 3ZYJA 4KU1A 2PW1B 1J9CT 5D7SL 3G5VB 1FFPA 1W8OA 5T5NF 3IDMA 1M71B 4OF3A 4QXWA 4ZSOB 2KZWA 3D39B 4YBQC 3ZZ1A 1DANU 1E4KC 4JRYE 4OQ1A 5GZOC 3GRWH 3O9WC 3QJHA 4F7TA 3PGDB 5FGBC 2F8VA 3MNVB 4ZOBA 5ESAB 1CLOL 5CP3A 1I4FB 1I1AA 1Q1JH 1TVHB 3QULA 4BZYA 2CK2A 1C12A 1A7OH 1FYTB 2Q20A 3CFJB 1DQML 3GMLB 3DHMA 2PYEE 3MV9D 4TUKL 4GOSA 3ULUD 2D2OA 3H3KA 3TLRA 3UTSB 2D31B 1K8IA 3QDJB 1BJ1H 3HE6B 3LRGA 4ODWA 4S1QH 2YPVH 1HK6A 3BEWB 2VISA 2F5BL 3ARDA 1YECH 3NACL 2GITB 1XCQB 1U2HA 4EVNB 3L5IA 4UNTA 5GGQH 4BKLA 1WWCA 4DCQA 1UXSA 4HFWA 4RGNB 1U6AL 1M7DA 3CXHK 2RHEA 1JYWA 1SEQL 5CS7A 1MI5B 2MCG1 3RWDA 2PKDA 5EO0B 4OFYA 2ITCB 4RAVB 4KXZH 4HEPG 2X4QB 4M9PA 5IFHH 3HPJB 4U3HA 5DVLA 4K9EL 2EDKA 3V6FA 5D2LA 2VRAA 5DRWA 2D7PA 5F8RC 4NNXA 1IAOB 3QJFA 4Z7UB 4JZJB 3ABZA 1N8ZB 2Q86A 1BEYL 3RVUD 1EHLH 2WUBH 3I6KA 4X6DF 4NJAL 3MSPA 3D1MC 4GKNB 4LCWB 4Y4HD 2UUDH 3HR5A 4IS6B 5F96H 5T3ZE 3V0VB 1QHOA 4JFEB 3KPRB 5ELIA 1KB9J 1WVZA 4X7EC 4EIGB 2EIEA 1YDPA 4HGKC 3EYVA 5D1ZB 5GGRA 5FUZL 4PJ7E 5DEFB 4X6DA 1XCTA 2XKNB 5DSCB 1P7KB 3U30B 4ZD3L 1I1AD 4BK4A 4PJAE 2X44D 1RHHA 5D4QA 2AV1A 4PLOB 4G43B 3UTQA 1F5WA 1ZLWK 3ROLA 4PPTA 2NW3B 2VSCA 3Q3GA 4OCNC 5FYJL 4JJ5A 2OR8A 5BVJA 4CDHA 4EJ1C 4R9HA 2X70B 4POZC 4LPUA 3ARDD 5FCUH 4Z8FH 1MJ8L 1P4LA 4OIIH 3GSVB 4DTGL 2OR9H 4FS0A 3VWJA 4LVHC 3VXSB 2VZTA 3S4SB 1HYSD 4XNUH 3AROA 3V6OC 1CT8B 1QSVA 2P7TB 5HDBF 3BZEB 4NM4H 1I9JL 4MQ7A 1AXIB 2XKUA 4LAQL 1DQLL 2DTML 4XWOC 3SE8H 5HI4C 2ATKA 3WO3B 2X1QA 2WBKA 4I0PB 1DQQA 1CXFA 1G9ML 5DJ6B 5F1NA 3IJSA 4R8WL 1R0AL 1UENA 2APWA 2VLLA 1U95A 1XGUB 3ZE0E 3PXJA 1I1FB 2J8UF 4P2CG 1H5BC 4JO3H 3JTTA 4K71B 1BFSA 4L9LB 5C07A 1A3RH 1T21A 2EECA 3AM8C 1A21A 4ZDHB 3WDHA 3T2NH 3MRCB 4P2QE 5D7LE 3CPLB 1MPAL 3QH3B 1LE5A 1NLBL 1JL8A 3MJ7B 4APQB 5CILL 2GY7B 2A73A 1IGCH 2WBJA 3MRLB 3HI6L 2J8UA 4H20H 4NUGH 4LKXA 2H9GA 1T83C 4Q2ZB 4KVCH 4NT6A 1NGPH 4XVUD 1QSFD 4OZGB 4BFGA 4ODHH 1FVEB 2XTJD 2AJ3A 4RFOL 3M8OL 3SO5A 2EDWA 4NWUL 4G8EA 4F7PA 3X3GL 4QYOB 4XP4H 1HYRC 5IT2H 4PJHE 3H42H 4R3SA 4WO4B 3VFNB 1FZJA 1HXYA 5EOQL 5E8EB 4CMMA 3BMVA 4ZPTA 4GW1B 1IC7H 1KIQB 4TTDC 3QAZC 1QKZH 3LPFA 2RIKA 1NKRA 2R1WB 5K33A 3L7EB 1YNKL 4E0RA 5DZLA 2FYYB 1MY5A 5DF0A 1PW3A 5IB1A 3VI3F 4GSDL 1HIMH 1ZLWH 3U7YL 3N9GL 5T3XD 1E6OH 4TSCL 2C9AA 4K3DH 1QO3B 4OZHA 2DQTL 2DOCA 1J86A 4E41B 5FDWB 1QSEB 5CJ5A 1YYMH 2FB4L 4K2UL 4LSRH 4KK5D 2XQBH 3ROOB 2D9QB 4LARH 4WGWB 2I9TA 4XWGH 1AXTH 1U93B 2VDRL 2BNRA 1ZLSH 3QUYA 4QCIA 3WJLC 4R0LC 4JN1H 1UYWL 3UJTL 5JW5B 4Y19A 2WP3T 4F57H 2YC1B 4HIJB 3BWAB 4OCYL 4ODTH 1XGPB 2XQYK 3S98A 5C07D 4I77L 5B38A 1C5CL 4DW2H 5GGSB 2A9NH 1ZT4A 2X4PA 2WBJD 5E00B 1YEEL 4LSQL 3RWFA 5IK3B 1K8DA 1T1XB 1NGXA 3G5ZB 2E7MA 3ARFC 4FFVD 5T3ZL 4X4ZA 1NBQA 4OTXL 5BRZE 1DBBL 1U8JA 1BM3L 4FFZH 5DR5L 2EXWC 5ISZE 4XP9H 1O0VA 1S78C 1A4KA 5GGTH 3HCVA 1RHFA 2ENYA 3X14A 2N4IA 4TOYL 5GS3A 1QR1B 1HDMB 1A8JH 1I3VA 2VL5B 1XEDA 3EYQD 1T89A 5FKAB 1AGFB 1KCRH 1FGNH 5J7CC 3ULUH 2OTWA 2MPAL 2PO6B 2X42A 3U1SL 2D03H 4G8IB 5C09B 5DMJB 2FNBA 2VLJE 2XICA 4OJFH 4WFFE 4HMEA 2B4CH 1FNEA 3FMGL 2VR4A 4YDKH 1DEDA 4HS8L 3K80A 4U1HA 4M1CD 3VXPB 4PD4J 2VN4A 3UBXI 3BQUB 4WV1C 1LO2H 3SE9H 5J6GB 4I18C 4QHLB 2VWEC 5EU5B 4XNQA 1MHPL 3KPPB 3IRPX 2VZ1A 1WBZA 1A7PH 3G6DL 3IYLW 1I85A 3O3EA 4JRYB 1FE8H 3WFHA 2BNRD 1T22B 3QUYD 4HT1H 2WWKT 4Y19D 4LNRB 1AXSB 3FONA 4LU5H 4FXLA 4ORGA 5KSAD 2VDPH 5FF6A 4K7PY 1U91B 1HWHB 4D0CA 1ETZA 4NO3A 1T4KB 5FM4A 1F2QA 1GSMA 3ILQD 4LVOC 4R7DA 3J7HA 1XGYL 3IETA 4R26L 2F54A 3W5NA 1LK3H 3VFMA 3OKMA 3KNBB 2EDQA 5AUMB 5CBEB 5J3HD 2W9EL 4P4KB 3GBLA 5C0BA 2ATPB 4HZLB 3RWIB 1V3JA 3FQXB 3WIFA 2K9UA 1YPZF 1DUZA 1NFDE 3OG4B 1H3WM 1IKNC 3BO8B 1H0DA 1X4XA 4ZO8A 5C0NC 5CP3H 2IC2A 3O6KH 4PJIE 3JTSA 5EU4B 4WTXA 2IALA 4YPJA 3TBYB 4ZTOL 2DMCA 4IJ3C 4S2SA 4XXCA 2A0LD 5A43C 2V2WA 3QNXA 1YPZA 4HJ0D 4FQIL 1FNGB 4HKJB 4NZJA 4M8QB 5B22A 3MLXH 1A6WH 3MXWH 4D9RD 4PB9H 3LS5L 4D0DB 3F58L 4LEOB 2FO1A 3WXVL 1RVFH 2BNQB 5ID0A 4MHHI 3MV9B 3OAUH 3DVGB 4Y89A 5I1AB 5DI8B 4AEIH 1PG7H 3B3IA 3TH3T 1RULH 2VXTL 2A1WH 5F9JB 5ITBH 1JWUB 1XF3B 4PRIB 3OZ9L 5M95B 4NWTL 3V9FA 4HLZG 1C08A 4LNVA 3ZLQC 4XBEL 1GGIL 5D7IF 3GSUA 4QNPF 4J8RA 4OCWH 4P48A 3TO4B 5C0RL 2Z8SA 4UU9B 3E3QE 5MENB 4ZOAA 5FXCH 1ORQA 3L9RB 4JO1L 1EK3A 2E6JA 2MFNA 3Q1SL 1G7HB 2YOCA 4AMKH 3NIGE 1VB9A 1D6VH 1U3YA 3CIQA 2IFFL 2HKFL 5SWSB 2F54D 5KTEL 2QQLL 1A22B 1CL7H 3MO1A 3QZWB 4MXVE 3ARYA 4K3EL 4KTEH 1XF5A 2V5RA 4LLYA 3N1QC 1RAMA 4QHKI 2FATL 4JM2A 4NZRL 1LILA 5C0BD 4UDTB 4G8GB 4JGUA 5H94A 1NCCH 3PHOA 2P49B 4G8FB 5JQHC 1T2XA 1WEJH 4U1NB 3KXFD 3SEPA 4K3JL 3GHBL 4LLDA 2E8ZA 4KKBD 3PGFL 1FFPB 2LVEA 4U7SA 1GYAA 3IDMB 4RFEB 4QRPE 4PJ5E 2MHAB 4JY6B 1JZ2A 3QJHB 4YZFE 3CJJA 5I8OH 4PJEF 4R7NA 3BUYA 4KMLB 3I9GH 4HK3N 4AY0A 5KANG 3UXFA 3QULB 3MCG1 5TFSH 4DOHB 4PJ8C 5DWUH 5FYKD 1JUFB 4UB0L 5T3XH 3CFDB 2VLMD 4J3TA 4ELMF 4PJEA 1A6TA 1A7RH 3EDKA 4LOUD 2A38A 3L5JA 1HXMA 3C6SA 3ARDB 5ILTH 3D0VA 3OF6A 4PRBA 4C59B 3X3FH 4H0GA 3RKPA 4S1RL 3QIWA 4NQEA 4JFXB 2JE8A 3ALPA 5GJSH 5I8CA 4BKLB 3BZFA 1OD9A 4X80H 3PV7A 4XC3L 5B8CC 4DCQB 4KJPD 3VE0A 4UINL 4HFWB 4LLMB 1A2YB 3O41A 1LGVA 2EE3A 4X7DC 1J0JA 1F97A 3VRLF 1RJCA 4NM8H 3BH9B 4L8DB 4CN1A 4YIQA 4O58H 3IXAB 4MAUH 4XP5L 3QPXH 5E6IA 2FJFA 3BH8A 5ICZB 1SBSH 5FA3B 2A83B 4YDLC 2IH1A 1MAMH 1UJ3C 5GRXG 1ONQA 4NNXB 1ROWA 4QRTA 2WLYA 3LQAH 4G9FE 4QLRA 32C2B 1MCFA 3L5XH 1I7ZA 1FBIH 1OAKH 3I6KB 1N59A 3K46A 4XAWL 5SWZE 4GKSB 3SKJH 5AYUH 3MLYL 1MF2L 4XPAH 1QLFB 4XCYA 3X13B 3TVMA 2CDFA 3EYVB 5JIIA 2XTJB 4OUOA 4M48H 5TQ0H 1CD8A 5C0EB 1NGQL 1XCTB 3OL2A 3FTGB 4JPKH 3HRZA 3IU3A 4GXUM 1AI1H 5DEGB 1JYXA 1EAPA 5CZVH 3G5XA 1JWSA 3V4UL 4HAFA 2AV1B 1ZA6B 3BP7A 1R5VA 1J10A 3NFSL 3ROLB 2GSIA 2R56L 3GB7B 4GG6E 1PGRB 2N56A 4WFGE 4JJ5B 5BVJB 2WWMD 1G9NC 3MA9H 3D0LA 3ZYOA 3MBEB 2KUTA 4YXLH 2DQCL 3C5JA 1UH4A 3OF6D 1P4LB 5DC9B 1T7WA 5IV2A 3QIUC 4NQED 3VWJB 1GPOL 2NW2A 4I9WD 5ID1B 2GY5A 1AHWB 2HN7A 3QIBD 4D8PA 3NA9L 4NCC1 4L8SC 1PX4A 2ATKB 3W2DL 5HHXL 1DQQB 2MCPL 3BPLB 5F1NB 3KHQA 4PRNB 3IJSB 4GMSL 3CFIC 2AABH 1U95B 4TVSa 5E6ID 4XVTL 4OM0L 2YEZA 5H35A 4XXDB 3WUWB 2VLJB 3JTTB 1G6RL 3TFKD 2R29L 1T21B 2VN7A 2I25N 1NCBL 3GNML 3V5KB 4CJ1A 5IW6A 1ZV5A 1LE5B 1OAYL 5C9JA 1ZGLM 2EE9A 4U1KB 5EUOE 1CE6B 2E9BA 1AD9A 2A73B 2WBJB 1NC4A 2F58L 4NBZB 1F4XL 1Q9OB 4HF5L 3MREA 4Z7VF 4LKXB 3FO0H 2E7CA 2PXYC 4RMUA 5D9SB 3FFCE 4XI5C 2V7HA 4JO4L 4M7JH 4NUJB 1JGVL 3K2UL 4QTHA 3TVMD 3EOAB 3H9YA 4P59H 3IF1A 5ITFA 1FLRL 5C3LD 4F7PB 3QDHA 3HZKB 4Z0BL 3B43A 1TVBA 4TNVF 1RIUL 4L4VE 5DGRA 3KPNA 1HXYB 4HWEL 4CMMB 3PABA 1CICC 4KGJA 2DBJA 2MQ0A 2JJVA 5F9AC 4K7FA 5KSUA 2YSSB 5L6YL 4NYLB 4NZUH 5DZNA 3G6JE 4LSTH 5F9OL 3QHZH 3F7PC 3VXRE 4PJXE 3DHJA 1Q8MA 2V2XB 3NMEA 2GHWB 3VFGH 1YEIL 4ONOA 3H3BC 4OZHB 2DQUL 2AJZA 3RJQB 2X4SB 4QKXB 3PE9A 3C09C 5GGUA 2GJ6B 1F8TH 2QADD 4OD1H 4P2RE 5HHNA 1NCDL 3GSRA 4LSPH 5CJ8A 1JZ4A 3RZCB 1UT9A 3I6LD 2DQIH 2BY1A 5L2JB 3EFFB 4KRPD 3KR3L 1FNLA 4LFHG 5IEKA 3WDJA 4LCYB 4LEXH 2BOCA 4F9LC 1C7TA 1ZT4B 3GBNH 2BOBB 3PL6C 3QI9B 2AJVH 3LKOA 1NC4D 3G5YA 3GSWA 1K8DB 4YHLL 4ZG1A 1RJLA 2AEQL 3MACL 1NGXB 4IOSD 2OS7A 2YD3A 4KKAD 4XGZA 1DDHA 1U8JB 1T83A 3RWJB 4ZNCD 2DQDL 4JQIH 1JMXA 5DUPH 4DKEH 5KAQG 3AGVA 5IHUL 1BJ1J 1KLGA 1S7VA 3HCVB 4WEMB 3SKOB 3X14B 1NC2A 3TBTA 2XZQH 5FYKH 3LS4H 4YGVA 5DLMH 4OLZH 4GRLC 1TQCB 3WD5H 3QFDA 4EDWL 3EZJB 3I2CL 5DDHB 2A6KB 2A6JA 3KWWA 1QFUH 4D9QE 5I16B 4AM0B 2IPUG 4KI5C 1BFOA 4M6NL 2ERJC 2CRZA 1X5LA 1GZQA 1SJHA 4G80A 1FNEB 5J11C 2FGZA 4QXUH 4U1HB 4L3EA 4Y2DA 3GDBA 1AFVH 4KHTH 4LSUL 4S0TD 4CVZB 1IT9L 3QG6A 1JTPA 2NY2C 4QRPB 4E9LA 4PJ5B 4HC1L 2C3XA 3K8LA 5A3IC 3KYNB 4O9HH 5EBMA 3LV3B 3TYFA 3P4NA 3FONB 5ESQA 4JY5L 3C60B 2R2HA 4H5SB 3F7YB 4D0CB 1ETZB 4M7LT 4H1LG 4LPYA 2J2ZA 4DGYL 1AO7A 4PLKD 5IMMB 4N5UA 4OLYL 5INCA 5JW4N 3IETB 4OFPA 1Z3GH 2F54B 4YHKL 5DRXB 2P8PB 3WN5B 3UZEA 2NZ9D 1CTOA 1MUJB 2ENSA 3OKOA 4WUKH 1VA9A 1Q38A 1FO0A 1WFUA 4ZOCA 3PXHA 4ODXA 3N85L 3GJFA 4IRSC 2XOTA 5DD3H 4X6CB 3FT4A 3FB5B 4EN3C 3MV7A 2R23A 5ANMB 4WW2B 4H8WC 3JTSB 3IT8D 4PJGE 3DXAB 4XNMB 2XG5A 1BQHG 4JB9L 4LASL 1FNFA 3V6OE 3IAQA 1U8PB 3B2UC 4P5MA 4Y4FA 3SBWC 2AJSL 1KN4H 5A2IH 4KUCD 1DJSA 2O61A 2KL6A 4JFFE 2LU3A 4HGMA 3ZDXF 4KK8C 3RDTC 3NFPA 4NOBA 5F7KC 2L7JA 2DQGL 5FOJA 1OP5K 2ZCHH 1YN7A 2XZCL 1MFEL 4IRJA 3CXHJ 4L3ED 4Y2DD 3CK0H 4FP8H 4HK0B 3BP4B 3SGJC 3OKNB 2V2TB 2PN5A 1KCUH 3MLSH 4ZUSA 4YQXH 3T0EC 2B5IC 1M05A 3GSUB 3VI4F 1BAFH 1CLZL 2P24A 3CVHA 4XX1G 2VTFA 4XTRC 1DBAL 3TO2A 3VXUA 1LE9B 4WHTA 4U1IA 2EE6A 1YEDA 4Q9CA 1WTLA 3BHBB 5F7LB 1ORQB 1T1WB 2HT4D 1OWRM 1SY6H 4OIAA 5IP4A 1T6VN 4GAGH 3KPOA 1AO7D 1VGEL 2FRGP 2WMPA 3L3KA 2CIIA 4FQ2L 5I73B 1JIBA 2RBLA 3TIDA 3IVKA 3LMJH 3B9KB 3OR6B 4LHUG 4LLYB 3WNLA 2Z8VC 5IWLC 1FIGL 4JM2B 4EUPG 3IJYB 2AAVA 5F9DC 1CXEA 4U05A 5I30H 1JGEB 3PHOB 3GI8H 1J5OH 1KN2H 4ZNEE 4Z77A 4NBXB 2P8MA 4JFHD 1FNHA 4F9PC 2ADJA 4OCLC 1V7ML 4X6FA 2OR7A 4TNVK 4ERSL 2QQNH 4JDVB 1QBMH 1N5YH 4C83A 3PV6A 4HQQL 1P7QA 2LU7A 4Y4FD 3SDXE 5HI5C 5DRNB 5I18L 2PYEA 1EXUB 4RMTA 3U0PA 4PJDA 1OCWH 3EDEA 2F19L 3ARVA 3ECBA 1GOFA 3V4VL 3MCLL 5GQBA 5FB8B 4TRPH 3DRTA 5CCKH 1FZOA 4DVBB 1P4BL 1Z5LB 1IRAY 3RU8H 1WGOA 3MLZL 4IRJD 1JHKH 4F7CB 1OAZL 1REIA 4LDEB 4QHUA 4XRCA 5F3HA 5F6IC 3BEVA 5CSGA 3BSZH 1BGXL 1QRKA 2B1HL 4GG8A 4G6KH 3U82B 3ULSA 1OP5H 1KULA 2C4FT 2YD2A 4KK6D 4RMWA 2E6PA 3D0VB 5KG9A 4PRBB 4JM4H 1WBYB 3SCMD 4XCEB 3KPLB 3QIWB 4N8CL 2QJDA 3VXUD 2O5XH 2I26N 4JPIB 4L3CB 4NKDB 2WQ8A 3O41B 1JGUH 2FZ3A 4NQCA 4X7TA 1BQLH 5ICXB 2BVEA 4ZXBB 2XT1B 5KS9E 4GS7B 2D7MA 2I27N 4PJ7F 1CD1A 3BDYH 3UPAA 2FJFB 5D1QB 5C0JB 2VDKL 4P23C 1N7MH 5HI3D 3BE1H 1BQSA 4QRSB 5FYJU 2NY1D 3FN3A 5I1IL 4QRTB 3MCKB 4O2FB 2DD8L 4PJAF 5GIRB 4RFNC 5D5MB 5D7JB 3L3JB 15C8L 5IROC 4FQCH 1CU4H 4PGBA 5F1SA 1N59B 4GAFB 4XPHL 4OLEA 4JFOA 1LP9A 3AB0B 2CMRH 5F7YC 4LIQE 3MODH 4UT9H 4DKDC 1S7XA 4XCYB 1MFNA 4M3JA 1YNTB 5GZNC 2C3WA 3QCUL 1P7QD 4JQXC 1RUPL 5A16A 2PYED 1UWEH 1HILA 4IIQA 3W11D 3HRZB 3KPMA 4WHCA 3IU3B 3GSOB 1TJGL 2OYPA 4JHAH 1KCSH 1S9XA 3G5XB 5K9JL 5EIQA 1FDLH 4PJ8A 3BP7B 3VWKC 1B4RA 3F7VB 5J9PA 4XNZC 3LN5A 5F1IB 3MJ8B 5TE6L 4R90L 3MROB 3ZE0F 4X0KB 5TPWH 1NMBH 2HWZH 4UUJA 3GMOA 1VPOH 3QWOB 5K9OB 2PW2A 2HJLB 4KKLC 2UY6A 3LCYA 3EDFA 3EYSH 4NRYA 3K74B 3TCXA 3UTZB 1PJ9A 1WWAX 2OJEA 2J6EA 1A6AA 2NW2B 2AJXL 3G6AA 3NZ8A 3DARA 3PWPB 3BKCL 4D8PB 5CKGA 4OGYL 4EXPX 1MOEA 3U4EA 1E4JA 1CZ8L 2X1XR 4MQXD 3M17A 1F4YH 2BSRA 3W39B 1RIHH 1HEZA 4LMQE 2R15A 3VW3H 3GSNH 4W6WB 4I5BA 4PRHE 5H35B 1IGJB 4KRPB 4KJWD 4PJHF 2EH8L 3GJEA 3OXRA 4B41A 1UJ3A 1A6UH 1ZHLA 5JW4Q 3VDCA 3A0OA 1LQSR 5IW6B 5H37G 4PJBA 1AD9B 3BKJL 1BBDL 5HGAA 1NDGA 1V8HA 2E3VA 1C7SA 2JCCE 3MREB 1RI8A 2J12B 1C8PA 4JPWL 5E1AB 2CKBA 3QISA 1CGVA 1OPGL 3C5SA 4P49A 4BSVA 1UCBL 2DWDB 4PRPE 5BZWA 1DQMH 4P2OC 5JXEA 1MQ8A 1KTLB 4NCC2 5ITFB 4MD4B 1FN4A 1B0GA 3MR9B 4M6OH 2UVFA 1IZJA 5HYQB 3TPUB 3JV4B 2IH3A 2FH8A 3DETC 1WIPA 4EEEA 2P42B 4I8DA 4AL8H 5KOMC 2VZSA 4ZPVA 3PABB 2F5BH 1XT5A 5DD0L 3S35L 1WK0A 1D6EA 4YAQA 1P2CA 2C1OA 4D94A 4HBCL 1F3JB 1U6AH 3BP6B 3BD4A 1CFTA 3S37H 1SEQH 4O51A 5HYJA 3BN3B 5D1XC 4CMHC 5EZOL 3RAJL 2ZUVA 3ARBC 1C1EL 1RD6A 2APFA 2AJZB 4K9EH 2F74B 4JVWA 4B5EA 4LVHB 2YPLE 4JG0H 5GGUB 1X4ZA 4KQ3L 1I8KB 4J1UA 2ICWI 3OSKA 3OKLA 1BEYH 2YPKB 3MFFA 2APTA 4P2QD 5HHNB 1D5ZA 2XWJA 4CAGA 1I7TB 4KAQL 3HMWH 4X7CC 5BS0E 5IFAL 5GRZA 2GCYA 3RWHA 5IEKB 1KSRA 5FGCE 4JAMB 1HZHL 5FGRA 5IHZA 2BOCB 2NY3D 43C9A 4RA3A 5E9DA 3CFCH 5ISZA 1U58A 1W72B 2C4FU 2CJUL 1RJLB 4IMKC 4A6YL 4LIQL 5MERA 1NGYA 1IQWL 3HE7A 2Z0BA 5JXED 2JB6A 2M2DA 1KXVC 4YBHA 4N9OB 3FB8B 2EDOA 5DK2A 4K94L 1OSPL 1ZANL 1QNZL 3L95A 3P77A 1KLGB 4C57C 3PWNA 3WMSA 3P40A 1NC2B 3TBTB 4Z76B 1G7PB 1ZHKA 4RIRA 3LPGA 4YPGA 4Z7OE 3QFDB 3BOVA 2NY4D 3KWWB 3IDYC 4LPTA 1FFQA 4PJ9A 5HGHA 4MJ6B 1I9JH 1BFOB 4LAQH 1DQLH 2DTMH 4JFZH 1GZQB 1SJHB 1MJ7L 3O6ML 5I1CL 1R0AH 3PWVB 3T8XA 3CVHH 3UDWC 2DLHA 4NQUA 4NPYA 1BOYA 4L3EB 4M7LH 5K59E 4PIRF 3QG6B 4KJQC 3T1WA 1RUML 2Y1VA 4X4YA 1XIWA 3P4OB 3QUZA 1XF4B 5EBMB 1QEWA 3HI6H 3NFNA 1NFDF 3MRBB 4FABL 1GOHA 4BQ9A 1AY1L 4KUZL 4R0LB 1MCWM 3QQ9D 3A6CH 1KXTB 4LLVB 1RZFH 3DTXA 3HUJE 1AKJB 4PJIF 2GUOA 1ZVSA 3ARXA 4HS3A 4U1GC 5BRZD 4RFOH 2AXJA 3M8OH 3MOBL 5INCB 3S96A 4YHPA 2CRIA 4NWUH 2EXYC 1YC7A 4FTVB 4F9LA 5ISZD 1I9IL 3PL6A 4OFDA 3LIZL 5T1DL 3TJHC 3MLTA 1MRFL 5CGYC 1QLEL 3MUY1 3REWB 4PJIA 3MYJA 3QXAA 5L0QC 1BIIA 1FO0B 3HE7D 4ODXB 3ARFB 3GJFB 3DO3A 5D8JL 1YQVL 2QHRL 3NGBC 4M02A 1A6ZA 4BFIA 1EVUA 2HFTA 2XNAA 4PGEA 1N2RB 3REVA 3MV7B 2R23B 3K81A 4P5TA 3BZ4B 1BJ8A 2GKIA 4KJYA 1QPXA 4WUUE 2HRPL 4LPVA 4WFFD 3U7YH 4HJJL 4TSCH 1RZGB 1FORL 4X99A 5HVGB 4P5MB 2R8SL 1RZKH 2XACC 4ZAKD 2FB4H 4AT6A 4HPOL 4K2UH 3HG1E 4JPVL 4PJ9D 1JZ6A 1TETL 1MEXH 1EGJL 2KH2B 3TWCL 1MAJA 4KMTL 2VDRH 4LLUA 1YN7B 3DGCR 4IRJB 5DRZB 3O4LA 4V1DE 1UYWH 3UJTH 3NIGF 2VXSH 4RDQG 4EQ2A 2IANA 3AXLA 4X8JA 4ZQKB 4OCYH 3IDJB 4MXVF 4WV1B 2CR6A 4NFDA 1EFQA 4ZUSB 4I77H 2W9DL 3NZHL 1C5CH 4I18B 1XIWD 1OARH 3R4DA 4WEBL 3QO1B 5CJXA 5D6DA 3GIVB 5F70A 1YY9C 1YEEH 3TO2B 1HCFX 4XCCH 4B7IA 4WHTB 4ZYKB 4L8CA 3VRIA 2F53B 4O5LH 1G6RA 1I7UB 8FABB 2XXMB 4PTUB 2D4FA 4OTXH 1DBBH 2KZ1B 4I4WB 5EU6B 4AK1A 5DR5H 6FABL 1MRCL 2ESVE 3L3KB 2CIIB 3IAPA 1YUHA 3QUMA 5LCVL 3UX9B 4YZFF 3QXTA 3RA7L 3TV3L 3TIDB 5CWSA 4JQVC 3SN6N 5T33H 1PQZA 2YD5A 3FOLB 4D0BB 3TNMA 1CN4A 5I8EA 4YR6A 3DOSA 4WEUD 5H2BA 2MWCA 2PYFA 4MDJB 4Z77B 5T1LA 3U1SH 1FZMA 4N8VB 4AYFA 4LRIA 4Q7DA 1NCAL 2F5AH 1P6FA 1G7QA 2WIIB 4OGZA 4IJ3B 2ILLA 5HGBA 1R3IL 4X4ME 4PRHB 1MCCA 5ESVB 3DJ9A 5EU7E 5F7EL 1Q9WB 3ECBB 2O5ZL 3LQMA 3WE6A 1MHPH 1FZOB 5EBGA 3G6DH 4R4ND 1I8MA 3ORJA 5DJDA 4Z7WB 3RL1A 5HBBA 4OB5L 3E2HC 1UADC 3BAEH 2JCCB 5BJTB 5DJCB 3QEQE 4UIMA 4XRCB 5F3HB 3BEVB 3P3YA 4GG8B 3ULSB 3MNZA 1U8MB 1X5ZA 5KG9B 1XGRA 1YNLL 4RQQB 1NEUA 1ZA3A 3JV6A 2R0ZH 4WI4A 4RCAA 4R26H 2HT2D 2CH8A 2DDQH 1LDSA 3NIFE 1LO0H 2G75B 3T0AA 4F7EA 4CKVX 2FZ3B 4NQCB 4X7TB 5EZLA 2W9EH 5LXGL 3AS0A 4HXBL 4JRXE 1MHCB 3QQ4B 3I85A 4G9FA 2IG2L 4U2ZA 1IBGH 3QQ3A 4JR9L 4X4XA 1CD1B 1EHXA 4OGAD 3HZYA 5SWZA 5D7KD 1WBXA 3WJJC 5JOFA 1NAMB 3MGTA 4ZTOH 1ZGLB 4WWID 3CDCA 4OI9A 3EO1B 4KI5E 1DP0A 1Z0MA 5IR1B 5I1DB 4HUWB 3CNKA 4QWWD 4KRNA 1G9NL 5ETUA 2H3NB 5T1LD 4PJCA 4X98B 1LP9B 5CD5D 3HAEG 5F88A 4GG6F 3LS5H 4OLXL 4HFUL 4JO2L 1NJ9B 4ODUA 3WXVH 5GRVK 3K7UA 3JXAA 1K85A 3EYFA 4WWKA 1HILB 5JPNB 5DD1L 4P46D 4XPTL 3SQOL 3OZ9H 4KXZI 4GG6A 2V5YA 1OWWA 4NWTH 3JUZA 1MCKA 1M7XA 1NEZG 5E2TL 2ZOKA 1G7LA 4XBEH 2AP2A 1LEIA 1GGIH 4PJ8B 2XA3A 5IHBA 5J9PB 1U8QA 5E6YA 3VFWA 1FCGA 1KIRA 2A6IA 5C0RH 1GAFL 2MQ3A 3TCLA 2H2SD 4JO1H 1JTOA 3GMOB 1AD0B 4NZTL 4ZFOL 5IJKC 2FJGB 4PP2A 3DVNB 3I02A 4LF3B 5TF1L 1KCVL 2IFFH 2HKFH 5KTEH 5EUOF 2FBOJ 2I60L 4NC1C 3B4NA 1JCKA 4FQXC 4N0CC 2X1WL 3AFLA 2FATH 4U1MB 1MWAL 2FJHA 1FC1A 4G9FD 4HWUA 1RIVL 3N06B 4M7KL 1BFVL 5D2NC 3C08L 4I5BB 3HLAB 4K3JH 5SWZD 3S3PA 4OIBA 1N26A 4CADB 5DURD 3OXRB 1KC5L 1UJ3B 1ZHLB 2MSPA 3FFCA 3U2SB 3U79A 2YD1A 4PJBB 1OP9A 5KAQF 3O2VL 1EVTC 1INDL 4OZIE 2ZUTA 3G6JF 4ODSH 4LGSB 1ZVHA 2CKBB 8CGTA 4HIEA 2VXUL 3C5SB 4WI8A 4L4VA 4PJXF 7FABL 1FC2D 5EZIH 1B90A 5BZWB 3UPCA 3NCBB 3VFOA 4PR5B 1QFWM 2XFXB 4MZ3A 3T4YA 1UM4L 1NBYB 4WWKD 4LLWA 3TZVC 5JDSB 1OAQL 1JPTH 1OTSD 3R1GL 4N8PA 3LDBB 4WFGD 1K2DB 2Z93A 3O6FC 1DE4A 2BZDA 3VXRA 1LO5A 4ZPVB 2AEWA 1LDPH 2NXYC 4QHNB 1NUFA 4XHJC 5MP6H 2Q6WA 3QNZA 1D6EB 4HX1A 1FL3B 1TITA 3QO0B 4YAQB 4XC3H 2C1OB 3LEYL 5J1TC 4XHQA 3LKSA 1XGQB 3C5ZA 4M03A 4UTAH 2VDMH 4O51B 5HYJB 3CZFA 3ETBF 3RWEA 2QQKH 3RNQB 4P2RA 3VMNA 2Y7QB 3F6IA 3QB7C 4MGXA 3SE3C 2VXQL 5DVNA 3UPRA 4LSDA 2HKHL 3QIUB 4XH2A 3T3ME 1U3ZA 2I9LA 1MCRA 2HLAB 2P44B 3TN0A 3OKLB 4L8SB 1KPUA 3KS0H 4S1SL 4MJ5A 5C0GB 4XAWH 3EJYD 1MCQA 3RUGA 2MKLC 3MLYH 5A2KH 4JGMA 5F7MC 2OX5A 3EFDH 4LFHD 3MRHA 3BPCA 4H1LA 4WW1B 1KPVB 3WLBA 1HHKA 5J89A 2YK1H 4U7KA 3FFCD 4H26B 1GZPA 1IAKA 4YGAB 3EJZC 4P2YA 4HSQA 3UYOD 43C9B 3MRKA 4JVPA 5E9DB 1LEGA 5SX4H 1VFAB 2A2QT 4RAUB 3LQZA 3L7FA 4UDUA 1CGTA 5FHBL 4L4VD 4ZFGH 2AJYH 4FQJH 2PXYB 1JNHB 1UG9A 2CXGA 5LGJA 2FR4B 5ACMA 5IQ7H 2EDDA 2EDBA 3UBXB 1PKQA 1MWAB 4Y1AA 1Z9LA 2DKUA 3L95B 4EDXB 3PWLA 3ARQA 4QRUA 3X11A 5DT1L 1BQHA 2G2RA 3AU1A 2XWTA 3VXRD 1ZHKB 4RIRB 3SDDD 4Y5YA 2KDGA 5IBUG 4M9OA 3H0TB 4YPGB 3STLA 1NBZA 1CICB 1D9KA 3OXSB 4M93B 4PGCB 2DQJH 1RK0B 3N1FC 4UV4L 3T0XA 1BD2A 4UT7L 3NA9H 5GS0C 1ORSB 3O2DA 3NPSC 5ACZA 3C5ZD 1YEFL 4HIHA 3WV0A 5HHXH 2MCPH 1WITA 4GMSH 3T8XB 1MHEA 4P2RD 1IZKA 5D1XA 1MY7A 4GW4B 3U4AA 1UEYA 4Q6IA 4YE4L 1G6RH 5DD5L 5FKPA 3O9WD 4IEFB 4JZOB 5HHVL 4NN6C 3LN4B 4X4YB 3TN0D 3QUZB 4YHYC 4CGTA 1OAYH 1WC7A 2UZIH 3T08A 3QUMH 3JWOH 4E5XB 4BH7B 1KJ2L 1SMOA 3QXDA 1OAUL 1QEWB 5I15H 4PS4L 1F4XH 1HSBA 1EPFA 3STBA 3CVIL 4YFDB 5C0DB 3PQYE 4Y16A 1AIFA 2I5YH 1JF1B 1ZE3C 1AQDA 4JO4H 4PJGF 1SYVA 5JR1H 2D7OA 3CFEA 2HJFB 3O0RL 4ZTPH 3A6BL 5I1KL 4YFLF 3S96B 2ZSWA 2Z9TA 5DD6A 4LHUA 3PL6B 4Z0BH 2JELL 5FOBB 1WT5C 3GSXA 1RIUH 4EUPA 5D71L 4BK5A 2VITA 2EDNA 1FRGL 4HWEH 1P9MA 3QXAB 4MB5A 1BIIB 4PJGA 5ADPL 5I2IA 3RBGA 1T20A 3CLFL 4Y5VA 4BFIB 5L6YH 5ALCL 1IGMH 3RY6A 4PGEB 4L1HA 2YMXL 3LB6D 5DFVC 4CNIA 1KIPA 4P5TB 4Y1AD 1BF8A 2JJSA 2Z31A 4D9QD 4JFFA 4PV9B 1VESA 4BUHA 5E8PA 3HNVL 1HH6A 1YEIH 4N1CA 4X99B 1I3RA 3SGDI 1CR9L 2DQUH 1D9KD 5IGXL 1SMAA 1UQSB 2IBZX 3D5OF 1BD2D 1T0MA 4YHNA 1FNAA 4JGJA 5IG7B 3H9ZA 1TENA 2ERJB 1IILE 2HVJA 1NCDH 1UVQA 1DLFH 3O4LB 3S6CA 1T0PB 3LRSA 2NYYC 3UDWA 4TUOB 2IANB 5JW3L 4XVJH 2K1MA 5DO2D 2FGWL 5F7NC 4WI3A 2NY2B 1CFVH 3IFPB 2YKLL 5E0QA 3FHAA 2ZUXA 4WHDA 3AAZB 5KSVA 4YHLH 4Y16D 4U3CA 4XP6L 3MACH 3BRDA 1A3QA 4JHZA 2C7UA 3DYOA 1KJVB 4ORZC 1NGZA 4ELKB 1JHLH 3TBVB 4BJLA 2J4WL 3W5MA 3W0WA 3NIDE 5FO9A 2HFGL 5HSFA 1YUHB 5GRJL 3SDXF 4TSAH 5IHUH 4LHUD 3GKZA 5EA0L 1MFDL 2E5EA 4GKZB 4POZD 3R06A 4UAOC 1PQZB 2VE6A 4W68A 1G84A 2X05A 3MXVH 3TNMB 1AH1A 4GRWB 1VACA 3MRIB 3SDXA 2Y4SA 3OKEA 4IRSB 4MA1B 2ADGB 3FOMA 1FJ1A 2NTFA 4H0IA 2CQVA 3V0AC 2Z31D 2IPUK 3K4AA 4M6NH 4JFFD 4A2MA 4EN3B 4TN9A 3MRFB 5E94A 4QY8A 4NDMA 2ARJA 1OW0A 3P30H 4LSSL 4OFIA 3ZT7A 3WFEL 5DXWA 5HGBB 4IMLA 4XBPB 4LSUH 4OKVB 1IT9H 3JUYA 5T5NG 3ZKSD 3DX8B 1QG3A 3RBSA 1OOAA 3WE6B 5JPMB 3QDGE 1I8MB 5ACLA 2AK4A 3T0BA 1CL7I 3RL1B 5KS9F 4J3VA 5IW1A 3S36L 3KYOA 3KPSA 3J8F7 4R2GD 3QA3A 2MQCA 2NY7L 3QT2A 5DUBB 2Z35A 3GBML 3B8SA 3MNZB 1JHTA 5TE4L 1VKXA 1S5HA 4LCIL 3WS6A 4EI5C 5I1EH 5IB3A 3T0EB 5DJ2A 1ZA3B 2B5IB 1OB1A 1IJ9A 3HI5L 3QCTL 4YHKH 2PCPB 4MS8D 4FQPA 5MI0C 4ENEC 2OZ4L 3IFOA 1PZ5A 3RVTD 3N85H 3VFUB 3W0WD 3EBAA 5B4MD 1A1NA 2LFGA 3HPLA 5AWNH 3QQ3B 3SGKC 3LKRA 4ETYA 2Q7NA 3Q6GH 4GXUN 4TQEH 3HZYB 2ICEB 1WBXB 5JOFB 4DUWA 1RFDL 4A6YA 4FZEH 4BQBA 3MGTB 1V05A 5LQBL 4JB9H 1N3NA 2EZ0C 1S7UA 4MYWB 3LAFA 2AJSH 1A7NH 4OD2A 2GTWA 4X5WB 3Q48A 1CLCA 4PJCB 4P3DA 5F88B 5BO1L 3O8XC 3CUPB 2DM3A 1BPVA 2VLRA 3L5HA 1JZ5A 2DQGH 2AKRB 4FG6C 3O45A 1DN2A 3GMNA 3VXME 4PV8B 5FUOL 3EYFB 1QZ1A 1T66C 12E8L 1TZHB 1RPQA 2VR9A 1K4DA 5LVEA 3FN0L 2BSTA 1OM3H 2ZOKB 1KB9K 3FQUB 1LEIB 2AK4D 1CLZH 3QNYB 3LN9A 1L0QA 1L4IA 2GIYA 4POUB 3VFWB 2GFBA 4PGDB 1KIRB 5T1MB 1LD9B 3O3DA 5DJYA 1T5XB 4YUEL 5F6IB 3VDBA 3GMQB 5IF0B 1V7NL 1UKSA 1VGEH 5IBLC 2UY7A 1S7QB 3I02B 2KQMA 1DBJH 3RVVC 1N5AB 3TEUA 3WDIA 1B0RB 2DLEA 3GSQB 4GAJL 5DHYA 4MWFA 2BERA 3JZ7A 5FA4A 2LU4A 3BVNA 4HCRA 3AREC 3SDCA 3IDNA 4LBEB 2FJHB 3WHE1 2CDGB 4FXGB 4NRXA 5MEPA 4LPWA 2VH5L 2VLKB 4BQ8A 2OL3A 4U1LA 3MV11 2AXGA 2GAZB 2LTQC 2P1YA 1R5IA 3D3VB 1OGTA 4NBYB 1V7MH 1JGDB 4HUMB 2D0FA 4NKIH 1ADQL 4DK3A 1IC1A 1KTKE 4QGTA 4HQQH 4PRPA 2V9RA 5CIPB 2Y5TB 3BN9C 3GGWB 4L4TE 1ACYL 5I18H 1I3UA 4HKXA 2NLJB 2F19H 5C9KA 4YDIL 3V4VH 1PEZA 2Z4QA 5I19L 4MSWB 2DI9A 3ARRA 4LK4A 2X4TB 2A9ML 4X9IA 1JI1A 2R1XA 1JNNH 2BRRH 3MLZH 2FH6A 2C3GA 4PB0L 1ED3B 3ARZA 1J05A 3D85B 2CUMA 4HGWA 1VADA 4KK9D 5GGSY 1BGXH 3HZVA 4XZUA 1UM5L 4JFQA 3L1OL 2Z93B 1EGJA 1S7TB 2IGFL 1ZSDA 1DQDL 3L3IA 3L3HB 4HAGA 4N8CH 3R8BB 1CFSA 3D18A 5C8JA 4I2XA 4WFHE 3KLHD 4QXGL 5TDPB 3SKMA 1MJUL 4Y4KD 3ULUC 4BSWA 5EOTA 3VD5A 5IJVB 2BX5A 3HNSH 3LVEA 2YUXA 1HN1A 4MLSA 4LKCA 3O2WL 3R0MA 4IHOA 2B4CC 2P43B 1PVHA 3FT2A 4O2CA 5AZ2L 1H15B 4XH2B 3HB3D 2ADFH 1W0YT 5I1IH 3B9AA 3VGGA 3MJ9A 3SDCD 2ARWA 1QUNA 3LOWA 4ONFH 4KROD 4JKWA 4GW5B 4MJ5B 4XPHH 3ARSA 3TIEA 3UO1L 4JE4B 3S88L 3DMMA 3MRMB 3M45A 4HHAB 3U48A 5B38G 3V5HB 2BDNH 5DVKA 5J4MA 1OGAA 1JYVA 3RGVD 2X9XA 3MRHB 4H1LB 4YX2L 3ULVE 1OQXA 1HHKB 4KDVA 4U49A 3QCUH 1GZPB 5IMLA 4PRPD 1EO7A 1BVLA 1RUPH 3NN8B 5HTSA 3RVUC 4Z7OF 2YWZA 1EEYB 3D9AH 1VGKA 1NGWA 1LEGB 1N64L 1TJGH 2JJWA 2R2EB 1T1YA 4N9GB 3S5LB 3MRDA 5EG6C 4Y4HC 5LAXA 2OTUB 3ARPA 5K9JH 1L7IL 1ZEAL 5LGJB 1YN6A 2NX5A 3VDAA 4U6TA 4P2OB 5DQDL 1F58H 1PKQB 4R90H 3EYOB 1R3HA 3TA3A 5DHVA 2DQHH 2AV7B 5K59F 4QRUB 3X11B 1W0VA 1AGEA 1BQHB 3IXTA 2G2RB 3AU1B 3PP4L 1I1AC 5JW4M 4MAYA 3TBWA 3WIHL 1AR1C 1S8DA 1SBBA 3O3AA 4DWHA 5KN5A 1D9KB 3HZMA 4QF1B 1CIUA 4ODVL 2AJXH 3V8CA 2AQ3A 1BD2B 3DX6A 4W4NA 1UB6A 3IDUA 1EFXD 1A7BA 4HBQA 2YPLD 4HIHB 3HUJF 3BW9A 1CZ8H 5GHWL 4FZ8H 5D72H 3VRJB 4MZ2A 3ZKXC 2Y72A 3ARDC 5D1XB 5MHSE 1D5BA 3QCVL 3QUKA 4Z18A 4Q6IB 2O5YL 4C56A 1DEEA 1UZ8A 5BS0D 4FMFA 1HYSC 4U7MA 4K7PH 2HMID 3HC3H 2CR3A 2EYTA 3HUJA 1J1PL 2VQ1A 4UV7L 4OCSL 2IPKA 1WZ1L 2UYLA 3G9AB 1F6AA 4WI5A 4LDLB 3BKJH 3DBXB 3DMMD 3CZJA 1UACH 3CH8A 1NMAL 1YYLL 3P4LA 3QDGB 5E5MB 5EWIH 4H25A 2DWEA 1UCBH 3U36A 1LNUA 2YZ8A 3CFEB 5FHAL 2X4NA 5JNYB 4FN0A 2XXCB 2R4SL 3P4MA 3HFMH 4EUPB 2AW2A 4PG9B 3L6FB 1MCEA 4LLQB 5I2IB 1T20B 5DD0H 2NX5D 3DYMA 3S35H 1X5GA 4XVUC 3CSYB 2XTJC 1ZHBA 4HBCH 3TA3D 4CNIB 2XG4A 5EDXA 2WBWB 3WBDA 1MJJB 3HG1A 3V6ZA 4Q9RL 1EMTL 5KVDL 4HKBA 1HH6B 4L8BB 5EZOH 4MAYD 1DUYB 2W60A 2C3VA 4M4RA 4FMKA 2E9WA 4HIXH 1WAAA 3UTTE 1U8KA 1IGFL 1LEKA 5D2NE 3B9EA 1NKOA 4KQ3H 3WNOA 3IDYB 2IAMA 1B2WL 1Z9MA 3N1GC 4QOKB 3D2UB 5EC2A 2B39A 1WCBA 5ABDE 4KAQH 1UVQB 1HSAA 4JRWA 3LRSB 4MA7L 1PKOA 3WFCL 4C56D 3VWJC 4KK5C 4U1SB 4S10A 1BX2A 3RIAF 1SVCP 1ZTXH 5IBTL 1QFWL 4UI2A 3L3OB 4J23A 3KPQA 1EBAA 1VERA 4ALAL 2E7BA 5LJYH 4A6YH 4LIQH 4RRPG 1CFNB 1IQWH 1NGZB 5H37H 4F2MA 3ULVL 4YH6A 3BZDA 2FX8H 3K4ZA 5DQJB 2DLIA 5HHOB 4U1GB 4K94H 2XPGA 1OSPH 1QNZH 2WV3A 2WBJC 3MRGB 2CO6B 5HD8D 2VE6B 1TNNA 4CU7A 9CGTA 4K8RL 4FFVC 4WUUD 5L0QB 1VACB 2XN9B 3LQAC 3MV01 5HPOA 4TNWF 4OSUL 3H9HB 2NY5L 3OKEB 1JP5A 3INUL 3HAEA 1FL5A 3UC0L 1CWVA 4FQ1H 1KLUB 3HG1D 3M1BA 1MLBA 1IGYA 1MJ7H 2H2PD 5E94B 4TVPD 4JZNB 1UA6L 3FO2B 5T1KA 2ARJB 4TSBL 1DL7H 1TZGL 2JF1A 2P46B 4WJ5B 2C1PB 3EYQC 4R6UA 4V1DD 5IOPA 1KB5L 4MJIE 3NIFF 3VGEA 1NUNB 1NEZA 1E27A 1RUMH 4UTBL 2IAMD 1PY4A 3ZKQD 3IJHB 3KS0J 5TDNB 2ZKHL 3IKCA 4NRZB 3V7MA 1QVOB 3V52H 2AK4B 2GI7A 1M7IA 4MXWL 3U4BL 4KZEL 4L4TB 1MCSA 3FB6B 4UOW1 3SO3C 3CMOL 5IW1B 1P5UA 4FABH 3KYOB 3KPSB 1AY1H 1CBVL 4M1CC 4DZBB 3QA3B 4PY8J 5ICYB 4HCRH 1JMZA 1VEOA 5BXFA 1X6LA 2H32B 4K3HA 5GS2D 3VFTB 1S5HB 2FO4A 2P5EA 5DK0B 4PYHA 3ILPA 5IB3B 3MOBH 2OL3H 3CU7A 4KI5F 1OB1B 1FHGA 2ESVD 1I9IH 3LIZH 3QUYC 1QLEH 5L2KA 4NP4L 2OJZH 4ZSOE 3D39E 2DF3A 3QWQB 1OP3K 1A5FL 1PZ5B 4YHZH 4WY7L 5LGHH 3MRRA 3MLVH 1CDHA 5D8JH 4GKOA 1YQVH 4YEFA 5E8DL 4AIXA 4QRQB 1TZIA 3ILQC 4J12A 1FYTE 1U92A 5IVXE 2EDYA 2HRPH 4HJJH 5J3HC 1FORH 2NY0D 2R8SH 3DI3B 1BLNA 4G42A 3UTSE 2GTWB 3QDJE 3VXQA 1A9BA 2EYSB 2F8OA 3QWRA 2IADB 4HULB 3IRZA 3PUCA 5D70L 4BA8A 2CDEB 1TETH 3KJ6H 1EGJH 2VLRB 3H6JA 1IEHA 5C0CA 4KMTH 5T1KD 4L4JA 3IB4A 3VMPA 3O45B 1EHNA 4RGNE 2A0LC 3MGOA 1M4KA 1EEUA 1T89C 4HJ0C 4PREA 4WU5B 5DS8A 1FNSL 1K4DB 1MI5E 1Q72H 2BVYA 5IESH 5EORL 3MLUL 4JANB 1Z2KA 2BSTB 2W9DH 3NZHH 3PF2A 3C6LA 2P47B 1OSZB 2BVPA 3MMEA 4WEBH 4BELD 4AEHL 1QPPA 2NY6B 1FGVL 2BSED 3PDOA 5F6HJ 5DZOA 4Z7UE 1IARB 3HKFA 4Y8DC 4H88L 5DJYB 3MJ9H 1N6UA 1R6VA 4FQLL 4OCXL 5C0AE 4LCWE 2EIDA 2P5ED 1MRCH 6FABH 5T5FH 5LCVH 1IEBB 2UZXB 2EKJA 3TV3H 5HPMA 4RX4D 3KPRE 1PZUB 4OZIF 5DHYB 4GRLD 3U9PL 1U8NB 4MWFB 3HA0A 4ZO7A 2VZUA 3IDNB 2ZOLA 4AZ8A 1X3DA 5FK9A 1D5XB 4PRDB 1NSNH 5FUCE 5HJ3B 2X4RB 1S3KL 1KB5B 4PJFA 4KI5D 3NA4A 4U1LB 2AXGB 3P9LA 4URTB 4KQ4L 4PRAB 1UWGL 2IEPA 3KAAA 4OZIA 1R5IB 1OP3H 4OAWB 3GI9H 2RCSL 1NLDL 5BV7B 1U3HA 1NCAH 3L3DB 2RFXA 1S9WA 1B6UA 1JF6A 2A74A 4DZ8A 4ETQB 1R24A 4FNLL 4HKXB 1EEZB 2X1OA 3U9UA 5KVGH 5F7EH 3QWRD 5DHVH 3DRQA 2AXHA 3FQRB 2O5ZH 3LY6A 4LRNH 5KSBA 1MRDL 1ZT1A 2XZAL 5KVFL 4BYHA 2DLGA 5C0CD 1EX0A 2R1XB 3W9EB 3O8XA 3VXSE 4OB5H 3EZ8A 25C8H 4XXCC 1MFAL 1VADB 4PTTB 5F9WC 2KKQA 4G6JL 1A9EA 3T3MF 5DJAA 3QEUA 1WFNA 5BOPA 3C6LD 1B0WA 1YNLH 4DAGH 1A1MA 1QYGH 1EH9A 1Q0XL 5FO8B 4W6XB 4XCNA 3D18B 5C8JB 1ITCA 2C4XA 1ES0B 1A6VL 1E28A 1SHMA 4EIZC 1IE5A 4ZFZA 3CGTA 4BSWB 1OAXH 4HXBH 1DN0B 3WNPA 4JLRA 2IG2H 4LOUC 3RIAK 4R96B 1NDMA 4JR9H 2W92A 2SEBA 4IHOB 4OLVL 3OHXB 1G7JA 1X9QA 4UNUA 3OBAA 2B0SL 1XH3B 4FQXB 4KJPC 1XGTA 4BM7A 2YUVA 3LH2L 5F89A 5KVEL 2GT9A 1UB5B 3B5HA 1G9NH 4MNQB 3T1FB 3TIEB 3UTTB 1KENL 4RGMC 5KJRL 5D2NB 1YEKL 5CP7B 3F7QA 1OGAB 4OLXH 4HFUH 3FQTA 1U3HD 4JO2H 5L8JB 2HG5A 2CLZA 3K4DA 3TT3L 1KFAH 1BIHA 4OLWH 2DQFA 4NJ9L 4W81A 3VG9C 1BVLB 5GS0L 5EIIA 4JKKA 1PY9A 1J1XL 3MLRL 4NQXB 4WFED 4XPTH 1VGKB 1NGWB 3OR7A 4Y8AA 3FO9A 1I8IA 3MRDB 3UJJL 5ADOL 5C71A 5I71C 5C08E 3FRUA 1I1CA 3SDYH 1IM9A 4E41E 1QSEE 2JIXA 3T0DA 4F3FB 1QRNA 1X4YA 5JHLL 1MQKL 3STZA 5JA8B 4TPRL 1KNOA 1J0YA 1TDQA 1W0VB 5LGKA 1AGEB 3TZVB 3IXTB 4YDVA 1EO8L 3VFPA 4NZTH 1KOAA 2ZSVB 2EDXA 1S8DB 2CGRH 3O3AB 1SEBA 4QEGA 5DTFB 3CFKB 1KCVH 3HZMB 5TF1H 2I60H 4H0HB 5DYOB 2NXYB 2GSGB 3LKNA 1HQRB 4ZO6A 3DX6B 4G6AD 3BT2H 3GK8L 5GS2H 5SWQB 2BMKA 4YWGH 4ZFFB 4G6ML 5AD0A 1U8OB 2V9QA 2WWMC 1RIVH 2P8LA 4F8TA 3O6LL 4G5ZH 4B53A 1T04A 1HINL 2CLVA 3UZQA 3QEHB 3QUKB 3TH4T 3NH7H 4L3AA 2R0LL 4NFBA 2WLZA 1UZ8B 3NAAL 3PQYA 2OZ4A 1O7SA 3RX8A 3CC5A 4U33A 3QIBC 4AENB 2WNGA 4HIIB 1BHGA 5E5UB 1FPTL 1F6AB 1L9NA 3WL9A 1IL1A 5D6CA 4GS7C 5CLTA 3C8KA 1Q9KA 4DKFL 3G08A 3D87B 5E6IC 4I3SL 3FQWB 5JHDE 3DV6B 5CAYB 2FBJL 1DFBL 4PY7B 1CGSL 3TFKC 4XC1H 4Y5XA 3RX7A 1J11A 2X4NB 5C09E 1UM4H 1YMMB 2FWOA 3P4MB 2HH0H 4XPGH 5JO5B 3SJVA 1IM9D 3MJ6A 4LCUB 3BP5B 3BGAA 1CK0H 1A47A 2JIXD 1QRND 5HVHC 3JWDC 3JWNC 3TVMC 4POYA 4J4PA 3LEYH 3WNNA 3OJDB 1IGTA 4YXHL 3H8NA 4J3WA 2EIZB 4HKBB 2V6HA 4JHWL 3WFDL 5GGQL 2DMKA 1LO3L 4CUCA 2VXQH 2DMBA 1LEKB 2HKHH 1V3KA 5FDYA 1IEAB 5CSZA 4NQDA 5IVXB 3PWUA 5IEHA 3RNKA 3NPSB 4JFDB 3NIDF 5FO7A 3OJMB 4YDJA 2VKWA 3EW3B 4G9DB 4X7SH 2HT3D 3PQYD 3CFBA 3BIKB 1BX2B 2EKSA 4NKOA 4YHMH 2NXZD 5DVOA 4NN6B 1X5FA 2QADC 4K23H 4YHYB 1Y6NR 2GTZA 5F96L 3QG7L 3RRQA 3T0WA 5IKCA 3DROA 4G7VL 5FHBH 3O11B 3RKDD 5ALBH 1S9YA 1CXLA 2W38A 4KRPC 1XMWA 1K4CA 1RZ8B 2YR3A 4P9MH 3VD3A 4KKLD 2XPGB 2BNQE 1RK1A 5DT1H 1CYGA 5JZ7D 1F42A 3MV9E 5C0AB 3SJVD 3LD8C 3UYRL 3NABL 4X6EA 2VJXA 4KKAC 4PRIE 4HUVA 4KHXH 2G5BA 4N1HB 2MOVA 3OKDA 4J4PD 3HAEB 4UV4H 1FL5B 1F3DH 5J56B 1QSFA 5F7HA 3OJ2C 3BI9X 1WFOA 5FCUL 3U7AA 3VD9A 3LKPA 1CE1L 5K9QG 1IC5H 4YHOH 2GYSA 4ONHB 5MENE 4JY4B 4I48A 5I76A 3NCJL 5IOPB 3T2OA 3GMRB 4FQHB 1NEZB 4NQDD 3I84A 4ISVA 5I66A 2ITDB 5HHVH 2FHCA 1EAJA 4OZFA 3MX0A 3IKCB 1BFTA 3ES6A 4M6ML 1M7IB 5SWSE 3VFRA 5I1LA 4X83A 1KJ2H 4U6XA 4GAYA 1CVSC 1ZT7A 3CVIH 2ZUSA 3DX7B 3OKYA 4GO6B 4F8QA 2BHYA 3RL2A 4G8GE 4O02L 3SKUD 5BXFB 1YJDC 3TC9A 4WIQA 4X9HA 1BVZA 2FO4B 5EC1B 2P5EB 4HUUB 3A6BH 3HI1B 5I1KH 4QT5B 4NO5A 3U46B 4U6YA 3SGEH 2JELH 1NCWH 5D71H 5L2KB 1DTUA 1JYNA 3FCTA 1NGPL 1HHJA 3K0WA 4WU7B 2EICA 4Z0XA 4F33B 3WEXA 5ALCH 5CEZE 4DOHE 1TZIB 2YMXH 4PLKC 3HC0A 5IT2L 1J7VR 4D3CL 3H42L 3CLEL 3ARBD 2FIKB 4UAOB 1RJYB 1MFCL 2NZ9C 1J88A 5TDOA 1KTDA 1CGWA 5DJZB 2Y06H 4P3CH 1BLNB 1FV1B 1CR9H 1QKZL 5IGXH 4O4YH 5HHQA 3C9NB 3VH8B 3AS2A 3F5WB 1CLYH 5DA4A 3RPIA 5IUSA 1JV5B 3BFOA 5CEYA 5CEXB 5E8OB 3L5WA 5CZXD 1DLHA 5E7FA 1E6OL 3WIHA 4Z5RB 2UWEB 1MCOL 5FM5M 5EUKB 4LSRL 5GJTL 5DMYA 2VKXA 4LARL 5JW3H 1AP2A 1U8IA 3P0YL 2FGWH 3BDXA 4WDIB 5I0ZA 4XWGL 1AXTL 3MMEB 3F65A 1F00I 4OD3L 4DUVA 1WSST 4QRRB 1ZLSL 3MZTA 5D2LE 5CJQH 3H9SA 1A4JB 1T7XA 2VSDA 1NFKA 4XP6H 3FO1A 4UBDD 5C08B 4Y2DC 1EHAA 2AGJL 4YEEA 2J4WH 2VQTA 1ZVYA 3SDAA 2A9NL 2HFFA 3D25A 3F6LA 2HFGH 1H3TA 4TTGA 2NNAA 1OF2B 4EI5B 5EA0H 5IIEA 4UQ3B 2X40A 1GL4B 1IFHH 2R0WL 3H7BA 4K9EC 2XTJE 3N1PC 5MI0B 2ZOLB 5IFJB 4TYUA 3FRPG 2HT4C 3I75A 5KSAA 5KZCD 1HKLH 4XP9L 1J8HB 3WHXB 4NGHH 3P9LB 1ZS8B 3DSFL 1NAKL 4P5KB 2A77L 5J1AA 5DMKA 1Q9LA 5TH2A 3VGAC 3P73A 2RFXB 1S9WB 2A74B 4HS6A 4DZ8B 4NC2B 1R24B 1WZKA 1N0LA 3BJLA 3WFEH 5A2FA 2D03L 3VXMD 2EO9A 3U9UB 2X7LA 2CUHA 2D7QA 2FLRT 1JZ7A 4OJFL 5JXAL 2HRLA 5KSBB 3DX9A 2B4CL 3CU1A 4XNYH 3O8XB 4YDKL 2E7LA 1T1ZB 4M1GL 2EEBA 1FG2B 5BZDA 1R3LA 1IM3A 3PDDA 2E9JA 1LO2L 3S36H 3SE9L 4M61A 4Y4FC 3WS3A 1RJZA 3ALWA 4LQFL 5JHDB 3GBMH 1VEMA 3QEUB 1A7PL 3G04A 3Q6FA 1FE8L 3R0NA 4G6FD 5IBUB 5E4EB 1BZ9A 3FZUD 2DJ4A 5ENWA 4HT1L 4XPBL 1LWRA 3H9SD 3QCTH 4XCNB 3BIBX 4LU5L 1E28B 4IRJC 2OZ4H 3B2VL 4IDJL 5F21B 3ULVF 1MLCB 3SDAD 3WHE0 2EIBA 4JDZB 4X8XA 5FYLE 1TMCB 4GJTB 4KK6C 4XT1C 1LK3L 1X7QA 3TP4A 1W0WA 3WSQL 4PYGA 1FP5A 1IGIH 5LQBH 3FFDB 5E4IA 4TUJA 1B6DA 5JIHA 3AREB 3U6RA 5L8LB 5F89B 2FSEB 4OLUH 1M1SA 2X4OB 1G7MA 2QQQA 3TGXA 3O6KL 3EAKA 5BO1H 5CEZL 3MV8B 2LTQB 3FT3A 4IBLT 3ZHKA 5HI3C 2QHLA 3DURB 4N0UB 2NY1C 2DQFB 4GUPB 3ZKMD 43CAA 3PG2A 4FRWA 1A6WL 1MHHA 2H8PB 12E8H 1TLKA 3MXWL 4EI6A 2EO1A 2YD6A 4OZ4B 3OR7B 2BSSB 3P0VH 5FV2A 1RVFL 2BFVL 4OZHE 5IMOB 3KXFA 2Y25A 3OAUL 1A14H 4AEIL 3I3DA 4MDIB 4KMQA 1U3JA 1FFOB 1PG7L 2R2BA 3B6SB 5ITBL 3QHFL 4JDTL 2OBGA 2WQRA 3WUWG 2GJ6E 1C16A 3W11C 3GZKA 3DIFB 2EYRB 4YDVB 5FCSH 3VFPB 2B2XL 3V6BR 1V7NH 3QDMA 5E8NB 3GIZH 5CMAA 2OI9C 3N0PB 5DQ9B 4OBSA 1SEBB 4OCWL 4M00A 3DGGA 1TPXC 3BXNB 4U1JB 4PY8I 4MNHB 5CZKA 4XP1L 1Y0LA 2D7TL 1RZKC 2IBBA 5AD0B 2VH5H 1BVKA 5SX4I 1D6VL 3B8YA 4OUUB 3WCYA 2CLVB 4RMQA 3T09A 1C5DA 5EBLA 5TE7H 3LEXA 1ADQH 4RBPK 3VXOA 1NCCL 3CXDH 3BGMB 4R4BA 2NXZB 3ULVD 5KANI 3ARGA 1ACYH 1AR2A 1WEJL 4RAHA 5ECJE 4QHMB 1INQB 4MQXC 3WL9B 4GBXA 5IW3A 5EO1B 4MNGA 1Q9KB 1L6ZA 3AVEA 5I19H 4RRPA 3K3QA 5IB5A 3G08B 5D7IA 1IKFL 5IM7A 5E03A 5EFIA 1NMCB 1JPSL 2ARJQ 5MEQA 4K8RD 4KJWC 4X6BA 5I8OL 5HHMD 4ZUVA 1ND0A 4D9RE 1RSFA 5GSVA 3I9GL 5EN2B 3BPOC 5JORA 1B4JL 5DWUL 2IGFH 1S9VB 3PHQA 4Z78A 5FECB 4Y4HB 4DN4H 1RZIA 2ZCLL 1JPGB 2B1AL 2VC2L 5I1GH 1DVFA 5AAWA 1A7RL 1IGTB 1GC1C 4IIQC 3JBG7 4NHUA 4OZFH 4ZS7H 4F7TB 3QDMD 4NKMA 3X3FL 3O2WH 2P5WA 5GJSL 1I1AB 3ZTJH 5JIKA 4LCCA 1C12B 2VDLH 5AZ2H 4BQ6A 5MHSD 1A7QH 2EDFA 1X5YA 4S1DC 3S34H 4JFYA 2F54E 4MAUL 1K8IB 1D3CA 1CF8L 5FYLL 3S88H 4ODWB 3ZKXB 5BVPL 1MAML 5C0BE 2VISB 1HQ4A 1MSPA 3CFBB 5IVOA 4YX2H 5AG8A 3CH1A 2EKSB 3L5XL 4ELMA 1FBIL 3QFJA 4X6CE 3ARGD 1OAKL 2HTLD 2DM7A 1UXSB 1G7IA 3QIBA 3TYGL 5ANME 3LSOA 1DQJA 3SKJL 4F7MA 1M7DB 2IQAA 5AYUL 4GBXD 2VQUA 2LAAA 3RWDB 3DXAE 4XPAL 2GJJA 3PNWA 4RBPH 5JLZA 5IVZA 4F37F 5FEBA 1JNLL 1L7IH 2ADIA 1Z0NA 1BOGA 1S9YB 4RWHA 1XR8A 4P57A 3V6FB 4M48L 5D2LB 1GGCL 5TQ0L 4LAJH 5DRWB 2G9HA 2Y6SD 2D7NA 1RZ7L 3QJFB 5DQDH 5SV4A 5J0BA 3RHWF 5TGBA 3FJTA 1SY6A 2Q86B 4KZDH 1KG0A 4WGVB 2YS4A 4NO2A 1HH9A 3N50A 4X6EB 4S0SD 5KW9H 3WIHH 3HR5B 3MTRA 1K9TA 2VIRA 4HPYL 1DVFD 3OKDB 4ODVH 5JXEC 2DN7A 1TJIL 1YDPB 1EV2E 1QSFB 2I07A 4DGIL 3IDGA 4MJIA 3LHPL 5GGRB 2H6PA 4X6DB 1WWWX 4KY1L 3LDBC 3OMZA 3LKPB 5GHWH 5MEOA 4ZUUA 5L88H 4HZAA 2P5WD 2W0FA 4I48B 1B9ZA 1JN6A 1RHHB 3LKQA 1P7HL 35C8H 4KWUA 5I76B 4YK4C 2NY4C 1H8SA 3WLWD 4ISVB 3WFBH 1XF2A 3UTQB 2OQJA 3ZDZE 2NR6D 4PLJD 4BQCA 3T3PE 3MUJA 1J1PH 4DVRH 5I6XB 4JKPH 3Q3GB 4OCSH 1WZ1H 4L29A 5I1LB 4Q0XL 2X89A 3RWGA 4U6XB 3MPCA 2W65A 3PJSA 1ZT7B 2PW1A 3RP1A 1YYLH 3RL2B 2N1KA 3RTQA 4EKXA 1DR9A 1WISA 4ZSOA 3D39A 5IVXF 4M1DL 2X4UA 5FHAH 3QFJD 4X5LA 3NPZB 5IQ9A 3RY5A 3MNVA 2LAGB 4MQ7B 4NO5B 3O6FD 3T2PA 3WFZA 2R4SH 2Y36L 5ESAA 3FO0L 1TVHA 2HTKD 3QXWA 1MCWW 3A6OA 4IDLA 2VLLB 5CUSH 3EIFA 4XHJD 1HHJB 1FYTA 3CFJA 3QQ9C 4WENB 2OMNA 4P59L 4N68A 4WHYG 1UXWA 3KDMA 3PWJA 5C07B 5HGDA 1SQ2N 2D31A 1WWBX 2Z92A 1GHFL 3HC0B 3QDJA 1MCHA 2AI0L 3OPZH 3HE6A 4Q9RH 1EMTH 4NNPH 3U0TA 2GITA 1XCQA 4LSVL 1MCBA 2J8UB 4TULL 4EVNA 4HMDA 4QTIL 1EEQA 3HE7C 2JB5L 5EBWA 4LSTL 2H9GB 3QHZL 5HHQB 2OMBA 2R69H 1OLZA 1EA9C 4NT6B 4Z7UF 2N7AA 3BUTA 4MJID 2AJ3B 1MI5A 1GIGL 1B2WH 4RAVA 3ZYIA 4XMPL 3L5WB 3VFGL 4G8EB 4KTDH 3UYPA 4I9WE 3HPJA 4Z7VA 4R3SB 4MA7H 4UOW0 1FZJB 4ZPTB 3WFCH 1ERNA 1AP2B 1IAOA 1U8IB 4M93C 2VDQL 4JZJA 4MA3A 2H26A 3EJZD 4LLAA 4XNXL 1T6WA 1N8ZA 1QOKA 1F8TL 4OD1L 4PJ9C 3S3SA 3Q5YA 5IBTH 1QFWH 4Q6YA 1J8KA 4LCWA 3ZE1E 4E0RB 3H9SB 2X89D 4AEFA 3SO3B 5IB1B 4ALAH 4JFEA 3KPRA 5D5ME 4JHBA 3RTQD 2DQEH 3D39D 5D1ZA 3ULVH 5JOEA 2Y07L 5DEFA 3GBNL 2AJVL 2HFEA 1MIML 1PG7X 2KBGA 5GISL 1XIWC 2NNAB 5DSCA 3QUZC 1TIUA 1GRWA 2I9TB 1DBMH 3H7BB 2BNRB 4ZUWA 3QUYB 4QCIB 2IBZY 1FYTD 4K8RH 4GQ9L 2FECI 4Y19B 3EUUA 5KSAB 1VFBA 3QPQD 5GS0D 3IS1X 1Y18A 2NY5H 2YUWA 3INUH 2NW3A 5B38B 2D3VA 3UTSD 3UC0H 5E08L 4I13B 5B21A 3QDJD 4W6YB 4KKCC 5J1AB 5DMKB 3HE6D 2XZQL 5TH2B 2X70A 3P73B 4JJHA 2X4PB 3O3UN 3BKML 1UA6H 2EDJA 3RWFB 3GSNA 5J8OA 1FAKT 3WD5L 4DGVL 3VXSA 2X7LB 3KG5A 5BW7A 4KVNL 3BZEA 4RGND 3DSNA 4UTBH 1MI5D 4P5TC 5DJ6A 3SOBL 1A4KB 4GLRI 4MXWH 4KZEH 4QXUL 1E4XH 1XGUA 3EGSA 1Z6JT 3HN3A 3CMOH 5B39G 1I1FA<