4NC1E

Crystal structure of tcda-a2 bound to a20.1 vhh and a26.8 vhh
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
124
structure length
124
Chain Sequence
VKLEESGGGLVQAGGSLRLSCAASERTFSRYPVAWFRQAPGAEREFVAVISSTGTSTYYADSVKGRFTISRDNAKVTVYLQMNNLKREDTAVYFCAVNSQRTRLQDPNEYDYWGQGTQVTVSSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Cell wall-binding repeat protein
publication title Structural Basis for Antibody Recognition in the Receptor-binding Domains of Toxins A and B from Clostridium difficile.
pubmed doi rcsb
source organism Clostridium difficile
total genus 31
structure length 124
sequence length 124
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nc1E00
3CJJA 4IRSC 4OZHA 2XRAL 1LMKA 1IC7L 5TH2A 3BZFB 1ZS8A 2MCPL 1BFVL 2ZUXA 3RA7L 1A3LH 5C7XL 1JZ4A 5B39B 2W0FB 1KCSH 3O9WA 2WUBL 4UQ3A 4WDIB 3QNZA 1SEQH 3N0PB 2EIZB 2R1WA 1A1MB 15C8H 3DHMA 4C57C 1J9CT 2JB5L 1WF5A 5AZ2H 2LAGB 4QXGL 3FMGH 4RDQF 1D6VH 1D9KC 3WHE1 4E9LA 1YEFH 4Y16C 1OQXA 1G7LA 3EOTL 2VC2H 5MENA 4JRWA 2X4NB 3EYQC 3U7YH 4FQCH 1A6UH 4OZIE 4P59L 4OFYA 2ZPKL 1UACL 5IVXE 5AD0A 3NA4A 1KPRA 4ELMF 4NNXB 3KWWA 3JBG7 3G5VA 2WIIA 5C2UB 3DX6A 3FONB 4IOIB 4JPVL 1R3LB 2Z8VC 4MS8C 1NAMH 5EIIA 5DD5L 3MRIB 4CJ0A 4YHPB 2NY6C 2VDML 1XCTA 3D3VB 2VH5H 4F7MB 2EZ0D 4AQ1B 4KMQA 2O61A 2VABA 3K0WA 3WFZA 1VKXB 1IGTB 3BEWB 1ZVSA 2ZCLL 5IWLC 5SWZE 4GUPA 3QEQB 5HYQA 4XMLL 4YH6A 1ORSB 5A40E 3L3HA 4LPYA 5GRUL 3PQYA 4LL9A 3WEXA 3G08A 4WEBL 4NOBA 4PRHE 5IB5B 2BSTB 5IQ7H 3SQOL 3U36B 4AEHH 3I85A 3TVMD 3L3GA 1OAUH 4JFDB 2OI9C 2FLBT 5DTFA 2MOVA 1S9XA 4YHNA 3OKEA 5BOZG 2Y9RT 3GSWA 4F9LA 5F93C 1QSZA 4R0LA 5FOJA 4YDJA 5DC4B 1DJSA 3VI4F 1X5XA 3WLWD 2PXYA 2P5EE 3BAEL 1PEZA 3MJ9L 2HTLD 4LLYB 1KLUA 4MQ7B 2BHZA 5KSUA 5JZ7D 3TZVA 2GHWB 4PJDB 1MH5B 4X4ME 4OF3A 4YBLB 1WQVT 3CCHA 1AGEB 3GI8L 5IW6A 1OD9A 5ICZB 3B9AA 2P44B 3UTTE 3SBWA 1FVDB 1NGQH 1NBZA 4X5WB 2GEEA 5LBSL 2M8XA 3OG6B 3OB0H 4UT7L 4OFKA 3RUGB 3W9DA 3QUYC 1QQDA 4PJ8C 1DP0A 3QCUH 2Y06L 4G6KL 1H3XA 3C6SB 3MV8A 1MRFH 4HWEH 4MD4B 3VWJA 4OSUL 4D2NA 2B4CH 2X4RA 5GRYA 4FQQA 5GSRA 2Z91B 4NWTH 3H2WA 4P2RA 4M03A 1OP5H 2QHRH 4HUKB 1F8TL 1GGUA 5FHBH 1RZ7H 1HHGB 4AMKH 1S7XA 3FCTA 3U6RA 1UEMA 4KK8D 1CGXA 4MJ6B 4X6DF 3SHSA 5DRXA 3E2HB 3QCTH 1OGTA 5EOCJ 3VXQB 2VXTH 4OZIB 1P4IL 4OFDA 3BKCL 4OLVL 5IVXB 3LH2L 2XNAA 3X13B 4R7NB 2RBLA 4HGWB 2BFVH 1J86A 1X5IA 3RAJH 4F37K 5CZKA 2MJWA 5EORL 4LCCB 2LABA 1MFCL 4FFVD 3UTQB 1F4AA 4WVRA 4TNVF 2V5SA 2PN5A 1DE4B 4PB9L 3DX7A 1YECL 1SVCP 3V5HB 2D2OA 1MCOH 5FUOL 1MFBH 2V2XB 1B90A 3BE1L 4JKKA 4PP1D 5HHNB 4BFBD 1BOYA 5FGBA 2VQUA 5IESL 4L9LB 5DO2D 1H3PH 2WWKO 5SWZB 2QQKH 4WWKA 4D3CH 5CLTA 4MDIB 3DX9B 3TJEH 3RWGB 4FQXA 4F2MA 4KV5E 3SCMD 1EFQA 3BH9B 5T1MB 3UZQA 4J4PD 4PRHB 4Y8DC 1HDMA 5CJBA 5EIVA 5LQBL 4RAHA 4RQQA 3HN3A 1QSED 1HIMH 3GJFB 4K3DH 1A7NH 5FAAA 4U1KB 5ECJE 4EDXB 4GRLA 4L8CB 3QUZA 2AJUH 1HINH 5DDHB 1LEKB 5M7QA 3KXFD 4POUB 2P5EB 3PG2A 4HLZH 2ZZUT 3QEHA 5ISZD 4D0CB 4KROC 3I84A 2ENSA 5IVOA 3DUUB 1YPZA 3UTTB 4I0PD 3ZYZA 5K9QG 3B9KC 2PO6B 1MCJA 4NGHH 1QZ1A 4F57L 4NCC1 5CINH 1CK0L 3MZGB 3VFNA 3RHWF 1BZ9A 4RAVA 1A6WL 2VLKA 1RU9L 2J5LC 2IGFL 1BECA 5CCKH 3SGJA 4WU5A 2DQJL 2G9HA 1XF3A 2D03H 3IYLW 3GNMH 4PJBA 2XXCB 4OLUH 4GXVL 4D8PB 3VD7A 3VD4A 5DMKB 1JUFA 4GKNA 1MWAB 1QFWL 1A14H 1JNNH 4P9HL 1A9EA 4TVSa 1KJ2A 5HI5D 2BNQE 2ITDA 5DYOB 4WU7B 3V6BR 5D72L 1BBDH 2R0KL 2DWEB 1REIA 1Q94B 1VEPA 3ULVC 5EBWA 2DL9A 2A77H 3ARDC 3WKMH 3QBTB 1S9VB 1UWGL 4LSTL 5C0NC 3I50H 4KKBD 4F33A 2WBKA 4ZTOH 5H37H 4HHAA 1DBKH 4X80H 2DQHH 2CR6A 3ZE1E 2NTSP 1H5BC 3IDNA 3IXAB 2W91A 3U1SH 5L9DH 2PF6A 5DQ9B 3V6OC 4ZAKC 5IW1A 5D1ZD 5L8LB 1CFTB 4BKLA 4Y5XA 3QIWA 4KHXL 4ONHB 2YPVL 1JGDA 1ROWA 4ZFOB 3NCYS 3ZMRA 1DL7L 3O3BB 5CEXA 4N90E 5FIEA 5I1HL 3JSSA 3QZWA 4U6HB 4UB0L 5FYLH 5CAYB 2JTDA 2EH8H 5I1EH 1P84K 1JPTH 2Q87A 1MIEL 2ICES 1U8JB 4YXKL 3MCKA 2DKSA 2HKHL 5ALCL 4N9GB 5CD3B 5DK3A 3ZO0A 5DEZA 3W5MA 1K8IB 3QI9A 4PGDA 2NW3A 4IBLT 1U8IB 4UMGA 4J8RA 4W6WB 2LTQC 1AFVL 1YEGL 3LPGA 4KDTA 3RDTC 1JPFB 2F54D 1OF2A 5MERA 1G6VK 1L7IL 1WIOA 4L4VE 5F21B 3HA0A 3L6FB 1AXIB 4YWGL 4CVUA 3OHXB 2XQBL 1EHLL 3BPNC 3ULUC 4U1LA 2PTTA 4I3GA 1K85A 4L3EE 3GBLA 1BFOB 1M05A 4Z7QF 4LSUL 4OAWA 5E8NA 2VAAA 1S5HB 4L8SC 3BP4A 1OM3L 2BRRH 4NHCL 1JZ2A 2B1HL 2ZJSL 1NLBL 4N8CH 3CZFA 3AM8C 1BVZA 4FFWD 2NY3D 2X1QA 3AS1A 2N7BA 3H9YA 2UYLA 2R0WH 3JWDC 3MO1A 5JXAH 4G8EA 2B20A 1TVHB 1T0PB 4OT1H 5DS8A 3WMSA 5IFAL 3S34H 4MDJA 3BP7A 4JDTL 3U9UB 4PJFE 2BNQB 4K3GA 1BM3H 5D2NA 3BD3A 2BMKB 3QHTC 4U1HA 4WV1C 3D25A 4NRXA 3OKOB 2HVJA 2XN9A 1XAUA 2VKWA 4R26H 3GI9L 4N0CD 2R8SH 3FT3B 4JDZA 3PXJA 1Y6MR 2GQHA 3MBXH 4U1SA 4HKXB 4Z7VE 5F89A 5IVNA 1PY9A 1W0VB 3X11B 2NR6C 5KS9A 5DLMH 1YDPB 3NZHL 4L8DA 2VNCA 5LVEA 5AYQA 1Z3GL 4F80A 4L8BA 4XP6L 1A0QL 2X4UA 4TN9A 3UDWA 1G7QA 3HNSL 4I5BA 1JN6A 3BVNA 1LP9F 4MZ3A 4PJAA 3C5ZB 3P4MB 4GMSH 5TE4H 2NXYC 3GSVA 3QH3B 1SJVA 3HUJA 1A2YB 4QTIH 5D93C 4M1CC 1C16B 1FVCA 1X5LA 5SX5K 4RISH 1CDYA 1HI6B 5C0IA 4PS4L 4CAGA 5CJQL 2Q7YA 2DQCH 5EULV 5BV7H 1XMWA 4FQLL 2HH0L 1ADQL 5SWQB 2XWBA 5T5FH 1XT5A 1JMZA 3DRQA 4HH9B 6CGTA 3G5XA 4ZFZA 3O0RL 5E2VL 3WS3A 2IMNA 3B8SA 2IALB 1A3LL 3VG0L 3MOAH 2JCCE 3ISWA 1KCSL 5EZJB 5ICYA 4I3RH 3FRPA 2ZUUA 1SEQL 5DJCA 4R90H 5DVKA 5E8PA 5AZ2L 3ULSA 3LS4H 3FMGL 4L4VB 1D6VL 4F3FB 5GS0D 3NIGF 1T0MB 3WXWH 5FXCH 1UXSA 3Q5TA 2VC2L 4NNYB 5ITBH 3VGBA 4FQCL 1A6UL 3S4SA 1AR1C 5JDSB 4I77H 3UBXI 5HBBA 2B0SL 1WBYA 3LQZA 4L3EB 4LK4A 3GSXB 4WJ5A 4QRRD 3RX5A 4UQ2B 4LCWD 4NRYB 2VDOL 5AYUL 1JNLL 1RK0B 4P3CH 1I3UA 1ZVHA 1L9MA 1KNOB 1QYGH 3L1OH 1FRGH 5HYSG 1HHKA 4TPRL 3TN0D 5L7XH 3ZTJG 5DD6B 4MA3B 1HILB 2VH5L 5GISH 3U4BH 4PJFB 1CFNA 4MXQD 3K8LA 4NN5C 4GAYB 5GS0L 4IMLA 5F7DB 3QB7C 3DRTA 1WC7A 3QWOB 3VXTB 5L0QB 3GRWA 3NFNA 3VU2A 2LV4A 1ZA3B 2I24N 4G8GD 1UZ6E 5JA8B 2WWKT 3UTZB 1BD2A 4U1IB 4Z7VB 1TETH 1QSFA 2E7CA 2OJEB 4JZNA 1MI5E 2NX5A 5IQ7L 4AEHL 3RQ3A 5E24E 2DRUA 3QQ3A 1OAUL 2QHLA 32C2A 1KN2H 1U8OA 3HG1D 4KRLB 1MHCB 4LHJB 1D5ZA 2D0GA 1OLZA 2GY5A 3NFPB 4IDJH 4BM7A 4XH2B 4ZUWB 3SDCC 4D9QE 3MODH 2R29H 4CRPA 2C3WA 5E8DH 5J8OA 2YWYA 3NVQA 3ROLB 1EHAA 3GMQA 4YDKH 4M7ZC 4I13B 4L29A 3VGGA 3E6FA 4YFEA 2CRMA 4NYLA 1NGQL 1ZA6B 1BREA 5FM4A 4Z8FH 1HK6A 1ZWIA 3DSFH 5CSZB 2GCYB 3BP5A 1PG7H 3EO1B 4U1JB 1G7MA 4X6BB 3U9PH 1MRFL 2JIXD 4HWEL 4HC1A 2B4CL 1IGFH 1Q72H 3DJ9A 3UBXG 3JWNC 3VMOA 4KZEL 3L95B 1PAMA 2JCCB 4NWTL 3D9AL 2QHRL 1DANT 4UNVA 5FHBL 1FO0A 4WENB 4AMKL 4HGMA 5B8CC 3VFPA 4OZ4A 2DLGA 3QXDB 5HPMA 2AV1A 3WUWB 4QHLA 3BUYA 2VLRA 2EXWC 4GW4A 3QCTL 5F1SA 4MXVF 4UIMB 4NM8H 2ADGA 2QQNH 4GG8A 3CVHH 5SX4I 2BFVL 1R3HA 4QWWD 5TDNB 4EQ2A 4AL8H 1R5IB 3T1WA 2V2TA 5GGRB 2MNUA 4F37F 1FNEB 1FZOB 1MCDA 5EBGA 5FYKH 1XGYH 3LKNA 1T03L 3IDJB 4JFFA 4OD2A 4ZS6C 5EU4A 5B3JF 3CDYA 1TVBB 4Y4FD 3W0WD 3W39A 1SY6A 1AHWC 2CDEA 5FA4B 2C3XA 4K94L 4JM2A 1MFBL 4Z95H 1DVFC 3X12A 5I71C 3I6LD 4PRDB 3S37H 3GB7A 1H3PL 1R5WA 5E6ZA 4F7EB 5ISZE 4LLDB 4RRPA 4J1UA 4LBEB 1P53A 3SDAA 3TJEL 3I2CH 1OTTC 4M62L 5DHVH 3FOLA 2OQJA 1MI5B 1HWHB 4LMQE 3VXNB 1HSAB 1I9IH 3HR5B 2H2PC 3TA3D 2J8OA 1LO3H 1GH7A 3FZUC 4K3DL 5DF0A 5D1XD 1A7NL 4UBDD 2L0DA 3CLEH 1FNLA 1RVFL 5IV2A 2WBWB 4RDQG 3QXAA 2AJUL 2BVOA 1HINL 1G9NH 3CFCH 3EIFA 3CSBA 1GIGH 3D18A 3WSQH 2VITA 5J4MA 3T3PF 4CMMA 5JLZB 1V3MA 3VA2C 1RV6X 3MA7A 5EUOB 1NC2D 1XGUB 5KN5B 4NGHL 4AYFA 2D7PA 4KI5F 1EXUB 4WUUD 5CINL 4FTVA 5IB1A 1GZQB 4Y4HD 1KSRA 1QHPA 4WY7H 2P8PA 1H8OA 1TFHA 5CCKL 5CLWA 1R24B 1T4KB 4JKPH 1HKLL 3LAFA 3UXFA 3EDDA 2D03L 3RVWC 1X9QA 3DV6A 3GNML 4JZJB 2ZUYA 2PETA 5KSBE 3DETC 5IIEB 5KG9A 1ORQA 4NZUL 3GM0A 2E9JA 4TUOB 3FKUS 4K3EH 1A14L 5ANMA 1JNNL 1RIUL 4F7PA 3UJIL 4ZUSA 2P4AB 2HLFD 2L7UA 4CL7A 3CUPB 3WIHH 2AERT 4Q9RH 1BBDL 1OTUC 2R1YA 4O58H 5I8KH 1U92B 2A77L 4R4BA 3UTPE 3SCMB 3I50L 3VXUD 5BCAA 3RTQB 1UJTA 4X80L 2DQHL 4APQA 3VFUB 1I3RB 4DGIL 4OZHF 4ZOCA 1QSEB 2EDQA 4Q6IC 1FZJA 1S9YA 4IIQA 1VGKB 1BHGA 3U1SL 5L9DL 3SE3C 1IAKA 4FQIH 4X8JB 3WXVH 2GJ6D 2XKNB 1I7UA 4RGND 1WT5A 5B38A 3WNNA 1IEAA 3GUTB 1KPVA 3G6JA 3OKNB 3GSNH 3WIIH 5JW4R 3QUYA 4ODHL 4PJ5D 5ISZB 1MSPA 2D7NA 2F54E 5DWUH 1K4CA 2XACC 4PUBH 2BY1A 3QCVL 2DMKA 4G8IB 4P3WA 5JIPA 5EZLB 3L5WB 3P0YH 2EH8L 2NY2D 5I1EL 1JPTL 2F8VA 3ZDYE 4GBXA 5IQ9B 4FFYL 1JNHB 35C8H 4H0HB 4J3SA 2VZUA 4OZFH 2CDFB 4XNMB 2Q3AA 5I1GL 3QNXB 4QO1A 2IH1A 4OD3H 3WO4C 2VDLH 4ODUA 2A83B 4R4FL 4RCAA 4NQDA 2E7BA 1Q0YH 1QFWM 3IKKA 3R0MA 2APTA 4MLSA 5I6XC 3SY0B 1JK8B 4BSWA 4UTAH 2MPAL 1J1OH 3CC5B 2FCBA 4Q2ZA 4XRCA 4OB5H 4PBWD 1HEZA 4KDWA 3BESR 4DTGL 4P57A 4F58H 2FH6A 5DJ6B 3WNOA 3KPRA 4QHNA 3UEZA 4YEEA 3WIFB 2FIRT 3O3EA 1QTYT 1CDIA 1WBZA 1AI1H 1JP5A 4JGMA 1NUDA 1UCTA 4X4ZA 2BRRL 4Y5VA 4JN1H 4OIIH 1E4XI 3PL6D 1BVLA 3ZTNH 2P48B 5KSBB 3MBEA 2F8XC 2R0WL 3HC4H 3P2TA 1W72H 4X7SH 3MRJB 5JXAL 3AS0A 3OJVC 4G9FD 1XF4B 3C60C 4DFIA 2VWEE 1RUPH 3P9LA 4OT1L 5F70A 5D1ZB 5T3ZD 4KZDH 3GFUA 4C4KO 3S34L 5I76B 2IEPA 4PREA 2FDBP 1BM3L 3F62A 4HPOL 3RX7A 5JW3H 5DRNA 5DSCB 3QUMH 4WCYH 3JTSB 1P4BH 3NOIA 4QXUH 4R26L 5ELIA 2R8SL 1NGZA 1QOKA 3CFIC 4FXKA 1U58A 3MBXL 1U93B 3IDYB 2BOBB 3M17B 2F9BT 5IMKB 4ELME 2BY2A 1X6LA 5CEZH 4RWHA 43C9B 4WO4C 3Q3GB 4JJHA 1HYSD 1OGAE 1LDPH 1B4RA 5EU6E 3MUZ1 2BNRA 3ES6A 5TE4L 5GGSA 5INDA 4XVUC 4QTIL 4JRXA 2BY3A 2GKIA 3CFDB 2UUDK 2OZ4A 4X7TB 1LEIB 1AH1A 2OK0H 2F54B 1X3DA 4RISL 4U6YA 4PJXF 5A2KH 4KU1A 5D71H 5SX5H 2EXYC 3LN4B 4KKCC 1I7TA 4YGAB 1FVEB 4S1RH 2NY4D 5BV7L 4EI5A 3EOAA 1A9BB 1GXEA 3PWNA 3LDBC 5TE7L 5T5FL 3I75B 1BGXH 2FEEI 4MD0A 5DFWH 1RZIA 4QRRE 4JO1H 2E7MA 2I07B 4LCWE 3MLRH 2E6QA 4XAWL 4M7LH 3RY4A 1AC0A 1P9MC 2NXZC 3IJYB 1H9VA 2YHGA 3MOAL 4KKAC 5JPMA 1IILE 3WNKA 3OX8B 1JGUH 4I3RL 4OCYH 1INDH 2D7MA 2NY3B 1NEZA 2H8PB 1N6QH 2NCMA 3BGMA 4JLRA 3LS4L 3TH4T 2GK2A 1MHEB 3RKDD 3GBMH 3WXWL 5TE6L 3QJFB 4KAQL 3LQMA 5CWSB 3KLSA 4BZ2H 3TESA 1X7QA 5ITBL 1CBVH 4AM0B 2RR3A 1G9MC 3F7PC 3C8KB 4PLKC 3PWLB 4LLMA 2FLRT 5TPWL 3AY4C 4S0SD 1UVQB 5SWSD 1JRHL 5DVOA 1QYGL 4UI2A 2CO7B 1ZGLP 2PCPB 3Q5YA 1FGNL 3ELAT 5F71A 3VRLF 1I8LC 2HG5A 1IC4H 3GKWH 3MRRA 2VSCA 3BDXA 5B39A 2W0FA 1JCKA 1RZKC 3U4BL 1T1XA 3BQUC 2EIZA 5FO8B 4KI1A 1PDKA 1MNUH 1CLCA 4X6DE 5KANI 3C5JA 4L4JA 4WRLA 5TGBA 1INQB 4JM4H 3B2UC 3HC0B 1YPZF 3HS0A 3L7EA 5CJ8A 3V9FA 4EEEA 1FFRA 1QPPA 4UDUB 3H9SA 1TETL 3TIEB 4GLRI 4AIOA 3L7FA 4ELMB 4JPIA 1IGJB 5I1CH 4HJJL 1P7QD 3RGVB 1KN2L 5EC1B 4P4RB 1OGAB 4R7DB 1FSKB 3FONA 3FO9A 1R3LA 5EU6B 1MIML 2BERA 4PGJA 4IDJL 4PJBF 3MNVB 4JB9H 2E9BA 4FXLA 3FQRB 4M93B 4RFEB 1ZLVK 5E8DL 1QBLH 1DUZB 4F7MA 3QA3A 4UV7L 3O6MH 4YDKL 1IAIH 3QISA 3MRLA 3BEWA 2D31A 2FX9H 2F8OA 2CXKA 2JK5A 3ARED 4KMLB 5AWNL 4Z8FL 2O5XH 3DSFL 4EIZC 3DUSA 4I9WE 2XIDA 3VWKD 1MHPH 1PG7L 2YA2A 3WYRA 4QRRB 3O2DA 4YHKH 3HLAA 4LCWB 4ZPVB 3U9PL 4P5MB 3U36A 1IGFL 1IKNA 1Q72L 4JFDA 1KOAA 4JRYA 2E3VA 3LKRB 1XGRA 3NZ8A 1JGEB 1KPUB 4DVRH 3BDYL 1PSKH 3QRFM 2OXGA 1TLKA 1WIPA 1IT9H 2DIAA 4G9DB 1BP3B 4O5LH 1U8NB 4TTDC 3DVNA 3O6KH 4LASH 1MCIA 5HYIA 2ORBH 1JRHI 3AMKA 2HTKC 3RY6C 2B5IB 3MXWH 1G7JA 4PJDA 1FORH 2DJSA 3I6LE 5E94B 1M6OA 3BPCA 1ZLUK 3STZB 3QNYB 4X7CC 1Y0LB 5ICZA 4MVBD 5BO1H 1TZIB 1CICD 1CG9B 1FVDA 3JV0A 4MWFB 2HKFH 4X5WA 3CVHL 2P8LB 3P0VH 1QSVA 5KANG 4AEIH 3RUGA 4OQ1A 9CGTA 1OWRM 3GMRA 2D7TH 1MUJB 3AU1A 1N6UA 2VSDA 4AL8L 3O6FB 5C0CA 2I9TB 1RK1B 5J11C 5JR1H 5HYJE 3G6AB 2EC9T 2KH2B 2Q86A 2GTWA 3DURA 3ZKXB 3RIAK 5GS2D 1C5DB 5IB2A 4DKEH 4Z95L 5E4EC 3INUL 3H3PH 2VLLA 4JKLA 2X6MA 3ZSTA 4HUUB 4P2CG 5MI0B 3WV0A 4X6DB 2G5BB 4ODVH 4YE4H 4LLUA 4P5TD 3REVB 3I2CL 4KI5D 2V17H 3CXDH 3D85B 4P4KC 1NFKA 3THML 3U0PA 5IVXA 4ZUTA 4OD1H 3HKFA 5K9KB 1ZLWK 1I9IL 3ZE0F 1RUAH 3TBSB 1S5IH 1LO3L 2Y7QB 4HT1H 4LEXH 2JIXB 1XGQB 4LCCA 1T21A 4KHTH 5H2BB 3T0DA 3CLEL 4HS3B 4PJ7F 1A6TB 1VACA 2CH8A 2A6KB 3TH3T 3CFCL 2MQ3A 5HVHC 3HZYA 1J0KA 1UWXK 3WDIA 1BQLH 2WM0A 3MCG1 3Q5OA 3RWEA 2EYTA 3RJDA 3WSQL 4U6VH 3P73A 4K9EC 2F5BH 1P2CB 5HGAB 1NMCB 2GSIB 4NUJB 3ARFD 1RJCA 2VQTA 4L9LA 4TYUA 5SWZA 4BK4A 3V5DB 5IG7B 1LE5B 3ZL4H 1BOGA 1TMCB 1JTPA 3RWGA 4IEFB 3C2AL 3VG9C 4J2XA 1X6NA 1ONQA 2VZ1A 3BH9A 4XGZA 5D6DC 2B1AH 3IT8D 5T1MA 5KS9F 1AO7A 3SDYL 4ZQKB 3R8BB 3VXUE 1BZ7B 1D7FA 1FV1B 5I73C 3LQAC 4PBXA 4JFHD 3RWHB 3ZDXF 3RWDA 4JFOB 2Z9TA 3L3OB 3O9WD 1UFUA 4Y4FB 2V5YA 3U83A 1DUYA 1QLFB 1IBGH 3AXLB 3N50A 2P5EA 3HUJF 2UY7A 3MPCA 4PRNB 4RGNE 2V7HA 4X4MA 4I48A 3WIHL 4Q9RL 4YQXL 1ZSDB 3R4DA 3UAJC 4C4KT 4PJ5E 2DTSA 5I8KL 5MEND 5I19L 4UOW1 3X14B 4LPWA 1CGSH 1TCRB 1FFQA 2NY1D 4OFYD 1N5AB 2DF3A 4DCQB 5ID0B 5EFIB 1YJDH 4ONGH 4W81A 5HYJB 4CBPA 5GGTA 1RURH 3TA3B 3K4DA 1FZMB 2J3SA 4HUXB 3BD5A 3TIDA 5D1XB 3EFFB 3HI1A 3T8XB 4FQIL 2ADIA 3NMEA 1WZ1H 3TO2B 5DMKA 3OWEA 4M8VA 4DN4H 1MWAA 1JFQL 3JTTA 4QRTB 2HFEB 2DLFH 2CIIA 2X4TA 1ZHNB 5E2TH 5DYOA 4WU7A 4MA7L 5FHAH 5IMLB 1BMGA 1FGVH 2DWEA 3CXHK 3EBAA 4P46C 1WEJL 3PQYD 4XHJD 4XX1E 3RI5K 3CFEB 1CL7I 2NLJB 2Z35B 4AENA 1S9VA 1MLCB 35C8L 4JHAH 5C0JB 4Y4HB 5F7NC 1KB9J 2V6HA 4QKXB 2QSTA 5DR5H 3DV4B 5E99H 1J1PH 4NQUA 1NKOA 1OARH 4OD3L 4LEOB 4XAKD 1LP9E 4XZUB 5ACLA 3OMZA 2EKSA 3O11A 3LS5H 1Q0YL 2PXYD 1CFTA 2E7LC 5D1QC 1NDGA 4UTAL 3TZVD 4F8TA 1J1OL 4X9HA 2YD5A 4OB5L 3W82A 5IFJB 1G84A 1YQVL 3O3BA 2UZXB 2W1NA 3GRWH 4F58L 1GGTA 5I1AA 1TPXC 2C4FT 3T65B 3MRKB 1W0YT 1UXWB 5HHMD 3VXUB 3L3DA 4IHOA 3MV8D 4KRPD 4JN1L 4OIIL 4YLQT 3VWJD 4N9GA 5CD3A 5D7SH 3ZTNL 4ENED 1K8IA 4YHLH 4P2RD 4KJPC 2GT9A 4E0RB 1U3YA 1ITBB 4Y5YC 3HC4L 1W72L 1FL3B 1U8IA 4JZOB 4X7SL 3C6LB 4DUVA 4U0RB 1RUPL 4KZDL 4XP5H 4RGNB 4BUGA 4NNPH 5BW7C 3QWQB 2Z4QB 4GS7C 1EHXA 3OKKB 2ZOLA 1UZ8B 4PJ5B 5JW3L 1KCKA 4M48H 4WCYL 1P4BL 4M6NH 4QXUL 4JQXC 5AEAA 2A73A 4G8FB 1MEXH 1H8NA 3OHXA 4D94A 3U4EB 1QUNA 2NY2B 4G6AD 3VFVB 4HC1H 4U6TA 1S5HA 4ZO7A 4RGOH 1S8DB 1LDPL 4Y4KC 1UH3A 4WI7A 3W5NA 2AK4E 4QXTA 5DHXB 3E8UH 4IRJC 2OK0L 1KGCE 4X7DC 2UUDH 2AJ3A 4WWKD 2BNQA 5D71L 5FV1L 1T20B 1BVKB 5C70A 1NFIA 3X3FH 4S1RL 4ESKA 4FQXD 3I6GB 2KQNA 3OKLB 5K59F 3DYPA 4LSRL 1BGXL 4JO1L 1CQKA 2YBRB 3BYTA 4LHUD 3MLRL 4NO3B 1V05A 4M7LL 2ADFL 4YBQC 5FO7B 3CMOH 1NDMB 4JY5H 4Z6AT 5SWSE 1XIWA 5DJ8B 4GRLD 1LP9B 1JGUL 4U2ZA 4OCYL 1INDL 3QUZD 1Z0NA 3P4MA 3QO0A 1OWWA 1N6QL 4JM2F 2AQ1A 3QH3A 1I4FB 4HFWB 2CKBH 3QDME 3GBML 5E00A 2WAHA 5ERWB 4QRQB 5JO5B 2YPLE 5HHPB 2CDGB 2HT2D 4BZ2L 5HHVH 3T09A 4GOSA 1FYHB 1CBVL 3VFTB 4JHWL 3L3JB 4D9RE 3MJ7B 4PP2A 5BV7B 1DDHB 1R3KA 2VR4A 4HJ0C 5SWQA 1I1AC 4E42A 2VLKD 4XPAL 3S35L 3RVVC 3KLHD 5CJOH 2MHAA 1WK0A 3HE7C 1IC4L 5JQ6H 4C83A 1N59A 3GKWL 3Q6GH 1EEYB 1G1CA 4M9PA 4YAQB 1N8ZB 1PW3A 1EVUA 3QDJA 1GHFL 3KS0H 4F7CB 2VLJE 5CSGA 3BIAX 4ODTH 4MMZC 2A6IA 1MNUL 1TJGH 4PG2C 4L4VA 2M1KA 1N0LA 5MEPB 2BZDA 3DO7B 5JNYB 4XP9H 3SDDB 4MXVE 4MQXC 5GRXG 1ZK9A 2NY4B 5K33A 4MB3A 4L3EA 3GSXA 3K2UH 4UQ2A 4HCRA 2UV3A 4NRYA 4M8QB 3AB0C 5I1CL 3HE6C 1MCSA 5CJXA 1RK0A 3TM6A 3BKMH 2N7AA 1IJ9A 1F2QA 2B7DT 4PY8I 3G04A 3HHRB 5B3JE 2DBJA 4JB9L 2AK4B 2PYEA 3WL9B 1CT8A 5FYJU 2DM4A 2E5EA 3KPOB 3MOQA 3FAXA 3QIWD 5DD6A 3HC3H 1QBLL 4GAFB 5BVJB 4M1DH 1HILA 4R96A 1ZLVH 3SE9H 3SKMB 8FABA 1IAIL 4HUMB 4X7FC 2BRQA 4GAYA 2VUYA 5I1DA 5F7DA 2FX9L 4FMKA 3QWOA 4HIHB 1AR2A 3MNZB 3W11D 1ZA3A 5ADPH 3JVGA 2O5XL 4YFLF 5F44A 1J8HE 3LKSA 5CUSH 4NRZB 1EO8L 3BPLB 4LKXB 4P5KB 4UT6L 1K6QH 5SWSB 1RZ8A 3QI9D 2JJSC 4DVRL 5GZND 1VFBB 5KTEH 1CXIA 5EIQA 1PYWA 1MHCA 2BOCA 5HJ3B 1IT9L 1MCLA 1HNFA 1PG7X 4OLWL 4XH2A 2AW2A 3QDGE 4YUEL 1HOCB 3QDMB 4RZCB 2EEAA 4ETYA 1UADC 4ZXBA 3O6KL 1MHHA 4LASL 1DBBH 2YPLB 2ORBL 3FTGB 3TLRA 1RIHH 3LEXB 2FRGP 1NAKH 2OBGA 3ROLA 3MXWL 4M7JH 1FORL 5I8EB 3D0LB 1UG9A 1UH2A 4MYWB 3L5XL 5BO1L 1X5GA 4HIEB 5HHOE 1ZA6A 1W0WB 2EEBA 1S9WA 4KI5E 1UEYA 2WUCH 3LRHA 1J18A 3IKCB 3NCFB 4QNPF 1UM5H 4AEIL 1DEEA 2W65B 1FLRL 3EO1A 3Q1SH 4U1JA 5FB8A 1D5MB 5LGJB 4X6BA 5JR1L 3UO1L 3RNKA 5KVMC 3I3DA 2J1KA 1A02N 2JCCA 3CPLA 4U31A 2VKXA 3RWJB 5E2WH 2YD3A 4Z78B 5M95B 4DKEL 3IFLH 4NCC2 3H3PL 4XP4H 3BN9D 5C3TA 3RIAF 3BH8B 2ZOKA 5FK9A 3N9GL 4ODVL 3EDEA 1J05B 3IDMB 5HGGS 3WUWA 5F1NA 2XN9D 1CFSA 4W6XB 3Q6FB 4BA8A 2V17L 3CXDL 4OV5B 4UIMA 2I26N 1P9MA 5DJAB 4XB7A 2APFA 3V7AG 3CVHB 3VWKB 2YA1A 3LSOB 1B0WA 1RUAL 4HT1L 5TDNA 1ZLWH 4HLJA 4HWZB 1BF8A 1T7ZA 4KHTL 5GGRA 4HWNA 2OJZH 4PLOB 1FNEA 5C9JA 4KJYB 3CFBA 3KYNB 3D0VA 2JKXA 3D2UA 2YUVA 4HS6B 1EO5A 3EGSA 3HB3D 4NKOB 4KK6D 1BQLL 1FYTA 5HYEA 1MCCA 2F5BL 3WO3B 1FP5A 3I6KA 2DDQH 5IFHH 5GHWL 3BW9B 4XCFH 4ZNCD 2GAZB 1X5HA 2YS4A 3ARTA 4MD5B 5AUMA 5IHUH 4LLDA 5M94B 2NY0D 4LBEA 3ZL4L 4K7PL 1BJ1H 5DHVB 4GG6A 1J8HB 1AIFB 2P46B 2B1AL 3G6DH 4W68A 1MI5A 2CUHA 5EBLA 1HSAA 3BQUA 4X0KA 3HR5A 4HV8A 2ESVE 2X1WL 4X98A 4LPUA 3SO3B 2DTMH 5GSVB 4GKSB 4PG9A 5CMAA 4U3HA 1UB6B 4JFXB 1IBGL 3QDGB 1QEWA 3S96A 2VOTA 3B9DA 4FQ1L 4WFHE 2OZ4H 3S36H 2B2XH 4NC1C 1L0YA 5DJYA 4NO0A 1IGYB 5JLZA 5HHOB 2W60B 4BFIB 4BH7B 2X1XR 4WFGD 1CGSL 1FLTX 3LD8C 4FQJH 4UINL 3ROOA 1MREH 1IEBB 3GGWA 5F9JB 1GZQA 1YJDL 4N8VB 2SEBB 1B88A 4ONGL 5JW5B 4JDVA 1R24A 1T4KA 4S2SB 3TYGH 3GEWB 1LGVA 3QUXC 4ZS7L 3ZYOA 2H26A 3ULVH 1H3WM 3ULVF 1WZ1L 3S88L 2ZP0T 4XCYB 4XTRC 5CZXD 5D5MA 4NJAH 1IZKA 3HAEA 4PY7B 4JANB 4MA8H 5E2TL 1KEGL 2YSSB 3ARFB 5KVGH 2D4FA 5FHAL 3IU3A 1FGVL 4DKAA 1T1YA 1P5UA 1BD2D 1MVFA 1X4ZA 3QHZH 5J6GB 4S1DD 1QSFD 3DVFA 2NX5D 1TJIL 4JHAL 3NGBC 5FUCC 3WFCH 5C0RH 3RTQA 5DHYB 2B39A 5H8DA 5HHME 4I2XE 4L3CB 3VA6A 1CDJA 5DR5L 2VZOA 1J1PL 2DI8A 3RY6A 5TH2B 5TF0A 1P84J 2J2ZA 1OARL 1ZS8B 4ZUVA 4J3UA 4PFEA 1KXVC 1Z9SA 3O9WB 3LS5L 4QHMB 3CVIL 2XKNA 1U9KA 2BVTA 3OKNA 5CBEA 5DEFA 5ISZA 3GRWL 4V2BA 1PLGH 3MGTB 4PJXE 1G7LB 4QYOB 2AXFA 5DMGD 3IJHB 2CXGA 3JXAA 1NCCL 5EZLA 3D69A 2NY1B 1KPRB 4QEGA 3EJYD 2L4OA 5IQ9A 2XTJC 3ET9F 3KWWB 3RL1B 2ESVB 5J56B 5C0AE 1FBIH 3G5VB 5D7SL 1Q1JH 4XNMA 1HH9B 1EV2E 3OG4B 4JREB 1M4KA 3V5KA 2F15A 5MHSE 1MY7A 2AJVH 4Q58C 4ERSH 5F9DC 1X5YA 2A83A 4XP5L 1T7YA 4OI7A 1H3TA 3F58H 2IPUG 3ULUH 1TQBB 5LXGL 2ZCHH 2VABB 5FGRA 5T5NF 1JL8A 2VLRD 1ZVSB 4XBPA 3ILQD 4M48L 3F7QA 4M6NL 4GUPB 4N5UA 4ZPTB 1MEXL 5DJ6A 3HPLA 3X3GH 1J7VR 2BVQA 3QFJD 3RVUC 3L3HB 2Y6SD 1Z9MA 3JWDH 3WEXB 3C5ZC 3G08B 3LN5A 5IROA 2AXGB 3QO1B 4HC1L 2YD4A 2XZCH 1S3KH 3L3GB 3O8XC 1DSFH 4YDLB 4JFFD 1S9XB 2X70A 2AJSH 4YHNB 1JVKA 1KXTB 3OKEB 2D9CA 3VRLE 1G0DA 1W72B 4JM2D 2EH7H 3MRJA 4YC2C 1XF4A 3E8UL 2V9RA 1BQSA 1GZPB 3EYFA 4PRIE 2PXYB 3SKOA 1I1RA 1VHPA 2OTUB 5KSUB 2PNDA 1EEQA 3TZVB 4A6YH 1NGPL 5JIHA 3OJDA 3CCHB 3SDAD 1WITA 3X3FL 1Q0XH 3F7YB 1YPZE 3CH1B 1IM9A 4WWID 3QQ4B 3W9DB 3RUGF 5LAXA 3PWJB 1QQDB 4RIRB 5DD3H 5HHMB 4I2XB 3FFCA 5TF1L 3CMOL 2J7LA 2VLKE 4KRPB 5DZNA 43C9A 2X4RB 3W2DL 3FOMB 3RL2A 1G7PB 1SY6L 2H2SD 4H1LG 4LQFL 2J88H 4PGZA 1XR9A 5CZVH 4PJBE 1S7WB 1KENL 4TOYH 1CFBA 3KVQA 2CKBL 1N6VA 1PQZB 5BZWA 1S7XB 3U6RB 2X7LB 3BO8B 5DRXB 5F7YC 1J87A 4PJXB 2IAMC 4YHMH 3T0EC 4U1MA 1C1EH 1OGTB 3WN5A 4KK9C 3MGOA 1FVEA 1A9BA 1OP3K 5DJDA 4FTVD 5IVXF 3GMLA 3DARA 5B3NA 3Q2CA 3DI2B 5C0AB 1YEIH 1I3VA 2I07A 3ARQA 4PV9A 5EU3A 2R56H 4K07A 5T3XH 5CJOL 4AG4H 2UY6A 3IJYA 3HZMA 3Q6GL 3V6ZA 5DUBA 2Z93A 4QOKE 3OX8A 3DX7B 5FCUH 3AVEA 4ODTL 1DANU 4PJ9C 4RFNB 1GYAA 3S35X 2Q6WA 3S4SG 1MHEA 1OAZL 2CJUH 5J12C 4NQEA 4YHOH 5CWSA 1FJ1A 5IUSA 4WHYH 2IBBA 4FQXB 4F2MB 1MCHA 2EO1A 2CGRL 1QFHA 3VD3A 3C8KA 3K2UL 3PWLA 2CQVA 1ZT1A 1ADQA 4CW1A 4APQD 1BLNB 1UWEL 2PYFA 2E7LA 2IPKA 4LHUB 1UVQA 3TT1H 3C2SA 2XOTA 2ZUVA 3L3KB 4CU8A 3H9HA 4NWUH 2JELH 4GRLB 1RZJC 5F1OB 3QUZB 4XC1H 1CE6A 3HC3L 4PRIB 2OTWB 4M1DL 5I8CA 4P2QE 2UWEE 3QUYD 2E9WA 5FO8A 2WWMC 5EU5B 3QEHB 1JJUA 3TNMA 4M3KB 3EHBD 5ADOH 4C56A 1SMOA 4EI6B 1YPZB 3NTCL 5ESAA 4XVJH 1Z9LA 4ZD3L 3B5HA 4HK0A 3LEYH 3D48R 5CUSL 4GBXD 5I18L 3VFNB 3RBGA 4LCYB 1BZ9B 5F97E 3N1GC 2VLKB 4RAVB 3FO0H 3ZE0E 1K6QL 3ILPA 3RGVA 2EZ0C 3A67H 4WU5B 2R23A 1OGAA 3RZCC 1QLEH 5GPRA 5C9KA 5EU6A 1NAMA 4PJ7E 4B0MM 4PJBB 4LU5H 3QIUC 3BOVA 3MNVA 1ZHBB 4NQDD 1RZGB 2AXJA 1OTSC 3FQRA 4RFEA 3BRDA 1JUFB 1NANH 4J6RL 3QG7H 5DVLA 4OGYL 1B2WH 1RIHL 4I18C 1NAKL 3GSOB 4KC3B 1AQDB 2EDOA 2ITDB 1A4KA 5D2NE 5D7KD 3KPRD 3TVMC 1EHNA 2XN9E 3VW3H 1E0OB 1HE7A 1UM5L 3EYVB 3U30C 3RFZC 3CSGA 2P43B 4F33B 1LQSR 4ZPVA 5KS9E 5KJRL 3WNPA 1I9JH 5E2JA 4EKXA 3IDNB 5DI8B 3LKRA 3BWUC 3MBED 4NUGL 2C7UB 4QOKB 5JZ7C 4MXWH 1N0XH 2H32H 3P9WB 4LVNC 3QAZB 3IB4A 4XP4L 5IW1B 1RULH 5HGHA 4BKLB 3E0GA 3H9ZA 3QQ9D 1U8NA 2IFGA 2Z31A 4G43B 3HUJE 3IAGC 5GZOD 1JGDB 1F90H 4K7FB 5CEXB 1OY3B 4NZRH 5E94A 3VGEA 3NIDF 4WW1A 1L6ZA 3QZWB 1GL4B 1WFNA 1Y0LA 4DGVH 4KGLA 5FYJD 3K2MC 4XXDB 5F1IB 1TZIA 3T4YA 2XZQH 1QHOA 4MWFA 4WIQA 2P8LA 1J0JA 1RJZA 2UZYB 1MUJA 3MCKB 3O6FA 1HXYB 5F88A 5HPOA 4JN2B 3QI9B 1JZ5A 4PGDB 2NW3B 4YFLI 2BNRD 2VRAA 4J8RB 3N85H 1LO5B 1X5AA 2AV7A 4UNTA 4P2QB 1FZKA 1U3HC 2CKNA 4JRXD 1H3UA 1J0ZA 3VD9A 4XI5C 5IFHL 1LO0H 4HUUA 4ZYKA 1JF1A 3C8HA 3V4VH 3F6IA 1NQBA 4LDEB 5GQBA 3IXTA 3RKPA 1AC6A 3B43A 1MFAH 4EI5D 3N1QC 2EE3A 3MRFA 3D85A 5EA0H 4FFVC 3G6DL 4U1LB 2YOCA 4JZJC 4M02A 5EO9A 2PTTB 5C8JA 3BRGC 1SJHB 3ALXA 3PGFL 4LAQH 1B0GA 5MP6H 3WHE0 4KUZL 3MLZL 4OAWB 5HGDA 5E8NB 5I1JH 1OW0A 2VAAB 3KHQA 2JB6B 3TBSA 1WZKA 2Y7QA 3VD5A 3PXHA 2DTML 3MA9H 4K7PX 3CSYB 3CZFB 3MV7E 3QG6B 4PJ7B 4GRMA 1A6TA 5DO2C 1KV3A 5DFVD 3V4PH 3ULVD 2UYLB 3MO1B 2HVKB 2Y36L 2JJVA 4PB0L 5FM5M 5IJVA 4DQOH 2OZ4L 3NCEB 5DS8B 1BIIA 2B2XL 4MDJB 1P2CA 3BP7B 3KJ6H 5HY9A 3L3IB 4M4PA 5AAMA 4NUJA 4J4PC 1TZGH 5D2NB 4U1HB 2FX8H 2HVJB 2XN9B 2V7NB 2OMNA 2AEPH 3ZHKA 4FQJL 3MLYL 3SKNB 4JDZB 1GGIH 1BD2E 1MREL 3G9VA 3JV6B 4H5SA 4U1SB 5F89B 1N4XH 2FO4B 5KS9B 1A7OH 4N0UA 1QSFE 3VE0A 3NIFF 4Z77B 3SE8L 4ZQKA 2NX5E 2G75B 4L8DB 2AXHA 3TYGL 1B4JH 1FV1A 2X4SB 3CGTA 3TPUB 2HYMA 2E8YA 4P9HC 4I5BB 5F9WC 2Q7NA 3FAWA 1JN6B 3BVNB 3QEGL 4JFOA 2V2WB 1FNGB 3L3OA 5FEBA 3ULVL 1AXTH 1O5DT 3UYRH 4I0PC 1QLFA 4XPTH 4NJAL 3AXLA 3C09C 3EJZD 3HUJB 3T0AA 3PWPE 4OJFH 5F7KC 3AROA 3LVEA 4MA8L 1CLZH 5CP7A 4M7LT 1NGWA 5I17A 5KVGL 3MGAA 4YX2H 3ARUA 1XCQA 2VIRA 4ZDHA 1KJ3H 2EYSA 3QHZL 1OSPH 3H9SD 1ES0B 4LP4A 5EPMB 3MLPA 1TCRA 4JQIL 2D0FA 3IDIA 1N5AA 2ERJC 2XWBB 5D9SB 5GGRY 5C0RL 3DRQB 5EFIA 2QADB 2JJTC 1JBJA 3QR2A 4OIAA 3G5XB 3ZKNC 5HYJA 1WWWX 3WS3B 5B38G 2XKSA 1IM3A 1FZMA 4HUXA 2R69H 4NIKB 3P11H 5HI3D 4C55A 4YNYA 3EFFA 5HI5C 1QNZH 4EVNA 2MWCA 1VCAA 4JO2H 4KQ4H 1YMMA 3TO2A 3U79A 2WBJB 1NCNA 5E8PB 3ULSB 5FGSA 1QBML 1PLGL 4MQTB 4N5ED 4DN3L 4KKBC 4FHBD 1UXSB 2VLRE 2HRLA 4GRWH 3CMGA 4C58B 3LQZB 4WJ5B 1HNGA 3QFJE 4P49A 2D0HA 4PBVC 1MLCA 3IRPX 3NAAH 4JFDD 3GMMA 4JRYD 5EWIH 5D1ZC 6FABL 3RGHA 3MV7B 2XZZA 2AJVL 5JQHC 3T1FA 1C12A 2ATPB 4JFFE 1ZLSH 4TVPH 1I8MB 1HHKB 4ERSL 2FWOA 1C5BH 1ETZB 1Q9LA 1KIPB 3A6OA 1I85C 4JE4B 5CGYC 3ULUL 3D87B 5DZLA 3MOBL 5JIKA 2NR6D 1CFNB 1CQYA 3IDYC 2AABL 1L9NA 1LK2A 2OL3H 3DRTB 5IFJA 1WC7B 3HMXH 3X3GL 3C5SA 4H1LH 4YHZL 3MUY1 5C08E 1BD2B 4EBQH 5HYFA 3EYSH 2ZG1A 1QSFB 4GFTB 1UXWA 2NX5B 5C0CD 32C2B 2IBZX 2XFXA 1DSFL 2I9LA 2IH3B 1U8OB 3LHPL 4K8RD 2VN4A 1YNLL 1CWVA 4NO5B 4KQ3H 4XT1C 3VDBA 1D5ZB 1FL3A 2EH7L 4JZOA 5E95B 3C6LA 2CPCA 2ZWLT 4M3JA 3TWCH 3PWPB 5ENWB 4LVHC 1KTLB 4PJEF 4N0FB 1D6EA 4JQVC 3V4UH 4A6YL 4L29B 1UZ8A 1AE6H 2N4IA 1Q0XL 4NYLB 5ID1B 3OJMB 12E8H 2KKQA 2X4QA 1ZWIB 1I9EA 4K55A 5J9PA 3W81A 4QHKI 4FFWC 4XBEL 1C8PA 3MLWH 1V7MH 5DD3L 2GJJA 1TTFA 4Z76A 1G7MB 2P45B 4PGBA 4Z9KB 3DX8A 4ZNEE 3SKJH 5DURD 5GIRA 1KTDA 2BDNL 1AKJB 3T2PA 1IRAY 1KIRA 2J88L 3MACH 5CZVL 2FECL 4TOYL 3TV3H 4PD4J 4EOWL 2W9EH 4L1HA 3LOWA 4W4OA 3VGAB 3AFLA 4BQ6A 3VFPB 4OZ4B 1X5JA 5ANME 5HPMB 2DL2A 5SWZD 4QHLB 1INEH 5FV2A 3BUYB 2VLRB 4YHML 4GW4B 3D39E 1BVKA 1KT2A 3W9EA 3MC0A 5D96B 1PBYA 2XQYK 5D70H 4GG8B 5GS1A 4ETQB 3QFJB 4ZO8A 3QQNA 1AO7D 4OTXH 4S1QH 1BWWA 5DQDH 1MLBA 2QLVB 4XHQA 2R56L 1NEZG 5FO7A 4AG4L 4MAYA 5F6IB 4K23H 1NDMA 4LPTA 3LKNB 4JFFB 4OD2B 5EU4B 4MSWA 3F7RA 3NPSC 5DJ8A 3PDGA 3SGEI 4BH8A 2CDEB 5F7WC 5FCUL 1NPUA 2P5ED 3R0NA 4JM2B 2IQAB 1G9MH 1BJMA 1RHHA 2CKBB 1U8HB 5ERWA 4QRQA 5JO5A 3KS0J 1QRKA 4IRSB 4EUPG 4PTTB 4YHOL 2I25N 4J1UB 4YR6A 2FEDC 2CDGA 4MNHB 4U7MA 2NYYD 2ZNXA 5C6TH 4BZ1H 4C59B 3RWCB 3VFTA 5C08B 3SN6N 2ARWA 5BQ7B 1JNJA 1FSKC 1CDBA 2CIKB 4GG6F 1NUFA 3FOLB 2OQJB 1U2HA 3K81A 1RZKH 4GKOA 4M93C 3VFGH 5B39G 1F2XK 4Z7UA 3TT1L 5I66A 3GO1H 4KRNA 2DM2A 2EC9U 2J6EH 1D9KB 1XGPA 3SEPA 4Y16B 5GS0C 3QHFH 3V0AC 4YAQA 1EFXB 2BVOB 4MGXA 1N8ZA 4PJGE 2KDGA 3D18B 3NABH 4X4YB 2CSPA 3LB6D 2VDQH 4PLJC 2BSRB 4TUJB 2VITB 4PV8A 5ADOL 3KJ4B 4JPKL 5MEPA 3MRQA 3MA7B 2A2QT 5JNYA 3SDDA 5D7KE 4QHUA 3KPRE 1T5WA 4I8DA 4WI8A 2E9IA 2P24A 4IM8A 5IB1B 5EO1A 3EJJX 3TN0C 3FO0L 1F6FB 4I4WB 1WIUA 4DFHA 1YMHB 4LCUB 1HQRB 4NN7C 2B5IC 3DV6B 4S10A 5T5NG 4HAFA 2A0LD 4LU5L 4KTEH 2AK4A 4JCMA 4MCYA 5KG9B 2RJMA 1ORQB 5D5MF 5K93A 4GW5B 4Y19A 5K9OB 2XKUA 1B2WL 5ANMB 4F7PB 3HAEH 3SKMA 3MRDB 4N9OB 3PV6A 3JUYA 3VCLB 1KLGA 1MFDH 4OCXL 3D39B 3HRZB 3AS3A 2FD6L 4HIHA 3CDGB 3VW3L 2G5RA 2M26A 1OT2A 2P7TB 1JMXA 3ZKXC 3QSKB 4R4BB 5I0ZA 4LKXA 4P5KA 4APQB 4HF5L 1RJLA 4HGKC 3D6GA 2VERN 5MI0C 5IBUB 1RFDH 1FZJB 1S9YB 1SBBA 4IIQB 4HS8H 4MXWL 1VFBA 5JA9A 2CRZA 2XA3A 1U8PA 2YK1H 1I7UB 2BNRE 4LLVB 5B38B 3MLSH 2FO1A 1IEAB 1HOCA 3QDMA 1KPVB 2DOCA 4JRXE 5BRZA 2YPLA 1RIVH 3QUYB 4K3HA 1A7RH 1PKQA 2FJHA 3LEXA 4NBYB 4ZODA 1WWAX 4NZRL 1BFSA 5FKPA 1AQKH 4YIQA 1K4CB 4LPCA 2BK8A 3B8YA 5F8RC 4B41A 2YKLH 2XZQL 3OGCA 4QY8A 4O2EA 3FL7A 4D9LL 3FFDA 4ONFH 3EYOA 1EEZA 4Y7MA 1A6ZA 4OM0H 4RGMC 5B4MD 2C26A 1D5MA 4K94C 4MJIE 1QR1B 2C3HA 2IAMA 3EO0B 1FH5H 4OGZA 1OT1A 3S7GA 4DZ8A 1JYXA 4R4ND 5A3IC 2P1YA 4ODUB 5F9OH 4Z78A 2VLJA 3VMPA 3ULVE 3KPQA 1F4XL 1HWGB 1LO0L 2A6JA 4B53A 5T33H 4U3XA 3V4VL 1YN7A 4N0YH 5IB3A 2BNQD 4XRCB 4QWWC 1T1ZB 4P57B 1CXFA 3Q6FA 5F1KC 3RVWD 1KJMB 3KPRB 3V7MA 1IFHH 5EA0L 2WP3T 3O3EB 5CHNA 4LAQL 3M8OH 1CXEA 4Y4FC 3V6OE 3Q48A 4GQPH 1BJ1J 5I1JL 2DI9A 4K9EH 4PJ9A 4Y5VB 1IGCH 3MA9L 3QJHA 5D7LE 1BVLB 1XIWD 2EECA 3E3QC 5TDPB 3V4PL 4BSVA 1A7BA 3MBEB 4JGUA 1AJ7H 4RWYL 1BJ8A 5JUEH 4LRIA 5KZCD 4FG6D 4NKOA 2VN7A 1KCRL 4XPGH 1AGDA 4DQOL 1PX4A 3PE9A 4XPFL 3WFDL 1UCBH 3OSKA 3BW9A 1T2XA 1TZGL 4DUXA 2ZUQC 2FX8L 2GAZA 4HXAH 4IOFD 4BQBA 4MD5A 3F5WB 5F3HB 4QRSA 5DRNB 1JHKL 3LQAH 2AEPL 2NZ9C 3TA3C 2C4FU 2DLEA 2IMMA 3EZ8A 5D1XC 4FXKB 4UBDC 5LGHL 5DHVA 1J8HA 1N4XL 3H9SE 3S36X 1AIFA 2H1PH 2I5YH 2ZSVB 1MRCH 5DFTA 4FOMA 1A3RH 2YD2A 3BIBX 4XNZC 1WUNT 4XMKH 4R97B 1ACZA 4KROB 2AJXL 4GKSA 5I15L 2OTPA 4FQHB 1AXTL 5F7MC 3QDJD 3RIFK 1WICA 2BNRB 5ETUA 1UB6A 1YEKH 4JFXA 3UYRL 4MZ2A 3QDGA 5GGSB 1UKQA 1IEHA 4JRXB 1MQKH 3RNQB 1CLZL 1CLYH 3ULUE 3DUHA 3GHBH 2VE6A 4Y4HC 2J5LB 2VAJA 5HHOA 4BFIA 1I7TB 4BH7A 4NFCA 1OSPL 4EI5B 3EOAB 4U3CA 3RZCA 5IJKC 4K71C 3PWNB 4L3ED 2EDEA 3FQWA 2A9MH 4UILH 3NACL 1LVEA 3DBXB 3QIUA 3MUHL 1RZIB 5JW5A 2SEBA 4FQPA 4MJIB 4BK5A 4I18A 3NCCB 3BHBB 5I74C 1T2JA 3BI9X 4JRYE 2R69L 4FXGA 4FS0A 3MRGA 2PYED 1KCUH 3V52H 1QNZL 3CAFA 4HWBA 1NEZB 5F8QC 4AH2B 4JO2L 3BGMB 4JLRB 1KCVH 4OKDA 4PY7A 4WNQA 4NKMA 4PJIE 2XG4A 1X7QB 1P7KB 3QFDA 4XNUH 5IM7A 2CO6B 2R4RH 3C08L 2DYPB 4LLMB 4ZAKB 2OR8A 3G5ZA 2WK2A 1E6OL 3NAAL 3TYFB 5DHYA 5EWIL 1UGNA 2DJUA 5C0CE 4L3CA 4GQ9H 1FPTL 2YXMA 5BJTB 4TVPL 2HG5B 2XY1A 1C5BL 4LNRB 3MRRB 2QR0A 3QXUA 1VESA 4ZXBD 1EGJA 1EJOH 1IQDA 2N56A 2R4SL 4QHMA 1T1XB 2COQA 2GFBA 5D4QA 1I3GH 1U0QA 3GSNA 2OL3L 2Q8AL 2IJ0C 3C5JB 5KSAC 5TGBB 3HS0B 3L7EB 1MVUA 3MGTA 1JPSH 3LEVL 4QYOA 3IJHA 3EYSL 3H9SB 2CK0H 2LTQB 2EYRA 3L7FB 1EBPA 1U3HA 4JPIB 3P4OB 2XG5A 3RL1A 2ESVA 1LDSA 1MCRA 4OZFA 1QFUH 4P99A 1A4JA 1HH9A 3QDHA 3M07A 3FO9B 5I75C 1N2RA 5DC9B 2EXYD 5JXEC 2LAAA 3OKYA 4WTWA 3TWCL 4DKFH 3BPNB 1DQJB 3QA3B 2Q1EA 3V4UL 3WFEL 3TO4A 4JHZA 4X9BA 3MRLB 2DQUH 3GIZH 2D31B 4YHYB 1CCZA 4LFHD 2JK5B 1NFDE 3ZE2F 3RBSA 4DAGH 1R0AL 4KKAD 4ZPTA 12E8L 3ARXA 3PL6C 3DUSB 2JLLA 3MLWL 1V7ML 2XZAH 1S7VA 2VDPH 3HLAB 1AO7E 2V9TA 2AXGA 3QO1A 1VGEH 3SJVA 4EUPH 4JRYB 3SKJL 2A1WL 5IR1A 2PTVA 3FN9A 4HD9A 1XGRB 3NZ8B 3D2UD 3QWRA 3KPLB 1DQDH 4OLXH 1FYTD 4OCRH 3TV3L 1W72A 3DMMC 5IGXH 4QF1A 2W9EL 4LAJH 1GZPA 1MCBA 3DVNB 2EIBA 3H8NA 2OTUA 1INEL 1OQOA 4A6YB 1G7JB 4PJIB 5FECA 1M6OB 4XMPH 3BPCB 4Y2DC 5I9QC 5ESVA 3F7YA 5D70L 3QUMA 3CH1A 3STLB 4ISVA 4U1GB 5ACZA 5I30H 1HYSC 1JF6A 1YEDA 4OQTH 1MI5D 4OTXL 4S1QL 3QQ4A 4LGRB 3GMRB 1ZHLB 3PWJA 3AU1B 3H6JA 4RIRA 5DQDL 3T0XA 2E6PA 2NXYB 3BQUD 3G9AB 4YPGB 3NCYP 5C0CB 4I2XA 4LLWA 2Q86B 3KPSE 1NLDH 2GTWB 1HZHH 3DURB 4XNYL 3FOMA 3LKPA 1G7PA 4D9QD 4HQQH 4X9GA 5IB2B 3HNVH 3OKMB 4CNIB 1G9ML 1S7WA 4M43L 3UJTH 2VLLB 2NY4C 5EO0B 1BIHA 2Q76B 1PQZA 5D7JC 4XC3H 2X7LA 4NO0D 3BO8A 4LLUB 3TCXA 1K8DA 2JJTA 2G60L 4PJXA 2KPNA 3P30H 1C7SA 4BZ1L 5C6TL 1YYMH 5B21A 3KPPB 1HQ4A 3U0PB 4H0IA 4ZUTB 2GK0B 4OV6F 3IFOB 1QBAA 2OR7A 5C0AA 3GO1L 2BJMH 1T21B 3RKDC 2DN7A 1VACB 3QHFL 5DURB 3S9DB 2Y5TA 3HZYB 3RWEB 1A6PA 2EYTB 3NABL 3P73B 2DQEL 1WAAA 4CDHA 25C8H 3N1FC 5CGTA 3BPLC 5A2JH 4BQ8A 4FZEL 1NFDB 4YXHH 1BOGB 2J4WH 3LZFH 3NIDE 1YNTA 2QQLH 4NN6C 3SE4C 5J1SC 1ONQB 4XGZB 4YXLH 3PHQA 3RTQD 2Y1VA 4Q9QH 1AO7B 3SGKA 1I85A 3BXNA 2EDLA 4TTDD 1BLNA 1P1ZA 3GSRB 1RUKH 4LHUA 3R06B 4MMXC 4NN5B 1OAYH 2XT1B 3L3KA 3RWDB 1OSZA 4JG0L 4KTEL 2BCKA 4PJHE 1F97A 1DUYB 1GGBH 1CZ8L 3FT4A 4LLQB 4PRIA 2OTWA 3ABZA 4OF7A 1KC5H 2V7HB 5EU5A 1WWBX 2FX7H 4I48B 1B6DA 2L7JA 3EYUL 3FQXA 4EI6A 2ZSWB 3TBTA 3NH7L 3L5JA 3UC0H 1Q9KA 3SDCB 3CX5K 4RMQA 4LCYA 3P4LA 3KPSB 5GJTH 1C5CL 4JQVA 1RFDL 4KK5D 5IK3B 3VFRB 1DFBH 3OQ3B 4DKDC 5CP3H 5GJSL 3TIDB 1K4DA 3HI1B 4H8WL 2ADIB 1VFAA 4KXZI 1EO7A 1NBVH 1ZHBA 3EZJB 1RZGA 3MLSL 3AREC 3O41B 2HT3D 4NKDB 1RIVL 1DQMH 3PWUB 3JTTB 2F74A 3GSOA 3VWKC 4JFZH 3BKYH 4NC0B 2CIIB 2X4TB 5J1AA 1AQDA 4R3SB 2I60H 1AQKL 1A5FH 1BFTA 2YKLL 5DK0A 2XV6B 4Z7WF 4YBHA 4ONFL 1UKTA 3EYVA 3RY5A 5J06A 4AENB 4MCZA 5L8KB 5C2BL 4OM0L 4HH8A 3NIFE 1L0XA 3UTSA 5E1AA 4QXWA 5DI8A 1FH5L 1CGWA 1TTUA 5IHBA 3F12A 2C7UA 4QOKA 2H32B 1UJ3A 4H88L 3WUWG 3FQNB 3GJFH 2EKSB 2A9NH 3O11B 2CR3A 4MVBC 5T33L 3SDXA 1NDGB 4OIBA 1CICC 4LFHG 4U49A 1M7IA 4N0YL 2VB5A 4G43A 5C0FA 3DSNA 4K7FA 2AJYH 3BEVA 1OP9A 5I1AB 3CLFH 2CLRA 1IM9D 2C9AA 3CK0H 4O02H 3B5TA 5C0DA 4NQVA 4XXDA 3UTPD 1EX0A 5F1IA 1EA9C 3M8OL 1Y6KR 1HKFA 1AHWB 4IDLA 2ADJB 3FFCD 3L3DB 4N0RA 5E08H 4IHOB 4K9EL 3L9RA 1DVFB 2Q20A 1ZTXH 1NCWH 2VISA 1EMTH 1HXYA 2YPKB 4JN2A 3UAJD 1MAKA 2GT9B 1AJ7L 1YUHA 5JUEL 4PJHB 3KG5A 4P5TC 3HMWH 4XPGL 1LO5A 4P2QA 4I3SH 3QDJE 2UWEA 3EDKA 2HFGH 1WISA 1UCBL 1S7SA 2K7PA 1FNSL 4UIKH 3PF2A 2ZOLB 3WFBL 4M61B 4NPYB 1U8MA 1HH6B 2A73B 2EDFA 4GRWE 1SMAA 4JAMA 3BGAA 5EU7C 2H1PL 2C3VB 2I5YL 4OFPA 1WGOA 1S7TA 4TUKH 3AUVA 1SJHA 1QFWI 1MCPH 2FL5A 3SPVA 1MRCL 5ICXB 4X6FB 1RMFH 2IPTL 5IBLD 5DJZA 1A3RL 2JB6A 3KNBB 1NJ9B 3CSYA 3QG6A 3ARGA 3MV9E 4PJ7A 1YEKL 4LMQI 4TVPE 2PYEE 2HVKA 3PABA 4QXTB 3RIFF 1AGCA 5EZIL 1CF8H 4F15C 2ED7A 3TJHD 5FF6B 2AJ3B 3GHBL 3L3IA 4XPBL 4G6JH 4NQED 4ZFFA 1NFIB 3T04D 4LQ1A 1MFEH 2V7NA 4GXUN 4U05A 1ZHKA 2HMID 3FQTA 3PDDA 4X99A 5GS3A 3SKNA 5KVDL 1T66D 3JV6A 4KY1H 3TF7C 1KB5H 2FO4A 1T83C 3O9WC 3T3MF 3I3EA 4Z77A 2QSQA 2G75A 2X4SA 4WUKH 4FABH 2OMBA 1CGTA 3TPUA 2DICA 1XIWB 1KCUL 3V52L 4FMFA 1MJJA 1KG0A 3JV5A 2V2WA 1FNGA 3QO0B 5KZCB 5CS7A 2PW1B 1F11B 1KCVL 3ARZA 5E00B 2DS4A 4PJEE 5A43C 4C56D 1SQ2N 5GRVL 1E4JA 3RWFB 3H42H 4CMHC 4XNUL 4Q6IB 4KJPD 2FATH 4PP2B 5TQ0H 1N64H 2R4RL 5EPMA 1ES0A 2Z92A 1R3KB 3MV01 5D9SA 4WHCA 3RVTD 3E6HA 4E42B 1JI1A 4Z7UF 3RGVD 1CI5A 4GQ9L 4L9DA 1OGAD 2MHAB 3VRIA 3OXRB 1TQCC 2A6DB 5EU6D 5DK2A 2O5ZH 4C83B 1N59B 3PWVB 4HK3J 5CIPH 2FZ3B 3OZ9H 4GSDH 1RZFH 3UJJH 4NZTH 1DR9A 1CD0A 1KLFA 3QDJB 3QPQC 3SGDI 5LKNA 3CIQA 5TJWK 2ZUWA 15C8L 4XNXH 2A6IB 2WBJA 1GRWA 2ICEB 5E4IA 2Y07H 1T0NB 1YEFL 1JPSL 3MXVH 4AZ8A 5EDXA 2XA8H 4GRWB 4JHBA 4ORGB 4O2CA 4UV4H 5HDLA 3U7YL 5IT2H 2HRPH 4A2LA 4F9LC 3WO4B 2G2RA 3HZVA 1PJ9A 4R0LC 3ZDZE 4LOUD 2PXYC 1QFUL 1RAMA 3MV7A 2DLIA 3MV9B 3TZVC 1NAML 3G04B 4I0CC 2ATPA 1I8MA 5DRWB 2PYEB 1CT8B 1ETZA 4HJGA 1KIPA 3SBWC 1FYTE 2Z31D 4R96B 3ZHLA 4KJWC 8FABB 1PY4A 4CDGC 3KAAA 2DQUL 3GIZL 2OL3B 4ODXB 5I1DB 1NC4A 4OI8A 4O9HH 1FAKT 2X10A 4E41D 3VWJC 3D5OF 3T2OA 1NCBH 4WI5A 1T89C 1CIDA 1I9RH 2YRPA 4WW2C 4GG6E 3LKSB 2VDPL 2DKMA 3C60B 4M5ZH 1MOEA 3O6FD 4MB4A 2VQ1A 1VGEL 4WFFE 2VZSA 4I0KA 2ATKB 2IH3A 4KTDH 1RZ8B 3O4LE 1DQDL 2P49B 1I8KA 1PYWB 2BOCB 2LQRA 4NO5A 1EAJA 5IGXL 3PGCA 2X1PA 3BT2H 2AK1H 4ZXBB 3PWPA 1YEEH 4HJ0D 3GMOB 1MHHB 3KPNB 5ENWA 1KTLA 1I1AD 2W0PA 4PJEB 1JWUA 3K1KC 4LIQH 4N0FA 2QL1A 4WGVB 4XXCA 4XMPL 4G6AC 2VXUH 1DEDA 1JF5A 2BVPB 4FA8A 3R8QA 5F96H 4M5YH 4Z18A 5ID1A 3D85D 3D1MC 1S9WB 5I30L 3ARYA 3JUZA 5ALBH 1A21A 1DEEB 5SV4A 2YMXH 1MCWM 1MCWW 5FB8B 2BC4A 3QCUL 3FJTA 1T04B 2BXYA 3RNKB 1DBAH 4UOW0 3TFKC 4EIGB 1WWCA 5FGBC 5JMOC 1B0RB 3CPLB 1AKJA 4KVNH 4WWKC 4HQQL 5C07E 2IANA 5C6WH 2XRAH 3UJTL 1RZ7L 5D5ME 4FQXC 4OF6A 2ZOKB 2MCPH 5FK9B 4XC3L 4AY0A 3RA7H 2DQDH 2K9UA 5C0GA 1NUNB 3UMTA 5F1NB 2WUBH 3VXMA 1VDGA 5JHLH 4PGEB 1CFSB 1WBXA 2H3NA 3CH8A 1YYML 1WSST 2VXTL 4I9WD 4YJZL 4QXGH 5D2LF 4ETQA 3QFJA 4GRLC 3DYMA 1D5BB 3QUZC 4LCIH 3RAJL 2BJML 1FIEA 1U8QA 5C9JB 4RBPH 3CFBB 1UACH 3D0VB 3D2UB 2ED8A 5EB9A 3EGSB 1JGVH 3T77A 5HDQH 2HT2C 1FYTB 5AZEH 1MF2H 1MCOL 2IQAA 1ZGLA 3I6KB 4RX4A 2CKBA 4KUCF 1I1FA 2MSPA 5DD5H 1U8HA 3GHEH 2QQKL 4D3CL 4IRSA 5HVGB 5AUMB 4PTTA 2VDMH 5TDOA 2GW5A 4YXHL 3LZFL 4MNHA 3OAZK 2AVGA 3SGJC 3RWCA 2QQLL 5C08A 4WFED 5BQ7A 4GG6B 4HIXH 2CIKA 3MMEA 1RZJH 4YXLL 1PD6A 4Q9QL 1T1WB 1PZ5A 4NKIH 5EBLB 5HYJD 3BQUB 4X0KB 2R9HD 4HV8B 3O45A 1A6AB 1HIML 4X98B 2BHUA 3C9NA 3FB7B 4WEBH 1D9KA 4PG9B 2D7OA 4X7EC 4Y16A 5CMAB 3SQOH 2VYRE 1EFXA 1GGBL 2DIJA 1YMMD 1QEWB 3S96B 1HYRC 4X4YA 1KC5L 3PIQA 3KDMB 1GJIA 2BSRA 4TUJA 5JPNA 2FX7L 5DJYB 4F9PC 4NO0B 5IMOB 1KBGH 4Y0GA 4X6CA 3MJ9H 4R2GD 4OZGE 1GAFH 3UROR 5JXEA 3TBVA 5HVFB 4S11A 5HI4D 3UC0L 3ROOB 4G7YH 1RI8A 1KIQB 3GGWB 4ZUUB 3LRSA 2V5RA 4JDVB 4Y5XC 5F6HJ 4Y2OA 2NY5C 3QIWC 1FCCA 4I4WA 4P9MH 3GBNH 4ZNEA 1NCAH 5LBSH 3DXAD 3FB5A 1DFBL 2AEWA 1YMHA 3OR7A 4UT7H 4LCUA 1HQRA 4ZOEA 1OL0A 5C07B 1CVSC 4KDVA 5IWLA 5E6IC 4LVOC 4HWBH 1NBVL 2H26B 4OLUL 5DVMA 5D5MB 4OSUH 3LPFA 5K9OA 4GW5A 5CBAB 3W11C 3H7BA 4EN3C 3MRPA 1DQML 1AXSA 4IMKC 3HAEB 4JFZL 3BKYL 3MRDA 3VCLA 2I60L 1A5FL 3D39A 3HRZA 2WSKA 3BJLA 3IU3B 5L6YH 1AGBB 3K3QA 2QSCH 1T1YB 5FYLD 3CDGA 1Y6NR 2PTUA 3WKML 3QI9C 2P7TA 2OX5A 2XY2A 3LCYA 3DMMA 4ZTOL 1DBKL 4KDTC 4B5EA 3FFCE 1FG9C 1ZT4B 1KJVA 3H7LA 4ZUVB 3VFOB 3WHXB 5DMJB 4Y2DA 3C6LD 5LWYH 1BQHB 5I1LB 1EGJH 3CNKA 4LLVA 1XF2A 5CBEB 3GIVA 2XQYG 5BS0E 4PJ8A 2AJYL 3KYMB 5DEFB 4XWOD 4FFZH 3CLFL 5J11B 4AIXA 1XZ0A 1NUGA 2P47B 3CK0L 3FRUA 4O02L 2AXFB 1UC6A 5FYLL 4BFEA 2CLVA 4CKVX 4H25A 3D69B 3FO2A 3BZEB 5E08L 4P23C 3ARSA 1E28B 1ZTXL 2MQ0A 1CVRA 3BN9C 5D7JA 2YUZA 1QR1A 3V5KB 1CDUA 2FIKB 5CJ5A 3EO0A 5D2NC 1AGFB 1PKOA 3HMWL 1P4LA 4LKCB 4PJGA 2YD9A 4N8PA 4M6MH 4P4KB 2WV3A 2WINA 1I7RB 2FR4A 4PR5B 1XEDA 3GMNB 3WE6A 2E27H 3DGGA 4XBPB 2MKWA 1W8NA 4NQEE 1T1ZA 4OZGB 3HPLB 1ND0A 1KJMA 2BVQB 3UDWC 5DUMH 1N26A 3BZ4A 4TUKL 1MCPL 3IF1A 1RMFL 2DLHA 3LN5B 4KK6C 4MAYD 3U0TA 1OVZA 4F57H 4N8CL 2ARJB 2X70B 1YY9D 4U6XB 5TDPA 4LSDA 2LVCA 1ZV5A 4OLEA 3RVXD 2C1OB 2IGFH 4TRPH 1UM4H 2NY0C 2RQ8A 3MRMA 3EYFB 3VG9B 1CF8L 3SKOB 2DQJH 3BGFC 3BP6A 1F58H 4G6JL 4R6UA 5ITFA 3OJDB 4PPTA 3QT2A 4C56E 3NA9H 1MFEL 3F5WA 4JJ5A 5F3HA 2HA1A 4P9HH 1Z6JT 4LP5A 1IM9B 1T80A 1CR9H 4ZSOE 4NJ9H 3OB8A 1KB5L 5LAXB 5D72H 5DLML 3V8OA 2ZSVA 3FFCB 4WUKL 4M6OH 4FABL 4FP8H 2ED9A 2VXQH 5T1LA 5LG1A 3RL2B 3IVKA 2OP4H 5HVWA 1XR9B 4FQHA 3VH8B 4ALAH 4ZO9A 2DI7A 3B9KA 4GMSL 4Q0XH 4NM4H 5A16B 1HCVA 1BBJB 2C1PA 5BZWB 5BS0B 3EDJA 3RNQA 4WHTB 2RFXA 3WCYA 2KUTA 5L2KE 3H42L 4U1MB 2DAVA 3SDDD 3WN5B 2YPVH 2GTZB 3MGOB 4UU9B 4GAJH 4CN4A 2DQCL 3ARPA 3ZE2E 3K74B 5DJDB 4J23A 3ZTJH 3GMLB 4HKZA 3DBXA 5I1HH 3LMJH 3KLDA 4UB0H 4PV9B 5CZXC 4MJIA 5EU3B 3BHBA 4PD4K 2RB8A 2O5ZL 1F5WA 3S5LA 3HZMB 4LVEA 3V6ZB 2AK4D 5DUBB 2Z93B 4GSDL 1RZFL 4OLYH 3UJJL 2HKHH 4NZTL 2O93L 4Y19D 4LSVH 3B6SB 4AH2A 4P46B 1EZVX 1L4IA 1T2QH 4R90L 1KGCD 3ARDA 1WAAF 3QUKB 2Q6WB 4S1DC 4NQCA 1HHJB 2WLZA 3O8XD 1IL1A 4NQEB 2XA8L 5J57B 1FJ1B 4UV4L 1H5BA 1QKZH 1P7KA 3TH2T 1L7IH 2HRPL 4I77L 4E41E 1O7VA 2DYPA 1P6AB 1ZT1B 4ZAKA 3V6OA 4CW1B 4JO4H 1JYVA 4W6YB 2PYFB 3TYFA 2IPKB 1MJ8H 1F6AA 4P3CL 4MA1C 4OF5A 1EHLH 3L1OL 5D7LA 1FRGL 2EEDA 4QT5A 1JYNA 3SGDH 1TENA 1JI2A 1I8IA 3H9HB 5BJTA 3O3AA 5L7XL 1FN4A 4LNRA 4Z5RB 1CE6B 1J8KA 2B1HH 5A1AA 4MNQA 3QDMD 5GISL 1NLBH 5I8CB 1QACA 5K9JH 5DMGC 5BRZD 2YPLD 3QPXH 1BPVA 3JV4A 3BZDA 3TNMB 4K7PY 2EDBA 4LPXA 4C56B 5IKCA 1SM3H 3ZKMD 3VFWA 4D9RD 4P2OC 4OGXH 5J3HD 5ESAB 4ZSOB 1NCBL 1O7SA 4JDTH 1BZQK 3NN8B 4HK0B 4Y5YB 2AKRA 1G7IA 1TDQA 4XBGA 4HSQA 4MAUH 4M5ZL 2IADA 3P0GB 4N1HB 2HT4D 3P4OA 1C7TA 3RDTA 3ILPB 3FHAA 3RRQA 1DCLA 2IAMD 4NP4H 2R23B 4UNUA 3LV3B 3NFSH 1NAMB 1YEJH 1XH3B 2VLJD 3ILQC 4WEUD 5D96C 1F42A 3MODL 2R29L 3BT2L 3HCVA 1A0QH 2AK1L 2YD8A 1DQJA 5I0DA 4LIQL 3KLAA 4TSBH 3G5YA 2Y6SC 5L2KB 4HXBH 2VXUL 4ZTPH 1A4KB 2QBWA 4L8SA 4OGAC 4M5YL 5I1IH 5IB4B 3AM8A 5ALBL 4Y4KB 3MUGB 1U91A 2YMXL 1F4HA 3MLVH 1URLA 3WLBA 4PJ9D 4PS4H 4JM2C 4N0UE 1X44A 1XFPA 5CJQH 1DBAL 1SEBA 1A1OA 4FQLH 4HKJB 5FYKD 2NTFA 4DZBA 3O2WH 4M7KH 1CGVA 4KVNL 3DVGB 3KPLA 4G3YH 3PJSA 4WV1A 5IBTH 3SDAC 3O0RH 5E2VH 4MB5A 2A74A 5HGHB 3A6BH 3KGRA 1NGYB 4KUCD 2Z31B 3H0TB 3SDXF 2DQDL 3HTLX 3VG0H 4PRPE 4XX1G 1T83A 2JE8A 2OYPA 5JHLL 4A6YA 1G9EA 1I1YB 4PJIA 3J7HA 4WW1B 4OUOA 2HLAB 4NM8L 3F6LA 4E41B 1VSCA 4MJ5A 3STLA 1F3JB 1Z0MA 2QQNL 3T4YB 1J8HD 3VXSE 5KW9H 1J10A 4IS6A 2CD0A 1K9TA 4WFEE 3K8KA 1RJZB 4LCIL 2H2SC 1ZHLA 1II4E 1ED3A 4N1CA 4YPGA 2WWMD 4G6MH 1H15A 5F88B 2B0SH 3MZTA 5FYKL 1XGYL 3KJ4C 1JGVL 5HSFA 2VDOH 1GOHA 2VDNH 5AYUH 1JNLH 5E0QA 5HDQL 1WZLA 3QDGD 1U6AH 5AZEL 2AV7B 1T5XB 1MF2L 1FZKB 3OKMA 5IW3A 4CNIA 4LPVA 2UWEF 3JZ7A 5CFHA 1YMME 4HUWB 5EO0A 4ZYKB 4ZOAA 3MFFA 2Q76A 3S37L 1JF1B 1I1AB 4TPRH 3GHEL 5E03A 4GW1A 3IXTB 3QIBC 3QXWA 5HHOD 4FN0A 5SX4H 1U8KA 2V5MA 3RZCD 3MRFB 4Z0XB 1IMHC 3HE7B 4DVBA 5E8OB 3OAZH 1HHHA 4UDTB 4HIXL 5GS0H 4Z7WE 1RZJL 5E70A 3KPPA 3QIUD 5EO9B 5C8JB 1OTSD 2H41A 2Y72A 1B0GB 2W9LA 3IGAA 2GK0A 4NKIL 5HGDB 3BX7C 3IFOA 3DWTA 1BX2A 2R2HA 3DXAE 1GPOH 4GRMB 4WTZA 1H0DA 1V3LA 1K3ZA 1ZKAA 3ECBB 3HNTH 2BSSA 1VADB 1G9NL 1BF2A 1GIGL 1CN4A 4V1DE 3ARBC 5IJVB 1J5OH 1CFVH 1BIIB 4O51B 2IBZY 4Q9CA 1CDGA 4O00A 5MEQB 5HY9B 2VJXA 4LGPB 5E9DA 3AB0B 2R1XA 1G6RH 3HE6B 4QTHA 2X41A 1KBGL 1S78D 4E5XB 3H3BC 4APQC 5JW4Q 1NFDA 4NKQB 4M1GH 2FHCA 4J3XA 1GAFL 3REWA 1ZANH 5JOPE 3PGDA 4YO0A 4IIQC 5FYLE 4G7YL 4H5SB 1Z5LA 1UQSA 1Q8MA 4TSAH 4N0UB 4MLIA 3VE0B 1ZT7A 4WY7L 1WT5C 3MRBB 3GSRA 4P9ML 1UM6H 3GBNL 1NCAL 4JKPL 3R06A 3GZKA 5HTSA 2EIDA 4WI9A 1CDHA 1S7RB 2HP4A 3KYAA 4HWBL 3EHBC 4CU7A 3IETA 5H35A 4K3EL 1J0YA 1T89A 4LLQA 4KZEH 4PRPB 4WW2A 2XPGA 3D9AH 4EXPX 5F7LB 5CP7B 1NGWB 5I17B 4GBXC 5GGUB 1XCQB 2VIRB 5K9QI 4KMTH 5L6YL 2ZSWA 2QSCL 4O58L 4ZDHB 2GUOA 3VXSB 4QRPA 2EYSB 3ZYIA 3VMNA 3IDIB 1Q9OB 1U3HD 4XI5D 3SDCA 2ESVD 2ZNWA 1SYVA 3PHOA 3KPSA 1M7XA 4NC1E 5IK3A 1IM3B 3VFRA 1YC7A 1VFOA 4YNYB 5LWYL 3WXVL 4EVNB 1EGJL 3MYJA 4WFHD 1FNFA 1YMMB 2EDHA 1T03H 2YA0A 3O41A 1MCEA 3GSNL 4G80A 4NKDA 3WIIL 3TO4D 3PWUA 2QV2A 1K5NB 4L5FH 1IVLA 4UAOC 2FNBA 4FFZL 4K94H 5DWUL 1Z2KA 4R3SA 4Y5VC 1M1SA 1N5YH 4PUBL 4Z7WB 4R2GB 2FYYA 3P0YL 3MBEC 3OL2A 1XGTA 1N7MH 2ICWJ 1A1NA 3T3ME 3SJVD 3GMMB 4M62H 3RP1A 5B8CA 3QWRD 3QQ9C 1JPST 1A7PH 3DXAB 1O0VA 5GZOC 2CK2A 3T1FB 1C12B 2VDLL 2H32A 2FWOB 3OAYH 4M6ML 4OUUB 1Q9LB 3FQNA 4V1DB 5BOPA 4B7IA 1RVFH 2FHBA 1T7WA 2E27L 4HDIA 2HFFA 2EDNA 1LK2B 3MLTA 4LF3A 5FUCE 3MRNB 2EDKA 3TNNA 3C5SB 1R3JA 2MMXA 2ICWB 4R97C 5DUML 3CDCA 5J13C 4U1NA 2NY7H 5E6YA 2X2YA 1AHWA 1AI1L 2ADJA 5JHDA 4H26B 1F02I 3KHOA 4LDLB 4U4BA 5CEZD 1DVFA 2XFXB 2I9LB 4Z7UE 3BN3B 3ZKSD 2YPKA 4PRAB 1TNNA 1AD0A 2YEZB 4P0DA 4PJHA 1QP1A 2AQ3A 3QEUB 1CXLA 4TRPL 1UM4L 1HKLH 4ZFGH 3UPCA 4EI5C 1AY1H 1D6EB 3FO1A 1F58L 3MX0A 4IJ3C 2HN7A 2XTLA 3ZKND 4NZUH 5KSVA 4M61A 1WV7T 3N06B 2XTJE 3NA9L 3QUML 4NPYA 1HH6A 1RIUH 3UTOA 1CR9L 4QRUA 1B3JA 3UJIH 4NJ9L 2X4QB 4CADA 3B83A 5J9PB 2GIYA 1E4XH 2C3VA 4OLZH 5DFVC 4JFQB 2MQCA 5C0AD 1QVOB 5ICXA 4Z76B 2GYSA 4X6FA 5CEZL 1E27B 4PGBB 3MLUH 4M6OL 4FP8L 3DX8B 3KNBA 2DMBA 4Y8AA 5C71A 5MHSD 2VXQL 3MJ8B 3DECA 4F9PA 1NJ9A 2HJKB 5GIRB 2QEJA 1KTDB 4DEPC 2OP4L 1MY5A 1KIRB 4ALAL 4DGIH 4XB8A 4Q0XL 1RJYB 4NM4L 2V5TA 3RU8H 3LD8B 5FOBB 4Y19E 2VMFA 1XF1A 2ZUSA 5FF6A 4PRBA 4XNQA 1KT2B 3W9EB 4N8VG 2RCSH 4GAJL 2E6JA 5SV3A 1H8SA 3T4AB 4ODHH 3QUXB 1XF5B 5E6IA 5GS1B 2NNAA 3LMJL 1LO4H 5CGYD 1KB5B 1JGLH 1MLBB 3EOYG 4YPJA 7FABH 4EN3A 3QCVH 5FUZH 4MAYB 4IMKA 3DIFB 5L2JB 3EJZC 1HSBB 5BXFA 3BMVA 4MSWB 4FFYH 4NQSA 4ELKA 4OLYL 4BH8B 4LSVL 3BMWA 3B4NA 4PRID 3FB8B 4XWGH 1T2QL 5I1GH 2PW1A 1F11A 3PDOA 2D4DA 3KYKH 1RHHB 1A6VH 4CVZB 1G7HB 5BRZE 3NGBB 1ZXQA 1PKQE 4R4FH 3BD4A 4LIQE 3BPOB 1TZHB 5C92A 5ESQA 3RWFA 4YR6B 1OD7A 5EUKB 1QKZL 2X9WA 4Q6IA 4WTXA 2MPAH 1LNUA 1YA5A 4JFEA 5HI3C 3SE3A 4JO4L 1KN4H 4DTGH 1PFCA 1MJ8L 2LU4A 4Z7UB 4HK3N 4POZD 2R0LH 5I66B 3OXRA 1XGPB 2A6DA 5JIIA 1J0IA 5CIPB 3PWVA 4YHYC 4N5EC 3R1GH 2FZ3A 3GMPB 3T0EE 3U46B 1DN0A 5K9JL 1E4KC 1OCWH 3QPXL 3GSQB 4PV8B 2ICEA 4RFOH 4P23A 3MRQB 1SM3L 2XTJB 1L0QA 4JM4L 5HD8D 1T0NA 1OPGH 4XCEB 4OGXL 1HXMA 4QCIB 3HZKA 1IKNC 2F53E 4X6CF 1I7ZB 3MQIA 5HHQB 4ORGA 4QHUB 1XR8A 5C0BA 4OZFG 1T5WB 4HPOH 2GJZA 4MAUL 2P24B 1X4YA 5D2LE 3VRJB 5EO1B 3B9VA 4FRWA 1DN2A 3MROB 2PKDA 5AG9A 3LKQB 3UTSD 2YR3A 2YD7A 3I02B 4HUVA 3PNWB<