4NC1E

Crystal structure of tcda-a2 bound to a20.1 vhh and a26.8 vhh
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
124
structure length
124
Chain Sequence
VKLEESGGGLVQAGGSLRLSCAASERTFSRYPVAWFRQAPGAEREFVAVISSTGTSTYYADSVKGRFTISRDNAKVTVYLQMNNLKREDTAVYFCAVNSQRTRLQDPNEYDYWGQGTQVTVSSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Antibody Recognition in the Receptor-binding Domains of Toxins A and B from Clostridium difficile.
pubmed doi rcsb
source organism Clostridium difficile
molecule tags Immune system
molecule keywords Cell wall-binding repeat protein
total genus 31
structure length 124
sequence length 124
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nc1E00
2VLJB 1YEHH 4Z7QE 2IADA 4NT6B 3KXFD 5GGRA 3KYNB 2I26N 2BHZA 4J1UB 3WN5C 3MBEA 4ZQKA 2FECI 3S3PA 3QIBD 1N64L 5SWQB 1AI1H 3BKJH 1CD0A 4LARL 5LBSL 1DL7H 4Y19B 2FATL 1WBYA 1B6DA 1MCKA 4JAMA 2AI0L 4H5SB 4XNYL 2B4CL 2CPCA 1QFWH 4KK9C 2BRRL 5EZIL 4OD3L 1FAKT 5SWQA 3RL2A 1Z9OA 2X44D 1A6UL 43CAA 1QLEH 1UWXK 2DJSA 5J8OA 3VXMA 1MVUB 3GJFB 4NQED 5HPMB 2C1OB 2Q7YB 4MX7B 2BK8A 2Q3AA 3DUUB 3H0TB 4S1QH 3TJEH 1XZ0B 3MRHB 5ADOH 5EU3A 3TN0D 3MLVH 3NZHL 2DYPA 4Q9CA 1CD9B 3JWNC 4QF1A 1NC2B 1TCMA 5ALCL 2BNQA 1JHKL 3FTGA 3DUUA 1OD9A 1XEDA 4Q9BA 1CICC 3D87B 1L0XA 1YEHL 1J12A 1G9ML 3NIFF 4LCUB 2PXYA 3QIUD 5DQDL 1M6OB 4X0KA 3MRQB 4JLRB 3ECBA 3ILPA 3TT3H 4PY8J 1F4XH 3IDYB 5DMKB 4HUUA 3RNKB 3TF7C 4KZEH 5E1HB 5E99L 4WRLA 3AAZA 2JB5L 1I1CA 1A9BB 1FH5L 5IB3B 5GGQH 1P53A 2L7UA 5AYUH 2R8SL 3WFBH 3DX7A 5SWZB 3ULUE 4LLWB 4DGIL 4P4KA 1UCTA 1YPZE 5FXCH 5D7JA 1T0MA 3E6HA 5ECJE 4P2RB 3TYGH 4BELD 2C9AA 3MACH 5L9DL 4OF0A 2IMNA 2K3TA 5EOQL 1BLNB 4FTVA 1UZ6E 2V5YA 1GZPA 2V7HB 2B5IC 3T3PE 1WWCA 1I4FB 4W4OA 3SE8H 2IQAA 2FR4B 5D7JB 3HMXA 2VLKA 4YFLF 4PJ9D 4FQIH 5I8OL 4H88L 1F4AA 1SQ2N 1I3GH 2OL3B 4RSVA 3FQRB 4JFPB 5KG9A 5JOFA 5HJ3B 4M3JA 5FA4B 4FABH 2D9CA 2CK0H 2AXGA 2VWEC 5D2NB 4I0PA 4CDGC 2VXTL 5GGSA 1T0NA 3QFJE 2XQYK 2XNAB 1PW3A 3HE7D 1CL7I 4HBCL 5E9DD 4KK9D 3WUZA 5ESVA 3BDYL 1U8LA 1CLZH 1I8IA 3TBSA 5KJRL 2YD7A 5C2BH 4V1DD 4LCWD 1I1YB 2XZAH 4PV9B 3DX9A 5I19L 5CBEA 3G5VA 3UYRH 1OM3H 2VZUA 5TF1H 3UYOD 4PJ8B 5EC1B 3RVWC 4JO2L 3KXFB 5CSZB 5JXAH 3ULUH 1BWWA 1BPVA 3GJFK 2AXJA 3QG6A 4FFWC 4N90D 4PJBA 5IVXA 1ZTXH 2DDQH 1EMTL 3FL7A 5C0AD 1XIWD 2R0LL 4O2CA 3MV8D 4NM4H 1SVZA 4DZ8B 3CSPA 2ARJB 1Y0LA 3TN0A 2E7LA 1WTLA 3QISA 5L7XL 4NKMA 1YMMA 2XRAL 1KCVL 4EUPA 1S7RA 5EC2B 1MFDL 3KYKH 1GSMA 3F12A 1G9MC 3HMWH 2WINB 1A47A 2BXYA 4HWNA 4HDIB 4XBGA 3FB8A 4H20H 4UTBH 3BZ4A 4JG1L 4LKXB 4ZTOH 1JPST 3QPQC 2BFVH 4P9ML 2PW2A 4DAGH 4HXBH 2GKIA 2JLLA 5L88H 1A6AA 4E41A 3VH8A 5J12C 4Z7OE 3MNVB 4M02A 4NYLA 1NEZB 1JYWA 2H2SD 3V4PH 2CRYA 4Y16C 2V6HA 4JY6B 5F70A 5GGTL 4Y4FD 4GBXC 4PG9A 1EEYA 2Z0BA 1KF9B 4LCCC 4YGAB 2QQKH 1E4WH 4QHMA 1BQLH 5ICXA 1HH6B 4R2GB 4OCNC 5B8CA 3U46B 4K07A 3K2UL 2W91A 4DVRL 3ARBD 1FLTX 4JGUA 2Z8RA 3IDJA 5D93C 3QCTH 3UTTE 5F9AC 3BPCA 4JLRA 3ZTNH 3RL1B 3WNMA 3QUXA 1JFQH 5GS1B 1JVKA 1MQKH 1WFOA 4JJHA 3QCTL 3X14B 1JGEB 1GHFH 3TWCH 1G7QB 1QO3A 3TBWA 1Q9WB 2QHLA 4GXUM 4HIXH 4XPHL 1XF5B 5ICYB 1V3MA 5HPMA 2RIKA 4KVCH 5INCA 1QNZL 1LEGB 5J1SC 5F9WB 4JRWA 3RX8A 3RWGB 1N0LA 2EIZA 4ZOAA 4X6DA 1S7WA 3HB3C 3IAPA 4M7ZC 3VG9C 5MERA 1C5CL 5H94A 3VFOA 5FOJA 4G3YL 1PEWA 1J7VR 4TUOB 1RV6X 3RGVD 4FN0A 4YHYB 1XCQB 4JDZA 2AEWA 4GSDL 1A6TB 2E8YA 3H9SA 4PJ7A 2MKLC 2NYYC 2VRAA 3QQNA 3QEHA 5D1XD 5HYSB 1NGWA 3BHBA 5E2VH 5CEYB 5LGHH 2E27H 1F6AB 1QG3A 4G8GA 1QQDB 2OJZL 4GAGH 4P49A 3TM6A 1DANU 5LXGL 4B0MM 5TDOA 1GGYA 3MNZA 3T08A 4JY5L 5MP6L 2N1KA 3MGTB 2EXWC 4I18B 1J5OL 2XXCB 5IBTH 2NCMA 3G6DL 4D0DB 1X5HA 4MQTB 3WKML 2H2SC 4WV1C 1HCVA 3D69B 4PGBA 4U1JB 4JG0H 1EHXA 2AJZA 5BS0E 2GJJA 2VXSL 3LEVH 3QUMH 1CICA 1OTUD 2MPAH 3A6BL 5DA0B 5DJ6A 4D3CL 1KN4H 2CKBA 2R56L 1UKQA 2VSCA 3SY0A 5J11C 3W11D 4R4FL 2A1WL 3QI9C 1GOFA 1H3TA 2NZ9C 1DBBH 1UKSA 3D3VB 3MZTA 5IVZB 4XVJL 4L8SC 5E5RB 3QUZB 4HFUL 2WANA 4ZO7A 1XAUA 1D5IL 5KN5A 4U1HB 2JCCE 3MRKA 3U2SA 4HPYH 3MNWA 4ODWB 2OR8A 4E0RA 3TNNA 5SWSE 1SY6H 2DF3A 4QRRB 2NLJA 1OQXA 2HVJA 4LEOA 4OBSA 3CVHL 4YWGH 3TYFA 5EU7C 4XNYH 4PRIB 2ZUXA 5LXGH 1I1YA 1RY7B 4HMEA 1G7JB 1VENA 3VXRD 4JFHE 5ESQB 2GTZA 5FYKH 1CVRA 5FHBL 2ZJSH 2HFGL 4EQ2A 3KAAA 4KPHH 5CD5D 4HXBL 2H9GB 1K5NB 3IDXL 5EN2A 1CFVH 1LEIB 2DKMA 4JB9L 2OI9C 4F7MB 3P3YA 3QWRD 1OAYL 1A22B 5KVDH 3QO1A 4UDTB 3UJIH 3MLPA 1XF4B 4KI5C 4L9LB 4YDJB 4F7PA 1CR9H 5B38G 1CGYA 3IU4H 1HQ4B 3W5NA 2D0GA 1X5XA 4R7DB 1W72B 1YPZB 4UDUB 3OF6A 1FL6B 1OT2A 1N6UA 4EJ1C 1LP9A 4L8BB 2EXYC 2XTJC 2ICEA 5C09B 1CFTA 2W0KA 5DVLA 3VFNA 2ZOLA 3T04D 1EX0A 1MCJA 1S5HA 3SKNA 2EXWD 4EI5D 3OGCA 2YPLB 4KKLC 3BX7C 4JKWA 5DK2A 4LRNH 4OTXH 3VJ6A 1JFQL 3WS3B 3TZVA 5C9KA 5L0QC 2QSQA 3G5YA 3HUJB 4OCSL 1OTSD 3VI4F 4JCMA 4HQQH 3V5DB 3EOYG 4LIQL 5DRWB 5KVEL 1JYVA 1JPGA 2IFFH 4CN1A 2C7UB 3SDYL 1PYWB 1ORSB 1JL8A 4A6YA 4G8GB 4JREC 4ZS6C 3HUJA 3RVUC 3VXUB 3O45A 4JPVH 4WY7H 3WL9A 2UZXB 3D39B 2X42A 5DS8A 1MHCB 1J8HE 4GRLA 5I66A 4UIMB 3MGTA 4MJ2A 1UWXH 4LCIH 5F21B 3R4DA 5FCUL 5I1AA 1YNLH 5C07B 4DKAA 5E8PB 1MF2H 4JR9H 2DI7A 1JMZA 3T8XB 2F53D 1WEJL 2WMPA 4BH7B 1IC1A 1QSEA 3FO9B 4PJHE 1S5IH 2OP4L 1BBJA 5AZ2L 1TFHA 4K3EH 1JCKA 4Y19A 1MEXH 5C08D 3S88H 5CHNA 1N26A 1NQBA 3NIGE 3C60D 5F89A 5JR1H 2OTWA 1WAAA 1J1PL 4AIOA 5KN5B 4DGIH 1YY8A 3S88L 2A6IA 3LOWA 1ZHBB 1TQCC 2HTKC 4KWUA 1J05A 1X5YA 5KSBA 3S5LG 2XQBL 5EU4A 4TUOA 1F4XL 4P57A 1HIMH 2R0LH 2FYYB 5J6GA 4UT7H 2Z4QB 5JPNB 2NY5H 3B4NA 1R3HA 5C09E 2CQVA 3J7HA 4HJJH 5KSBB 1KCSL 5J9PA 2A6DB 2QSCH 3H2WA 4F9LC 3SGDH 2BVOB 3T65A 1QRNE 3DTXB 3P4NB 2GHWB 3CFDA 4YXKH 3AS1A 4LU5L 1CGTA 1Z9LA 2QHRL 1DFBL 1RZFH 2F54D 5BO1H 3VXSB 1QEWA 2DIAA 1T0PB 2EYTB 2R2HB 1NFIA 1MCDA 4ZO8A 2EIBA 3ARYA 5GJSH 1V7MH 4HGKC 1A6UH 4HLJA 4P2YA 1M71A 4XRCA 4Z18A 1VPOH 4NN5C 3DO7B 4FQQB 1RUPH 4BK5A 2DTSA 1BF8A 3HI5H 2EICA 4MA7H 4RISL 4JO1H 2YN3A 2O26U 3C6LC 4KROC 1KXTB 4NBZB 5BRZD 1DQDL 4PJGE 4HKZB 2ICEB 3RKDC 3BUYB 4YHZL 4UTAL 1LK3H 4MJ5A 3MPCA 2A77H 3KPRE 4NUGL 2PR4L 5FGCB 4ONGL 4QEGA 5EBGA 4U7KA 3EYUH 3QHZH 4OFIA 4YHKL 5HGDA 1C1EL 4Y4HA 2D7OA 4AEIL 4NN6C 5EOQH 4UINH 3SCMB 2NXZC 1GAFL 4W6YB 1U8QA 4XCEA 1IARB 5FDYA 2ICES 1T20B 1I85A 1E4KA 5HHVH 4CMMB 1RZKL 1D6VH 4ORZC 3U6RB 1DVFB 3CFKA 4NKIL 1DUZA 1GGCL 1FFOA 4HV8B 3DVNB 5HHMB 5DLMH 4YHLH 4DAGL 2J5LB 3EYFB 3EFDH 5BV7C 2NMSA 1UJTA 2O5YL 4MZ3A 5DTFA 2P8LB 4XCFH 3IDIA 4HWBL 4MA3B 4J8RA 1VKXB 5HHOE 2I5YH 4EDWL 3OAUH 1EEQA 3UBXA 3NABH 3IGAB 4OCWL 4EVNB 3QG6B 5D96B 3UCRA 4JFXA 4KGLA 3BZEA 5ADPL 1O0VA 1OLLA 1CN4A 2IQ9H 1RFDL 2R1YA 3C5JA 2EC8A 2W60B 1K3IA 3O81A 3QHZL 1HDMA 4P2QE 4KGJA 3NCFB 5I1GL 3MOAL 5D7SH 1YY8B 3W39B 5BVJB 5CBAB 4XVSL 5GRJL 1VGKB 2ID5A 3T0EE 1JIBA 1JP5A 1NUGA 3LDBB 3RBSA 5CHNB 3E3QE 3QUXD 4OZFG 1KEGH 3BO8A 2YBRB 2VZTA 3M45A 3OQ3B 4QXWA 3UAJC 4XNZB 4WI5A 1DEDA 3HB3D 4RMSA 4JM2C 1A6AB 1ZT7B 4OGAD 3NN8A 4R0LC 4AM0A 2GK0A 3GIZL 4HUXB 2FX8L 3OKEA 4KQ4H 3RGVC 4X80L 1MH5B 4PGDB 4XPFL 4L3CB 2B4CH 1BJ1H 3GSRB 1DBAH 2LU3A 4GRLB 3HS0B 4ZUSA 5I66B 5MHSD 3QEQA 1XCTA 3Q3GA 3QJFA 5CZVL 2IANA 3OAUL 3TA3C 3MBEC 5E2JA 4M6MH 4U31A 5FUZH 5EUOB 1A6ZA 1JK8A 1CXKA 4XRCB 5JHDA 3D0LB 2E7MA 1FG2A 4K7FA 1JF1A 2Z31B 3HE6C 5BZDB 5C0BE 5CUSH 3QIWB 2DM2A 4GLRH 1Y0LB 3NH7L 2XRAH 4U6YB 1CK0H 3BE1H 1F11B 5MEOA 5HXMA 4HJ0C 5J3HD 2CR6A 4GQPH 4UV7L 1NFKA 5DEZA 3UTZA 2OJEA 2OS7A 1PG7H 4OM1L 3ROOB 3OKMA 4PJAA 3OB0H 1JPSL 3BRFA 4UNTA 5C0AA 1KEGL 2X4SB 2KH2B 2AJSL 1B2WH 5CZKA 2JJSC 3RUGF 3VDCA 3C60A 1T3FA 4P46A 2OBGA 4CW1A 3RUGE 4PRIE 3QO0A 1EBPA 2VQUA 4LNRB 4OQTA 2F8VA 3GO1H 2VAJA 3MO1B 4OZGB 1A1NB 3RWFA 3TEUA 5AZEH 1GZQA 5DJXB 1DVFD 1ZHNA 5C6PB 5CP7A 4BKLA 3WD5H 4OD2A 2EZ0C 1CWVA 3ZYJA 4G6AC 1YEJH 4PRNA 1WFNA 3QUXC 1JV5B 4XWOD 1NL0H 1DZBA 2P7TA 2J7LA 5IUSA 4LHJB 4C59B 4UQ3B 1NCBL 2HKHH 1G9NC 4LLUB 4LVOB 5FOBB 4KVNL 4G6ML 4OGXL 1O7VA 5DD5H 2VISB 3VDAA 1AGFB 1NMAH 5I0DA 1RZ8A 3ETBF 3R1GH 4WFED 3UZQA 2HLFD 2CDGB 3EDKA 3O11A 4NQDE 3UJTH 4X5WB 1K6QH 4G7YL 4AEEA 1AKJB 1N5AB 4TVPD 2PYED 4P23B 3PXHA 4DCQA 2UY6A 1L7TH 2I27N 3MCKB 1I8LA 2DQCH 2VXUL 3SQBA 4PRPE 4XBEH 3Q0HA 1LQSR 4BZ2H 4WO4C 2VXUH 4EN3D 5F9DC 1TENA 1YN7A 5JHDE 3X3GL 4PJ5A 4FQHB 3C9NA 3UDWA 1MCQA 3S3SA 1HH6A 1P6AB 4NM4L 4PIRF 1IGCL 4JE4B 1Q9LA 3QFJB 4XXDA 1AD0B 1QSEE 5F9JA 4X7DC 5GZOD 1FP5A 3KPPB 3VMPA 5I17A 1TVHB 1G7JA 4OFDA 5EU6A 4LGSB 4P59L 1I1FB 1NFDF 2XPGB 1KJ3H 1GGTA 4LCWA 4NO0B 3CVHH 5DD5L 3VRIA 1RJZB 3PIQB 4HKBA 2DYPD 2DKSA 3Q5OA 1A9EA 4LOUC 1U3ZA 3S9DB 1JUFA 2JELH 4HKJB 4XH2A 1GJIA 1KB5H 1RUKH 1Y18B 3WDIA 3VXSE 1AE6L 3GHBL 2YPVH 4OT1H 5E6ID 4JO3L 4F7PB 4OGYL 4Q6IB 4OD1L 4YX2L 2Y07H 3DX7B 5SWZA 5T3ZD 5M94B 3HMXH 4HQQL 4FFZH 1QRNB 4R4FH 4EI6A 3WN5A 1HN1A 4KHXH 3SKOB 1X4XA 2DQTL 4Y5XA 4H26B 3FO0L 3ULVE 3GO1L 1BLNA 1OSZA 4M03A 3O9WB 3T4AA 5EUOE 3VFUB 3NIFE 3E2HC 3C60C 3LN5A 5EUKB 5FK9A 3RDTC 3TH4T 2IH3A 2AGJL 1T7XA 1C5DB 4U1NA 2DB8A 3FT2B 3MJ8B 4OUUB 4HMCA 5DC0A 3NPSC 2IAMC 5I1EL 5M7QA 1DJSA 3RQ3A 3WS3A 1OTTD 4LVNC 2Z93B 3JWOL 1KN2H 3FOLB 1I85C 5KG9B 1HHJA 3E1F1 4WW2C 4PG2A 2W38A 2E3VA 1FZJA 5KVDL 5F7KC 1XF1A 1OGAD 4CAGA 4M7LT 2C7UA 4Y2DD 4J23A 1FFNA 4PBXA 3FTGB 4OFKA 1C1EH 4NBYB 4Q6YA 1EO8L 1PSKL 3RZCA 5D7IE 2AJZB 3RRQA 4WO4D 5IVOA 3OKKB 5ALCH 1FG2B 4K7FB 2ESVD 5IB2B 1FYTE 4BFBD 1PDKA 5IWLA 2DBLH 3U7WH 4L9LA 3MJ7A 2EC9T 2PO6B 3QWOA 2DQTH 5CJOL 3BGMA 1CXEA 2NY0C 1U3YA 2COQA 4Z7VF 5IW6B 5TDNB 2X7LB 2GI7A 5B3JF 1TJHL 2P49B 4DUVA 1RVFH 4U1GC 4QY8A 2WBJC 1DLHB 3KHOA 2ZPKH 9CGTA 1RIVL 2R1WA 1CTOA 1GPOL 2HVJB 3AFLA 3BP6A 3RKDD 2X5PA 5CIPA 5H2BA 5DD6B 3RWEB 4JZJB 1MELA 2WM0A 2YA1A 1UC6A 4GW1A 2QKIB 3QUZD 3F5WA 3HC3L 4WHYH 1JZ5A 3MMEA 1U3HA 1X44A 3U30B 1DL7L 1MCPH 5FB8A 3DLQR 4HH9A 3U9PH 4ZUWB 3O6FB 2KQMA 4J12A 1G0YR 2D7MA 3MV11 4NQCD 1NGXA 2X4TB 3V4UL 1T1YA 2C1PB 3W0WD 4JO4L 2BSSA 3HZYB 3GI8L 4Z0XB 4DUXA 1MHHB 1YMMD 4MLIA 3T2PA 1HSAA 4CJ1A 1L4IA 1IAOA 3OF6D 1QSZA 1AGFA 4M7LH 5CBEB 4KUCF 1X9QA 4DVBA 4S11A 5DMIL 1B0RB 4PV8B 1T83A 5EO0A 4ELMF 5T1DH 5DJ2A 5C09A 3O3UN 3O0RL 1FN4A 1EAPA 1MWAB 3BH9A 3T4YA 3GSVA 2D03H 4P2RD 4RNRB 3FO9A 1UXWB 5TGBB 3CSYB 4PY7A 3RWCB 5E8NB 1QRNA 4EI6B 5I1IH 4GO6B 1HHKA 3O0RH 4P5MA 1UB5A 3FQUB 4NZTL 4GG8B 2VSDA 3IFLL 4RIRA 3LD8C 3RVXD 1QZ1A 3LCYA 5JR1L 2NTFA 4Y2OA 3SBWC 4Y1AB 1BZ9B 2QR0A 4R4ND 3I6GA 1ND0B 4X4XB 3W82A 1IT9H 4KHTH 3ZKSD 4X4YB 4E41B 3EZ8A 3FB5B 3T0DA 5CJXC 1ZTXL 2XY1A 2BP3A 4X6CB 3MROB 4QNPF 1K8DB 3GSNB 5SX5H 3EBAA 1DE4B 2W59A 4PJXA 3CDYA 3WIFB 4XVSH 4L4TB 5JPMB 3S36L 2Z8SA 2DQEH 3RNKA 3V2AR 4GAYA 4QOKB 2RGSA 3OKNA 2Z93A 4N8VA 3AAZB 2F54A 1XCQA 5K93A 4K7PL 1I1AD 3DX6B 1QSFD 3TVMB 1QFWI 2VLKE 2WQRA 2CR3A 3TLRA 2W9EL 4U7SA 1Y18A 4C58B 3VXTA 4N5ED 3TPUA 4NJAH 4HWZB 3QIBA 3MOQA 1RIVH 1NFIB 3EYSL 3VFWB 2VLMD 4RBPK 2X70A 4UT9H 2BMKB 3OJDA 1B4JL 5AWNH 2Y36H 3D39E 1U58B 3FN9A 4NZRH 2DQGH 3G5ZB 4WI2A 3UTSB 5GGTH 5T1KB 4I77H 4YUEL 1EHLL 4XP1H 1IGML 1HK6A 4G80B 1DQQB 2NX5B 3HA0A 3MRIA 4F9LA 2R1WB 3VFRA 4NZTH 2BMKA 3T1FB 3K4ZA 5JW4R 1IGTA 2XWBB 3BEWA 4FA8A 5DD6A 2B1HL 2PTTB 1C7TA 4OKVB 3G5ZA 3UTSA 3VU2A 5GGSY 4M6NL 2IG2L 1T1WB 4NGHL 1J8HB 2VR9A 4X7SL 5K9OA 1DSFL 1DLHA 3IB4A 1WZMA 3K0WA 3W9DA 3T0AA 3TCLB 1JPFB 3FFCB 5JOPD 3BO8B 1AO7B 1NCAH 4TNVF 4ENED 1G7HB 3TO4A 4AIZA 5TH2A 2Y36L 1OGAA 3ULVL 5JUEL 4WI8A 2ILLA 4PLJC 1CE6A 2JB5H 2VKWA 2Y06L 4ESKA 4WTZA 2EYRB 1WT5C 4DK3A 5KAQF 5DWUH 4WFFE 2F15A 1F90H 4X4ME 5JXAL 5F7UA 3ULUL 4OZHA 1AO7A 1CGVA 1S7TA 3MUY1 1TVDA 5FF6B 1VACA 3F6LA 3DRQA 3T2QA 3F58H 3KDMA 2O93L 3VI3F 4JRXA 2DLIA 5HI3C 3PWPE 2CIIA 3MOBH 4TVPL 4OCRH 4Y1AE 5EO0B 4JDVA 3WFHB 43C9A 5BZWA 1KG0A 4WW1A 2IAMA 1BVZA 1OTUC 2IWGA 2AJSH 2FLRT 2IQ9L 4M62H 2JIXA 1ZOXA 3B9KC 2AEIT 3WXWL 2Z31A 2C3VA 1U8KA 5J1AB 2VDRH 4YO0A 3SQOH 4I8DA 2L0DA 5KBNC 4MXQC 1FL5B 3V6FA 2C3XA 2ZZUT 4PY7B 4DFIA 3AUVA 4LSVH 4NP4L 43CAB 1UM6L 3LKNB 4V1DA 2FD6L 4HZAA 1WJ3A 4G8FA 2NY5C 1NCWH 4OLVL 4C54A 1DVFA 4NM8H 3RWHB 5GSVB 1P7HL 2ZSWA 1PZUB 1ZA3A 4CVZA 2A2QT 1T2QH 1GGCH 5JW4M 3HMWL 3BQUD 4GQ9H 3MLYL 1EIBA 3O3AA 2UV3A 2BXZA 3SGKA 1DR9A 2VDQH 4GAJH 3VWJD 4KV5F 3TBYB 2HJLA 2HMIC 1ZLSL 5GZOC 5TE6L 4DGYH 5C86A 3IDJB 1W2KT 1T89A 3LKQA 5HHMD 4MWFA 4RA3A 5ISZE 5KW9L 2EDHA 5F72S 1NDMA 1R3KA 3ARZA 4OFVA 4YIQB 2P42B 1KXQE 4OZIF 4MGXA 1CGXA 1GOGA 4U6XB 2HJKA 2CGRH 2NNAB 2B39A 4JFEE 3O3EA 2GITB 5MENB 4NPYB 2V5MA 2Q6WB 5C07A 4K9EL 4GG6A 1CXIA 2ARWA 2H41A 3T0BA 1C5BH 1AP2A 2OSLA 4FQXD 1A6WL 5D7KE 5T1MA 4AEFA 1JGLH 2J8HA 3GNML 5GSRB 5HI3D 5IR1A 4X98B 2HH0H 1G0DA 4P2RA 1S78C 1NFDB 4MAUH 2X4NB 1V3LA 4K23L 1IAKA 1NKRA 3NCYP 5KSBF 1KJ3L 1MOEA 2V5RA 1VFAB 1G7HA 3TO4B 4NZUL 3FZUD 1OAUL 3DBXB 3QEQB 3B83A 1UWEH 3V79C 4GUPB 5I1HH 5ILTH 5F7YC 4ZDHB 2MPAL 3GSWB 5HDQL 3LEXB 4FXGB 4WFHE 3TZVB 4JZOA 1OTTC 1XGQB 4I1NB 2ZCKH 5JOFB 3VGFA 2X9WA 3MRCA 4OZHB 3CLFL 4U1IB 1S9VA 1QFUH 1KIUA 3QJHB 3EYQD 4OD2B 1U36A 4EUPH 3PQYE 2BCKA 5FEBA 5HVHC 4D0DA 2DWDA 1ZLVK 4POZC 3TIEB 3O2DA 3CVIL 3OZ9L 4NT6A 4N8CH 1JBJA 1U8MB 1IGFH 2QQLL 2RJMA 2XICA 4CU8A 4WI7A 3H8NA 4GS7C 5C3LD 5CUSL 2XIDA 3BQUC 2V2XB 2IGFH 3HRZA 5E2VL 3O3DB 1YEGL 1Z3GL 2QQLH 7FABL 4FRWA 4AK1A 4X6BB 1EZVY 3DURB 2VE6B 3NTCH 1MCEA 1YJDL 3FO1A 4HPOL 5KZCD 2A73A 2P8PB 1SYVB 3BAEL 3DO7A 4U1HA 2NY3C 4G3YH 1KC5H 4LKCA 3LKNA 3NFSH 5DC4B 1CXFA 4G43A 2XN9D 1PY9A 4P3CL 3MO1A 1OB1A 4OZGA 3RWFB 3FO1B 1KPRB 4DTGL 3C6SB 3LH2L 4PJAF 2D7TL 1TPXB 2ENYA 4OZGF 4EUPB 3HMXL 4OV5B 4J3SA 5EBWA 1KB5B 3GGWA 3MRFA 4APQC 1KBGH 2DYPB 4ZS7H 1NGQH 4OB5L 2WIIA 5K59F 1YJDC 5T3ZE 3WUWA 2UUDH 1A7QL 4W70A 1RZIB 3F7VB 2AKRB 5GRWA 1LP9F 3MLZH 4UIKH 1LEKA 4LP4A 3OR7A 4FQXC 1IGJB 4YFDB 4TULL 4IRZL 3BGAA 1FDLH 3LHPH 5DJCB 4ZXBB 3BWAB 3MLWH 4W81A 3FONA 3TBVB 2W65A 5FOBA 1E6OL 4JFEB 1OF2B 3D39D 4WTWA 2ICCA 4JEGB 5JOPE 1G7MB 3F7VA 1FDLL 3LHPL 3IJSA 1ZS8A 4NQXA 2VLME 5E8OB 5E4EB 1DUZB 1PJ9A 5GISH 3OAYH 1H15A 3G6DH 4PGJA 3Q5YA 1W72A 4DCQB 3T09A 2Q7NA 1MQ8A 2CIKB 4WU5B 2ADIA 1J0YA 4Z7UE 3P0VL 4X8JB 3WFEL 4MZ2A 1XGYL 4ZUUB 5T1MB 1X6NA 3HZVB 3QIUC 1RPQA 5FHAL 3O2VH 3AMKA 4ODHL 5HHOD 4RRPG 1KC5L 4WUKH 5D7IA 2AEQL 2I60L 4YDLB 3RVXC 5TQ0H 8FABA 4M48L 4QRPD 2K9UA 2OZ4A 3ZDZF 5T3ZH 2HFGH 3KLAB 2EEAA 1BBDL 3BPOB 4LPTA 1KENH 1IC7H 4KTEH 5BJTA 3WFBL 1F4YH 3GI9H 3NA4A 3GKWL 3D39A 3KS0J 3ZTJH 3H9SB 3VGGA 1U8LB 1JTPA 1S7XA 1S7WB 3TH3T 4NHUB 3LKQB 4ZSOE 5GRVK 3CLEL 3MV9A 4IIQB 4KRPC 1F13A 5EC1A 1WBZA 2FDBP 1WEJH 4JPIA 1A4KA 2PCPA 1AHWB 4Z7NF 4JFZH 1HSAB 4Q9RL 3HAEA 3ILQC 4R2GD 2KZWA 3CU7A 3SEPA 1I1AC 4PJBB 4WWKB 4XHJD 5ILTL 4EEEA 1AD9B 2P45B 4KJPD 1A8JH 1I7ZA 2BNQD 4RGNB 1S8DA 1WIOA 1X4ZA 3I02B 1LGVA 3MRPA 1VFUA 4PGBB 1MFNA 4NCDA 3B6SB 2UWEF 3QEUB 2EO9A 1NCDL 5IBUB 4ZPTB 3E3QC 3QRFM 2UVFA 3NCMA 3FN3A 2ATKB 4HBCH 5DFVD 1XFPA 3T0EC 3GB7B 4OCWH 3MLRH 3O8XA 3I50L 3CLEH 5FA3A 4G6JL 4KTDH 3LMJH 1U8JB 5SX5K 3P73B 5HHPB 1AO7E 4IOFD 3JWDL 2P1YA 1CL7H 4X6CF 3HNTL 1N7MH 3QA3A 3HC4H 1U3HD 3IF1A 4X4XA 1XGUB 3GDBA 1VADB 5E2UH 4G43B 1G84A 5GHWH 1N64H 2E6JA 1R3JB 1U6AH 5DJZA 4DUWA 4HIEA 1L0QA 3P30H 4DOHE 5JZ7C 5I74B 2R15A 1U91B 5T5FL 4YHPA 4TN9A 1OQOA 3KPOB 4YAQB 2P46B 4RBPH 3SKUD 5C71A 1G7MA 1IGIH 3DV4A 3RY6A 3I75B 4LDEB 2GUOA 2DOCA 3Q6GL 3V4VH 2EO1A 1WT5A 5DJCA 3JWDH 1H15B 4B5EA 5KSUB 1GAFH 2R8SH 1NPUA 4F7MA 1TZHA 1VSCA 3GI8H 5EUOF 3DX8A 2JJTC 4KUCD 3GKZA 4GLRI 4WO4A 1ACYL 3WLBB 1Q0YH 3SDDB 4R7DA 2VXVL 1P5VA 2JJTA 4P5TB 3HE7B 4F15B 3CZFB 4JO2H 1RSFA 2Y4SA 1NAMB 2XXMB 4NO3A 4L4TE 2X2YA 2R4RH 3GM0A 4W68A 4DGVL 1F3RB 1JWUB 4O02L 4ZNEA 4WEBH 4AYFA 1ZT4B 1Y6MR 1RJCA 2HKFH 1NBYB 3H3PH 3L95A 4UAOC 3WFCH 3OGCB 4K8RC 3PGCB 4FXLA 5F9OH 1A7NH 4LNRA 2OMNA 2CK0L 5F7WC 1CDHA 1LO5B 1NFDE 2FX7H 2KKQA 2YPLE 4X6CA 3GMLA 4TPRH 4ZUTA 1JHTA 2VXTH 3WNPA 1DN0B 5C0AB 1CS6A 4KI1A 1H8OA 3UC0L 4RDQG 3TIDB 2QSCL 1UG9A 2XN9E 4RQQA 5DFVC 4PD4K 1HHIB 1JV5A 4RAUA 1T4KA 1N2RB 1DQJA 3CVHA 4JPIB 3L3HA 5DEGB 1Q9LB 1MSPA 1IE5A 1P4BL 2BX5A 4M93C 5DS8B 3UTPD 1D9KD 2CDFB 3FT4B 3QHTC 1OOAA 4KRNA 3B2VL 4NCC1 1S7SA 2CIKA 4GW5B 1CDYA 3C09C 3PDGA 1RU9L 3RTQA 2VLJA 1NBVL 1SJEB 4IJ3B 4BQBA 1OGAE 2X4RA 2B8OT 5GJTH 5KAQG 3S36X 3QEUA 1HQRB 1NAKL 3B9KA 3QAZB 4KJQD 1N7ML 1R0AH 1J11A 3EJZC 1W72L 1CDJA 5DJ6B 4NNXB 4OZHF 4XPFH 1CI5A 3FQTA 4Z7VE 4WUUD 3MV9D 4UT9L 4GJTB 5BRZE 1T21B 1CLCA 2C1OA 2ZUTA 4PJ9B 5FM4A 1MCWW 5DQDH 4AY0A 1TCRA 4M6ML 3VDBA 1UXSA 3TO2B 2YS4A 2Z91A 3QXAB 2FIKA 1P4BH 3U2SB 1R24A 1G9NH 3ZLQC 3SKOA 4PJ5B 4OF3A 2AK4E 4XP4H 5DXWA 1KTLA 3O9WA 1NMAL 4Q7DA 3M07A 3SJVD 5I18L 1J10A 3EOBB 4JFOB 1XCTB 3Q3GB 3QJFB 4L9DA 4QYOB 3QNXA 3KLHD 1MCCA 4YHIB 3FKUS 4NRXB 4U1NB 5ICZB 2E8ZA 2NZ9D 3N9GH 1JYXA 4QF1B 3MRLA 3DTXA 2PYEA 3T3ME 5DDHA 5I1LA 1E4WL 2FYYA 1UEMA 1RJZA 3PIQA 1NUNB 4IHOA 1N0XL 4EKXA 3KDMB 2LAAA 3CD4A 5K59E 1JGLL 2Q8AH 4HIHA 4A6YL 1JNNH 5E6IC 2PKDA 5BZDA 1DQQA 5D7SL 3RWIA 5IW3A 4XVUC 3F62A 4OM0L 1SYSB 3N1GC 3W0WE 1RFDH 3HE7A 5ISZD 1S9KC 3R0NA 1M05B 4L4TD 3U0PB 2VITA 1INDH 3EAKA 2X1QA 1JF6A 5T1LB 4PJCE 1RZJL 5GS1A 5CEZH 3V4VL 1LE9B 3TCLA 5HHPA 1BGXL 5IBTL 3QQ3A 5C1MB 5C7XL 4ZOEA 4U0RC 3AM8C 4M43L 1INDL 1MVFA 1TTFA 4IMKA 3CFJB 3ARQA 1J1OH 3GSQA 4NDMA 1RK0A 3ARFB 4MNHA 1CBVL 1CFQA 3GMLB 3VFSB 3W5MA 4G8EB 5MI0C 2PW1B 1X7QB 4G8GE 1CFVL 2DDQL 2D31B 3R1GL 1I8IB 3WLWD 4K2UL 1B3JA 1JRHH 2JK5A 1FNGB 3EO1B 3W81A 3WUWG 6FABH 2XQYG 1BOGB 5AAMA 4JHZA 4APQD 4YZFF 2BHUA 1QKZH 1LVEA 3O2VL 4LDLB 5HD8C 1CD1B 4KRMB 4KK6D 4N0CC 4M4PA 4Z7VA 2CLVB 3KPSB 3LZFH 4LPUA 5DC9B 1EFXB 5ESVB 3RX7A 2CXGA 3CDFA 4B7LA 1AFVH 1G6RL 5GGUA 1BOGA 1BVLA 1OAQL 5A2IH 5F6IB 4LQFH 4JFFA 3ES6A 1XR8B 1T20A 5ESAB 3CXHK 1PGRB 1A7QH 3G5VB 1QR4A 4OJFH 4UOJA 2EE3A 3OX8A 2EDEA 3WXWH 3O11B 1NDMB 1R3KB 4ORGA 2DICA 2P24B 3GJEA 3QFDA 4NHCL 2H26A 2YUZA 3KLHC 3QNYA 5DMGC 2R1XA 4KY1H 1E6OH 1G9NL 3O3DA 4HGMA 5EFIA 4OCSH 4ZOCA 5F93C 3QPXH 3MRGA 3QEQD 4PRID 4XC1H 3NFNA 4C56E 5I73C 1D6EA 2HT3D 4IRSD 3BIBX 5ID0A 2C5DC 1LHZA 4Y5VC 3WKMH 1DBKH 1IQDA 3OR6A 4LASL 3BUTA 3DJ9A 3F12B 4JN1H 3MV9E 1H3UA 3O6MH 4MDJA 4OZIE 1FVCB 1ZLVH 3VGHA 5B21A 5GJTL 4F8QA 2HJFA 4TSBL 3ZE0F 3QUYC 3IETA 1C16A 3FB6B 3X3FH 1FNHA 1ITBB 2VZOA 5I15H 1WICA 3MA7A 5AZ2H 4Y2DB 1RMFH 1XZ0A 2NW2B 3MRHA 2GSIA 1IKNA 2A9ML 5HGHB 3SOBH 5GRUH 1KNOA 2ZCKL 4LSVL 3FMGH 4O5LH 1X5LA 1Y6NR 4C57C 2GSGA 1PX4A 5CJ5A 5EUOA 2ESVB 3G6JA 3HZYA 4Z0XA 4K55A 4XAWH 4BH8A 1WZLA 1VA9A 4MA1B 1GC1L 1CDCA 3KLDA 2IH1B 1YC7A 3E8UH 4KMQA 2H2PD 3PJSB 1FNSL 5DGQA 5IR1B 1NSNL 3INUL 4Y88A 4NN7B 5J4MA 4IDLA 3U9PL 2P5EB 1QNZH 1XF4A 3QIBB 2WNGA 4A2MA 1A6ZB 1JK8B 2A6JA 3QQ3B 5F7EL 1WGOA 2R0ZL 3ARPA 2GJZB 1A2YB 1DDHB 1JNNL 1WWBX 3LQZB 1KN4L 4RFOL 4CVXA 2DN7A 2EDFA 3DXAA 3VWKB 4RIRB 3DXAD 4HZLA 3L3JA 4LRNL 4OTXL 2KZ1B 4HSQA 1RD6A 1XGRB 3SCMA 3HZKB 5DEFA 1U0QA 1OARL 4XMPL 4NQTA 1FZJB 4HEME 4OB5H 3Q48A 3FQNA 4P2QD 3PGDA 1J8HA 4CVXB 5I30H 1FFNB 2BCKB 2AABL 5DRZA 3RZCD 2CSPA 2P5ED 3L3OA 4M5ZH 4Q58C 4OCYL 4F8TA 2ENSA 3OR7B 2EIEA 2NXYC 4BKLB 4MXWH 2NY6C 4JY5H 2B2XL 3DUHA 2LABA 4ZUVB 2VQ1A 5IB2A 5D2NC 2WLYA 3EOAB 1Q8MA 4HWZA 3H6JA 3S7GA 3FHAA 1AKJD 3M17A 2YD5A 1DEEA 5E8OA 4NC1E 1KCSH 1MREH 1OAXH 6FABL 2MNUA 5CGYD 3GMNA 3GSUB 3GSNL 1EUUA 3PG2A 4JQVA 2NX5A 4G80A 4JHAL 4NQSB 3W9EB 2HTLD 4FZEL 5IHLB 5BZWB 3IDGA 1FC2D 4OCYH 1U58A 3RWEA 4KC3B 5I1EH 3U36B 1GGIH 5B3JE 3P77B 4FXKB 5GS0C 1T04B 2HVKB 2Y72A 4MD0B 5JIHA 3JV4B 1D6EB 5EWIH 1MI5A 4ONOA 2IQAB 1VESA 4BQ8A 2FR4A 3LS4H 1B0GB 3RY4A 1BZ7A 1C08B 2P5WB 4PLJD 3L6FA 4E0RB 4Q9RH 5D70H 1MLBA 2WBJA 4MQSB 4XNZC 3UEZA 4P5KA 5C08E 3MLVL 4L3CA 1ZVHA 4OLXH 4Z78A 1ZHKA 3AC0A 3ES6B 4WFHD 4XPAH 2QLVB 5BW7A 1P84K 5J12B 4DVBB 5DMKA 1U42A 1XGTB 5EZIH 1CCZA 1MAML 3B43A 4LCWB 4NO0A 4PJBE 1X5IA 3TBYA 4P5KB 3GSVB 2HFFB 4PREA 3SDXA 3ARGD 1D9KC 5EPMB 3EZJB 1EEZB 5I17B 5C0CE 3RZCC 1OP3K 4YXLH 5C6TL 5EOCJ 4KDTA 1IGIL 3I02A 1YMME 3QO1B 3F7YB 2GSGB 3KLSA 4KKAC 3VA6A 2VLLA 5JIPA 4ZTOL 3U83A 3V6FB 3H9YA 4UOW1 4IEFB 5IP4A 2EH8L 2VUOA 3CH1B 4HBQA 1MRCL 4NUJB 3HE6B 4V1DB 5IB4B 2BY1A 3WNLA 4NO3B 5DR5L 1FL6A 4JFED 3N1PC 2E9IA 1A5FL 2G9HB 5IESL 4ZYKA 3L5XL 3QEGL 4F80A 2XA3A 5MENE 3T0WA 4NRYB 2A0LD 1J1PH 3TT3L 1AR1C 3PGDB 5DK2B 3RTQC 5KVMC 4Z5RB 1GH7A 3KJ4B 3T2NH 5I8KH 3JTTB 3T4AB 1H3GA 4UT6L 4PGCB 3ZHLA 5ISZA 5K9KB 3GMQB 4I13B 2IH3B 4WENB 3BKYL 1P1ZB 1K2DA 3ZKMD 5CD3A 5D5MA 2PR4H 3ULVD 4MHHG 4F7TA 4Y4FB 2AS5M 3MRNB 3BKCL 1I7ZB 4ODVH 1T4KB 3S96B 5CILH 2CUMA 1FPTL 5I2IB 2ORBH 2YD9A 3O45B 1MAMH 3N50A 5DHVA 5EO1A 2QQNH 4OIBA 3GSUA 5DJ0B 2X4UB 2NR6C 5E08L 4PJ8C 2QHRH 1OAKH 3H7LA 3C2AL 3O8XB 1BWMA 4MD4A 4QRQA 3T8XA 5F9OL 3RDTA 1IGTB 3BEWB 2HFEA 3SE3C 1T2JA 1ZAGA 2N56A 2APVA 4I18C 1I9EA 4EDWH 1NDGA 5DUMH 5FDWA 2ZNWA 4NQVB 2AK1L 4P23C 4PJIF 3HAEG 1AGEA 4NSKA 1F4WL 4S2SB 4X6DF 3DNKA 5J11B 5FDWB 1KPVB 1M7IB 4OZIB 1II4E 4J7RA 5DWUL 5FM5M 4FQHA 3ZDXE 1U3HB 2YOCA 1TJIL 3GBNH 4FG6D 5EA0H 1KSRA 4LBEB 1T66C 5J6GB 1I3VA 4GAGL 1V3KA 1T7VA 1OD7A 3EYQC 3QG7L 4Z78B 2G5RA 5HHNA 3WLWC 15C8L 3T0XA 3UTPE 2BNUA 4NGHH 2VLRE 4JDTL 5L2JA 1YNTA 1HHIA 2VKXA 5FO7A 3VG0H 4AM0B 3M17B 4ALAH 2FSEB 5HD8D 2ERJB 4PJHB 1RIUL 4JDVB 2H3NA 4K3EL 3BVNB 4OLWH 4Q2ZA 1A9EB 1IFHH 2CUHA 5EPMA 2IANB 4NM8L 3A0OA 4X6FA 5L2JB 1AY1H 3NVQA 3S35X 1T22A 3F8UB 4NZUH 5DD3H 5DJ8B 2DLFH 3B8SA 1A1OA 1C7SA 3LKPB 1WZ1L 4BA8A 3DROB 5I1HL 3D25A 4LFHD 3CGTA 4P2CG 2QJDA 1CDGA 2NZIA 2PYEE 1CFBA 2G2RA 4JFFD 3FQUA 1QSED 2ADIB 2FBJL 5F6HJ 1VCAA 4Z7UF 2VE6A 4FOMA 4WFEE 5GGRB 1XF2B 4K9EH 2H6PB 1IAIH 2XTLA 3MYZA 1LO2H 3G08B 2NR6D 2AAVA 4N5UA 4HC1H 2YXFA 5LKNA 1RAMA 1YMHB 4HX1A 5I75B 4ODVL 5FYKU 2W92A 3JTTA 2XTJB 3G6JE 3OKMB 1S9YB 2BNRE 2W9LA 2HN7A 4U1LB 1BECA 4HV8A 2ZWLT 2LAGB 3TBVA 4LPCA 5JDSA 3BGFB 5IHUH 4YR6B 1FGNH 2JJWA 4LSSL 4JFEA 4QHMB 5ICXB 5CEXA 3PP3K 4LPWA 2R4SH 3DYMA 3QXDA 2DLGA 4UV7H 1BQLL 3OWEA 4PREB 1RU9H 2YN5A 3MUGB 2E27L 2V17L 4QHUB 4U6XA 1JYNA 4XGZA 2VTFA 1ZMYA 3BPCB 3ABZA 2VIRA 4QRRD 2B1HH 3VFWA 1SBSH 2BVQA 4QRQB 4U1JA 1X5JA 4PBWD 3I3BA 3RKPA 2R9HD 5EO1B 2PETA 3MJ9L 3X12A 3U0WH 5I71B 1UFUA 4X7EC 5D1ZA 3CLFH 1CDUA 1MNUH 4KJYA 4MMXC 4XXCC 5EU6D 3ILPB 5IGXL 1S9XB 2IGFL 4QY8B 3PL6C 2EE2A 5I9QC 2V9RA 5DO2D 5I8CB 3KPQB 5C7XH 2BSRA 1IZJA 4G6MH 3BP6B 2ARJQ 2MCPL 2R2CA 1HE7A 1NL0L 5DSCB 3CVIH 3OZ9H 4LNVA 1LDPH 3P0VH 5C0EA 1XGYH 4K3JH 4GUPA 4F57H 4UBDD 1AXSB 3PWJB 1KV3A 1ZXQA 2BSRB 2BVEA 2NY0D 2V7HA 2ZUQC 3JWOC 4HIXL 1U8OB 2AQ1A 1FNGA 1DBKL 4OCRL 5GPRA 3QT2A 2AJVL 1VADA 1HSBB 4IIQA 2ZUUA 2YXMA 1FYTA 3GBML 3N85H 1T1YB 2ZSVA 4Z7VB 3MUJA 1JPFA 4POUB 1LO4L 4U6VL 3WV0A 1FZMB 4KY1L 3MV8E 1GL4B 3S4SG 4N9GA 4KK5D 3H42H 4FQPA 5DK0A 3ZHDA 5DFTA 3AVEA 4S10A 1UVQA 1FYTB 4E9LA 3T65B 2FBJH 1B0RA 2L4OA 4PV8A 4BQ9A 1Z9MA 2R2BB 3WJLC 5DRNA 1JN6B 3CFEA 4PBVC 1FNSH 2J6EL 2LU7A 5ETUA 5F3HA 2MCPH 5KSVA 1Z6JT 4PV9A 2WV3A 3FCTA 5ITBL 5TFSH 1ZA6A 3BW9A 3D9AL 3V95A 5IFAL 5D1XB 5IW1B 5C2UB 3CMOH 3M1BB 3VXQA 2ZP0T 3NOIA 1NLBH 4M61A 3JV0A 4WIQA 3I6GB 4U1MA 1MRFH 4HIJB 2FJHB 1YEGH 1C12A 3DXAB 3V0WH 1FNFA 3LKSA 4NKMB 3B3IA 3NZ8A 4XZUB 3D6GA 4MAYC 1QRKA 2YZ1A 1HHHA 3BP7B 3V5DA 1IILE 1P69B 1RZGB 5I30L 4YWGL 4EI5C 1CXHA 4QHKI 4JVWA 4CMHB 1IGFL 5FYLD 1MRCH 4LPVA 4QT5A 1QFUL 4G7YH 4M8VA 4WJ5B 5C0DB 1N3NA 5HHXL 2CLZB 1MHPH 2ZUVA 2DD8H 2LV4A 3FRPA 5DYOA 4HXAH 3O6FD 1CXLA 2EDBA 4NO0D 4JO1L 4OF7A 4WU5A 3BSZL 4PRNB 1YUHA 3AU1A 3QXDB 2A1WH 2P8MB 3BWUC 1RJLB 1IRAY 3IJYA 4XP9H 3PJSA 4K23H 3ARGC 3CZFA 1QBBA 4XPAL 4Z76B 2JELL 4L8BA 2AJ3A 4TSCH 2R2HA 1GVIA 3QDMD 4WHTA 1W0VB 3OB8A 4JFYA 4J3VA 3V6ZA 2IPUK 2HAZA 5H37H 5GSRA 5FYLH 3Q6GH 4LFHG 3ZMRA 4N5EC 5T3ZL 5C09D 3IDNA 4FP8H 4NKIH 4U1LA 5I1KH 4XNMA 4Y8AA 3B9DA 4O00A 1T7YA 4YHLL 3PGCA 2A0LC 3OBAA 5I6XB 2YPKA 5I16B 1HIML 2Z92A 2JTDA 2I60H 3RTQD 1UCBL 5GHWL 4GG6F 3VFVA 1NLDL 4TOYH 3VRJA 1NMCC 2FGWL 1Q9KA 3PWPA 3QIWD 2CLRB 1MEXL 3V5KB 3EJYC 3A6CH 5HHOA 5JIIA 5IG7B 1UVQB 2R0KL 3K74B 2BVPB 2G5BB 3LKOA 1GCFA 2D3VA 5CEZD 4MAYD 5A43C 1JGVH 4PUBL 2XPGA 1MJUL 3L5JA 4HC1A 1EO5A 1G9MH 2OR9L 3ZE1F 2CO6B 2PO6D 3OKYA 4IS6B 1H5BC 4GBXB 5CJBA 5EORL 4HKZA 3LAFA 2UUDK 5CP3A 5DMJB 4TSAL 4MSWB 5GGRY 2BOCB 1HQRA 3B9KB 4OGZA 3D85A 4HK0B 4P2OB 5ACLA 1G7QA 2WBKA 1KJ2A 1NBZB 5HGDB 5KVEH 5SWSB 3QH3B 4MD0A 5EO9B 1SJHB 3RBGA 5D93B 4YXKL 2BRRH 4FFYH 5F1IB 4B7IA 4ERSH 1ORQB 1SM3L 1IAIM 1RZJC 1HHJB 1T1ZB 2B5IB 1U2CA 2WWKO 3OKDB 5HYIA 1U91A 3GGWB 4EXKA 2QQNL 4TVPH 2GYSA 3U0TB 3UX9B 3HLAB 5LBSH 2VQ1B 3D3VE 5IHBA 1AC6A 5ANMB 4OUUA 2PF6A 2OR9H 3EOAA 4PGEA 3LS4L 4M4RA 5C0DA 1PSKH 3ZKXC 5IM7A 1L6XA 4AG4H 1D5BB 4M00A 3PE9A 1W0YT 4RMUA 4L4TA 5JPMA 5CJQH 4FFVC 2WIIB 4AMKH 2YEZB 5ERWA 1UB6B 3T0VA 3QDJB 5L9DH 1TNMA 3S35H 4ZNEE 1A3RH 4U1KB 4YGVA 5F96L 4YQXL 1CR9L 3S34L 3IDGB 1K4DB 1QFPA 2FH6A 3RVVC 2VL4A 1RHHB 1NC4B 1I9IL 4OFPA 5C0BA 5IT2H 4JJ5B 3VXPB 3ZSTA 1KIQB 2OP4H 5DUPL 3CDGB 1ONQB 3HC0A 3QUXB 5GQBA 2C4FT 5D8JL 1VB9A 4MCYB 3N0PB 1FO0L 4OF6A 1E28A 3OAZK 5L8LB 1JGEA 3AM8A 2DS4A 1WIPA 1E27B 5DUML 3PHQA 4IOIB 2YRPA 1TVBB 4DJMA 3V7AG 4I0CC 4TNWF 5L6YL 4MLSA 1EHLH 4ISVA 4ERSL 3EYSH 1AGCB 3BI9X 3WJLA 1MIEH 1YEDA 5I1DB 2ITCA 1OP5K 5BJTB 1LE5B 3I3DA 1BFOA 2D0FA 1XMWA 2HP4A 2C1PA 3VD9A 3TO4C 3FAXA 3QQ9D 4O2EB 3DVNA 4LHQB 1BX2B 1MFCH 4P48A 1F58L 4DZBB 1UJ3B 1RURH 4Y89A 4OZ4B 3FQWA 3CC5B 4J2XA 1ES0B 3ARDA 4RISH 4RGNE 1BD2D 2AXHA 3REVB 4I9WE 1KLUA 1CLZL 2R29H 5I2IA 4ZFGL 4O2EA 1RJLA 3VMOA 4WHYG 1KCKA 3FZUC 4GG6E 2ZPKL 4I18A 4YC2C 3K1DA 4PY8I 4ODTH 4R90H 4LCCB 4X7FC 2R69H 2LVCA 2QSVA 2FRGP 1MJ8H 4NQDA 4ALAL 3W2DL 1AFVL 1A1OB 2M2DA 4XPGH 4HUVB 4IRSC 2HLAB 3BXNB 4YPGA 4ZTPL 5HVGB 1HINH 3U1SH 3JTSB 2QBWA 3VFTA 3W39A 5BVJA 4PB0L 5KS9E 5D1QB 5B38B 5BXFB 2VDPH 5EA0L 3NIDF 1S8DB 2OJEB 1EJ6A 1P2CA 3KVQA 2UZIL 4PP2B 4UT7L 4NJ9H 5INDB 4ELKB 3H9HA 3QUYD 4Q6IC 3U0WL 2VO5A 1XGUA 3U0TA 4OM0H 1B9ZA 1A2YA 2FWOB 2OZ4H 3BQUA 3HI1B 5SWSA 1U95B 4KXZI 4WU7B 5JHLH 3VD5A 5AWNL 1UM6H 4NC2B 1RZJH 1MFDH 2EKJA 5EBLB 3JUYA 4G5ZH 3M8OH 4YR6A 1NH6A 4W6XB 4O4YH 3UPAA 4FNLL 1JZ2A 3IAGC 1W0WB 4ZXBC 1VFBB 4BSVB 2F54B 2I9LA 1QR1A 1LDSA 4KUZL 3O6LL 1GHFL 2ADFL 3TWCL 3O3BB 2UZYB 3L5WB 4I9WD 2PNDA 4G6AD 3WSQH 4DVRH 5JW5B 4MB3A 3MLTB 5EB9A 5EOTB 3CK0H 5FV2A 3DMMD 4HC1L 1QSVA 5E00B 3BIAX 5KW9H 1MIEL 2FL5A 3KJ6L 3MLZL 1PFCA 4UIKL 3GNMH 2OL3A 2YUWA 3WE6B 1IEAA 3U79A 4EUPG 5SV4A 3L3KB 4JFPA 2YC1B 1AP2B 1IJ9A 4GKNA 3VFPA 3BPNC 4PJEF 4UB0L 1CLOH 3AREB 5BW7C 5D7JD 2OYPA 4PJFA 1T3FB 4JKPL 4P46B 4WWKD 1CK0L 1V3JA 4JFQB 4WHDA 1F42A 3W9DB 2EE9A 3ZT6A 3NFSL 3RWGA 5E56A 4Q2ZB 2GFBB 2ITDA 4ZSOA 4K71C 3UBXG 1MCIA 3IFPB 4L4VD 5IFJB 3BH8A 1TVHA 1E4XI 1JPTL 2CDEA 1NAKH 1R0AL 3SDCA 4RZCB 3WL9B 1HXYB 1FZMA 1ZSDA 4UUJA 2Y5TA 2V17H 3RVTD 5IEKB 3MV7B 1MFAL 1CLOL 3KWWA 4TSBH 4CUCA 1U9KA 3BHBB 5CEYA 2VISA 4YDVA 1DCLA 2V2TA 3QUYA 4DZ8A 1ETZA 3HHRB 3QI9D 3EOTL 3GIVA 1KG0B 4WW1B 3RPIB 2H6PA 1EJOH 4YZFE 3SDAC 5F7LB 1E0OB 3VXUE 3DI2B 3OKOA 3SE9H 4P23A 3HZMB 1IQDB 2ZG3A 5I1JH 1FFQA 3FQTB 5HDOA 2P8LA 1T21A 5JMOC 2CJUH 1XH3B 1U8IB 2HKHL 4ZXBD 1P2CB 4M9OA 4F58H 4YX2H 2JB6B 1RJYA 1FO0A 4X6EB 1L6ZA 4HUVA 3BZFA 2JJVA 3L3GA 4XCNB 1UZ6F 4J1UA 4D3CH 2FJGA 1OCWL 5J56B 3MODH 4PRBB 3VD4A 1ADQL 2A74A 5FIEA 1B88A 5F7EH 2Y7QB 5KJRH 3STLA 2FWOA 1NANI 2VDNL 5C0NC 1F90L 3FB6A 3QHFH 1T04A 4YXHL 4MJ4A 1R3JA 3LD8B 3LKSB 3GUTB 2WUBH 5E24E 4I0KA 2MHAB 1LNUB 4GT7A 4NRYA 4PG9B 5AZEL 3CXHJ 5GSVA 5CBAA 1QKZL 4OZ4A 5CGTA 5GRUL 1HKFA 1F6FB 5FGBA 2GJ6E 3PV6A 5DRXA 1JPTH 5IHZB 3EHBC 4IHOB 3LN9A 4QHNB 5D7JC 5EBMB 3MRMB 2GEEA 3QDMA 1P5UA 4KV5E 1BQHB 2PTVA 2OLDA 1QYGL 4RFEA 3OGOE 4WI3A 4PJDE 2BNQB 2APFA 1IZKA 2R0KH 4I0PC 2XQBH 2ZG2A 1J1OL 4N8CL 3WFEH 1M4KA 4ZUSB 3UO1L 3IGAA 1IAOB 4EVNA 4BZ2L 1OAYH 3DV6A 4Z76A 5BQ7A 3GSNH 5C8JB 1KN2L 5IHUL 4PB9H 3AB0C 1XT5A 3RWJB 3AMLA 4PRHE 1KIRB 2R4SL 4TNWK 2VLLB 4K3DH 3K8KA 4QWWC 1TQBC 1RQ5A 3ARED 3CH1A 4NUJA 4FHBD 4ZO9A 4NWTL 1AC0A 1KCRH 1QHOA 4HLZG 4G9FE 3L9RB 3SO5A 2B4CC 1G7PA 1LD9A 4RGOH 2LTQB 4KHXL 3VGDA 1ZE3C 1WAAF 5JO5A 4PJFB 4L4VB 3KJ6H 1KUMA 3RA7L 4R97C 5D2LA 2F54E 4M1CD 5GZNC 2GK0B 3L3IB 3PNWA 3CFCH 1IL1B 4R9HA 4DKFH 2I9LB 1QR1B 3TBTB 2XWTB 5DEGA 5HJ3A 2XT1B 3LB6D 2R39A 4O9HH 3TJHD 1MY5A 1OGAB 4PJ8D 5SV3A 4UNVA 3U4BH 3GI9L 1Q72H 1NCCH 2J88H 2DWDB 1DQML 1WCQA 3P2TA 3MLTA 3OX8B 5I8EB 3ARXA 4PJHA 1YJDH 5FGRA 3FO2A 4LLVA 1WLHA 2APWA 3V8CA 1CD8A 5DHVB 4LPXA 4BSWB 2RBLA 4MA8H 4HHAA 3TN0C 2F9BT 4PLNC 1VGEH 2JCCB 3IS1X 4PJIA 2CKBB 3RVVD 5KVGL 2ADJA 2NY2D 1FIGH 5C0JA 3VA2C 1AXTH 2W0PA 1XH3A 2W60A 4HAFA 4PJ8A 3NFNB 5HDBE 3LEYL 3UJJH 5IK3A 1TJGL 1UXSB 5J13B 4KKNA 5KSAD 5KS9B 1NMBL 4ODWA 3MLSH 4LGRB 4XVTH 2VR4A 1YPZF 4JO4H 1FSKC 2AGJH 3EFDL 3UTZB 1QBMH 3D3VD 3Q6FA 4DKEL 3HR6A 5K9JH 5I0ZA 3WIIH 4KJQC 5DUBB 2X89A 4OV5A 2Z8WC 5EH1A 3O6FA 1PAMA 2AJUL 1JI2A 3BMVA 5ITBH 4MXWL 1J0HA 3P4MA 2P8MA 3VXOA 1NCTA 2VLRB 3MLRL 5T33L 2IC2A 3G9VA 2JF1A 1OW0C 2FX7L 1RUPL 2AQ3A 4DN3L 4P3WA 2QQQA 1JI1A 1Q0XH 5JNYA 1S9WB 3G9AB 4X0KB 4HIHB 1EFXD 3MNVA 2AJYL 3C6LD 1CZ8H 5A16A 2YPVL 2GTZB 2VDKL 4RFNC 2WWKT 3E6FA 5DJ2B 4UILL 3MXWH 1U8PA 3ZE1E 4UTAH 4PS4L 5DQ9A 1H3PH 1NCDH 3V8OA 1FFPA 2DAVA 4P4KB 1D5IH 5J0BA 5JNYB 1YPZA 4QOKE 5D7LE 5EU6B 2AI0H 2APTA 3BPLB 1FVEA 2XYCA 1F4HA 1CGSH 1A9BA 1HZHH 2A38A 1KB9J 1PLGH 1ND0A 1FNEB 5FFLA 3BISA 1MHPL 1QOKA 4OLWL 1EFQA 1CE1H 3JWDC 1TITA 2AJXL 4LHUG 5MEQA 2R23A 3T2NL 3BMWA 3MACL 4J3XA 1S9YA 3GKWH 4HG4J 4GAJL 3K8MA 3THML 3UTTB 1FNEA 5EU3B 3T1WA 2NY2C 5GGQL 3O4LB 4PJ5D 3PWLA 3B5GA 5F96H 1VEPA 2AP2A 3OJVC 1IAKB 3ZDYF 3WCYA 4Q9QL 4NJ9L 1INEL 3P4LA 3DVFA 3LN5B 4MQXC 2PCPB 4QHNA 1AD0A 3RIAK 4H20L 2OTUA 5HHVL 5DRWA 4F3FB 3O4LA 1C5DA 4QRUB 4RFEB 1F3DJ 3KPNA 4Q9QH 4GBXA 4HUUB 2H45A 3U48A 4FQJL 5GIRA 4LVHB 3HG1B 1QBAA 3L3HB 2IAND 3LEYH 2QADC 4X80H 3GMRB 4UQ3A 3GJEB 4TPRL 1TJIH 3GBNL 5DURB 4GRLC 1DBAL 1HYRC 5HYSA 1B4JH 5IMKA 3ZKQD 1EVTC 4RGMB 3ZTJG 5D9SA 3TA3B 1DTUA 2Z35A 2BHYA 5TE7L 1WBXB 4OF5A 4WEBL 4ZFGH 4N0FA 1I4FA 4EIZC 3ARRA 5ID0B 2BY0A 3HI6L 3JTSA 1QSEB 2F19L 4V1DE 3STZA 4EI5A 3QA3B 1HI6B 5D1QD 1DQTA 1DQDH 3MSPA 2BNRD 2FEDC 1SEBB 3IVKA 2GY5A 5BS0A 5I73B 1WCBA 4ZPVB 4Z7WB 2Z31C 4U6TA 3NCYS 3V9FA 3SHSA 3WHXA 5ADOL 2OK0L 1WBXA 4LSUH 3SGDI 4LKXA 4Y5VB 4JRYD 1KGCD 3SN6N 3T77B 3LKRA 5JW4Q 5JDJA 3OSKA 4HIJA 1D5MA 4YNYB 2ITCB 3EDFA 2Q76A 2XA8H 4N1CA 1A7OL 2HT3C 3UTSD 2Y06H 2N7BA 1C5BL 1KEML 1CLYL 5T1KD 3KPSD 2IALA 4WCYH 3MA9L 2W1NA 5FKPB 2N7AA 4KK5C 4XP4L 1ODAA 5F9WC 1AQDA 4APQB 1AY1L 2B20A 5FYJL 1JRHL 5C0CB 4RX4A 4ODXA 5HY9A 2FHFA 2X4QB 2X4OA 5B8CB 1JRHI 3NTCL 3QRGH 4NQEA 2IAMB 4JG1H 5D71H 3QJHA 3G6AB 3PV7A 2YWZA 3BD3A 4YHYC 1WUNT 1NCWL 4OLVH 5FUZL 4HJ0D 5J3HC 3CU1A 3FFDA 2X1PA 3DGGA 3VH8G 4MNGE 4YPGB 5ACZA 5TDNA 1JNHA 4G9DA 4ZG1A 5B38A 5BXFA 4JQXC 3X17A 4D0CA 4HAGA 2VAAB 3ARWA 4LVEA 4OZGE 4MCZB 4U2YA 3WS6C 4P3DB 3FB8B 3RAJL 1IEAB 4YDJA 1FVEB 1IEBB 3CK0L 1V05A 3KGRA 1QPXA 4MJ5B 1E6JH 4EDXB 2BRQA 4CADA 2UY7A 4LLQB 2WWMD 4NNPH 3BIKB 3B9VA 1MAKA 5A2JH 4PTTB 1LEGA 1KLUB 2F5AL 1B0WA 1XGQA 2R56H 4AIXA 5HHQB 2WUBL 2HJLB 2JK5B 4C4KT 4OCMC 1Q94B 2YSSA 1ZVSB 1EJOL 5CSBA 3KNBB 1BM3L 1G7LB 4OD1H 2QQKL 1OHQA 1XF3B 1MCRA 1UH4A 3G5XB 1MUJB 1PG7L 4OM1H 3REWA 1LEKB 4M6AA 3WD5L 4KFZC 4F57L 4KQ3H 5CP7B 4W4NA 5JORB 3BWAA 4ZMAT 2R4RL 5C07D 3D2UA 3GMNB 1M1SA 4QXTA 3LZFL 3JUZA 3CAFA 4A6YB 4JN2B 3FFCE 4IMLA 2BERA 4LLDA 4Y5YB 3SOBL 2NY6D 3DYPA 4ELKA 2HA1A 4RNRA 3RAJH 4KDWA 3SGKC 4M48H 2Z91B 2DLHA 4JCLA 3J8F7 3FOMB 4JFDD 4NNXA 2X9YA 5IMKB 5HYJA 5C6WH 2VC2L 4RGNC 2Q86B 1FGVH 3PWJA 3R8BB 4PB9L 3ZL4H 3VXUD 4Y19E 5CEZL 3JSSA 3VD7A 1AKJA 4WFGD 4JQVC 1HI6A 2FEEL 1C08A 1MCBA 1YA5A 3VFOB 2A9NH 1OVZA 2DMBA 4I3GA 4LSQH 4KI5D 1HHGB 4XBEL 5ALBL 4ZPVA 3PWNB 3GSXB 3MMEB 4XB8A 1FHGA 4LHUB 1FQ9C 1K6QL 2FX9L 4WFGE 3B2VH 4KDVA 1Q9KB 3U9UB 3EOBA 4JFOA 4AEHH 3TT1L 5AEAA 1ZHKB 1M7DB 3DVGA 4HEPG 5IG7A 3NGBB 4K94C 1NCBH 3HG1A 2FSEA 4N68A 2ZCLL 1RULH 5JW4N 3SDXE 5EOTA 4ONHA 4PGDA 1Q9OA 1I1AA 5L0QB 5HHNB 4MJIA 4X6FB 2EKSA 4LQFL 2FCBA 3ALPA 4HPYL 4BFEA 4XC3L 5ESQA 4LIQH 4N1EA 3PWUB 4JVUA 2IADB 3MODL 3N1FC 3F7YA 2D7TH 3SCMC 2ESVA 5CSGA 5LVEA 1KIPA 1NSNH 3INUH 2IPUG 2IFFL 4U6VH 1EAPB 1MWAA 3BH9B 2D9QB 3L1OL 4NQEB 3C2SA 3STZB 2KL6A 2YMXL 4WWKA 5JQHC 3WS6A 4LDOB 3ARFA 1LP9B 4GRWH 1XIWC 3OG4B 4JKKA 1DBBL 3PWUA 3QCUH 1N4XH 1K9TA 1LO3L 3D3VA 1RUML 3QDME 3QIUB 4G8EA 5L88L 4PJGB 3H9SD 4Y4KB 3ZZ1A 2PTTA 4HWBA 4XPTH 5DD0H 5E95B 5GS0H 4Y0GA 4NOFA 3VFMA 1NBZA 4UDUA 1BZQK 3VJ6B 3AGVA 5TPWL 2WK2A 2O61A 4LSQL 5ALBH 3SDCB 4PJDB 4YJZL 4R0LA 3TFKC 1ZSDB 1YECL 4O58L 2EDKA 5FA4A 3ZE2E 1A1MA 1BBDH 4PRHA 4HK3N 4FFVD 3FQNB 4Y4HB 3EFFB 3MBXH 1GC1C 3U7YH 1TQCB 4J4PA 3PGFH 2AJXH 5FGBC 1BMGA 3TBTA 5KS9F 3PHSA 3SBWA 2OCFD 1D5BA 1ZVSA 1NCCL 4D8PB 3CFBA 2X4UA 4ZD3L 1KPUB 1W8NA 4HIIA 2BVUA 3DIFB 1U6AL 5ESAA 3O3AB 5FGSA 3UTQA 4YE4L 1K4DA 5L8JB 4QCIB 4M93B 4O9HL 4KVCL 3ULVC 2HG5B 5IOPB 4MYWB 2Y7QA 3FOMA 4JHWL 4ZPTA 2JIXD 3BN3B 4JRYE 3O8XC 4JO3H 4Z0BL 4BM7A 2E7HA 3MCLL 3LRHA 5C0GB 4HF5H 1ADQH 2I9TB 1S7UA 4U33A 2P4AB 4IMLB 2DWEB 2BOBA 2H32A 4JHWH 5HYJD 4BQ6A 4YDIL 5T33H 1N5AA 4I5BA 4K3HA 3UTSE 3BZEB 3CMGA 1I8KA 5F6HI 4X83A 5HYJB 1SJVA 5FUCE 5DQJA 3UPCA 4PG2C 2Z4QA 5JPNA 4UILH 3MCG1 3MFFA 5EBMA 1Q94A 2YSSB 3X13A 3CUPB 4ZOBA 1HYSD 5C0FB 1XF3A 4KROD 2MWCA 3A6CL 1U3HC 1IT9L 4KHTL 4NC0B 1PYWA 3EDEA 1AH1A 3QQ4A 2OXHA 5E0QA 1S7VB 5CWSA 4MNQD 4AT6A 3MFGB 1HEZB 2H3NB 1BIIA 1UQSA 4CVUA 5C0RH 2F8XC 3QXVA 1IC7L 4KTEL 2AV1B 3WFDL 2W0FA 4XNXH 4N9OB 3CSBA 2A6DA 4LIQE 1UACL 2C3WA 4GW4A 4FG6C 5EIVA 3REVA 5KSAB 3V0VB 1T66D 4KMTH 4TQEL 3LQAC 1NAML 2NXZD 4RMWA 4HPOH 2QADD 1JWMB 2QV2A 1QPPA 1OAXL 4R4NC 3FFCD 1HWHB 3KS0H 4FP8L 4OAWB 1BFSA 5CINH 1RIHH 3SKMA 4IRJB 5E8DH 1YNLL 3V0VA 3L3JB 4S0SD 2HRLA 2FJFB 1MCNA 1T1XB 5DRNB 1XGRA 3MJ9A 4YDKH 4JM2A 5J1TC 1WWAX 3X14A 4N8VG 2C3GA 1SYSA 2O5XH 3DOSA 2QEJA 4KZEL 3G08A 3OV6A 1TIUA 5C0RL 3HLAA 4X6CE 4P5MB 3LN4B 2J1KA 3NACH 1TZIB 5JXEC 4HDIA 2B0SH 5IIEB 1MFBH 1KELL 4HK3J 3QDHA 1ACZA 2R69L 2YZ8A 5J6HA 4LSUL 2EIZB 1XGPB 5SWZD 3ALXA 1R24B 2NY4C 3AY4C 4EXPX 3O8XD 4IDJH 3WFZA 1Z5LA 1I3RB 3P9WB 1BVKA 1YYMH 4G42A 4ZDHA 4WU7A 2OK0H 3ROOA 5F1NB 3DETC 3CXDL 5GRJH 4IDJL 3B2UC 3QZWA 2VXVH 1QA9A 2ITDB 1RI8A 4FZ8L 2F19H 2K7PA 4ZUVA 4L4VE 4WUUB 3RGHA 1U8NB 1PG7X 2I24N 1BVKB 4G42B 1KIQA 4GAYB 1RUAH 4FABL 1RZIA 5IEHA 4F33B 3LH2H 4Z7NE 5A3IC 2OXGA 1CFSA 5IEKA 1HYSC 32C2B 2HG5A 1G0XA 5IOPA 5DJ0A 2MSPA 3L7FB 3EYFA 5EORH 3WEXB 1KJ2H 3PHQB 4KJYB 3VXTB 2O5YH 4YPJA 4IJ3C 4MQ7B 1GGBL 2I9TA 3BN9D 5IB5B 1MWAL 3KPQA 3FN0L 4OZFH 2I25N 5I1IL 5MEPA 1QVOB 1UT9A 3UYPA 4QCIA 3MBEB 4K2UH 2E9JA 2QKIA 2VDLH 3WIIL 2Y6SD 5IT2L 4L8DA 2FL5B 5BS0B 2VDPL 4U0QB 3KPMB 2FZ3B 1LO5A 4D9QD 1WFTA 2IF7A 2XFXA 2XN9A 5F97E 2YWYA 3MRGB 1HDMB 1TTGA 1JHTB 1PD6A 1CF8L 3ARFD 1DP0A 2GY7B 1AIFA 4MVBC 3QDAA 2G60L 2FJGB 4PRAA 5DA4A 4MB5A 4P9HC 1LK2A 1T5XA 5A40E 3DMMA 1MCOH 4YQXH 5TE4H 5D7IB 1VGEL 2BSTB 5KVGH 3LPGA 3WUWB 2EIDA 4U6HA 2AQ2A 1AXTL 4BFIB 4ODBD 4CKVX 1YY9D 2W9EH 1A6TA 5HDBF 3TV3H 3JVGA 5E7FA 1INQA 3RFZC 5DJYA 1BIHA 3KHQA 1P9MA 4FQ1L 4CN6A 3HI6H 4XT1C 2GIYA 1GIGL 1ZANL 3PP4H 4ZS6D 4TUKH 2ADGA 1HEZA 1MH5A 4HT1L 4M7ZB 3VG9B 1MFCL 4OSUH 5FCSH 4QTHA 3KWWB 1INQB 1KB9K 3HE6A 4YBLC 1JF1B 2E7CA 1UH3A 2APBA 3QULB 3EYOB 2KDGA 3D69A 4I3SL 4L8SA 1J0JA 3HCVB 3GRWH 5A2KH 4HKBB 5LGJA 1SYVA 4XVUD 1HILB 3MR9A 1A6PA 3UDWC 4X5LA 2R1XB 4IS6A 2P48B 3VRLF 3GSQB 3KPTA 3BYYA 5CILL 5EZLB 2AK4D 3HI1A 3WHXB 1OSPL 1IAMA 4H5SA 4PRHD 3MROA 1IM3B 4BYHA 3EDJA 3I84A 4JREB 5FYJU 5HSFA 2UZIH 3GMQA 4S1SL 3VWJC 2VERN 4NOBA 5C9JA 3BKYH 4LK4A 3SDXF 1JNJA 5BOPA 4P9MH 3VGAC 1ZT7A 4E41D 1TDQA 2J4WH 4S1RL 4BK4A 4E5XB 4WV1B 2HLFC 5AYUL 1NCAL 3OKNB 3V0AC 4NO5B 2NYYD 3P9MB 1BIIB 3NH7H 4P0DA 1MJ8L 2AV1A 5GGUB 3MLYH 4BJLA 1A0QL 1AJ7L 1CQYA 3H9SE 1NC2A 2VDQL 3I50H 1CU4H 3SJVA 4M7KL 1AXIB 1UM5H 1MCSA 5JW5A 4KK6C 4N0CD 5D71L 2AVGA 3FN0H 3EDDA 2HFTA 5F6IC 1VEMA 2NXYB 4NKDA 4EN3C 4OLZH 4L3AA 4PLKD 4UIMA 3MXVL 1LO4H 1LK3L 2VJXA 5D7LD 5DD1H 4FQ2L 2JCCF 3DRTA 1Z0NA 3DX9B 3SJVB 2DQGL 1EPFA 1S78D 3FB7A 1H8NA 1DEEB 1LE9A 4HULB 1EXUB 3MV01 4MD4B 3VXNB 5T3XH 2WLZA 3EJJX 3O6FC 4CRPA 1F3DH 4PJIB 3W11C 3P40A 1A7NL 3LN4A 2WIMA 3KPRA 3SE3A 4FQLL 4X9HA 1KIRA 3SGEI 3IDUA 4K3JL 1IC5H 5IROC 2OMBA 1OAZH 5CCKL 4M1GH 1CGUA 3M8OL 1RULL 4X5WA 4LSPL 1AGCA 3MGAA 4ZNCD 1FV1A 1W8OA 4P9HH 1NUFA 1OCWH 2OI9B 3IF1B 5F44A 4PRPB 3QO0B 2F53B 3KLAA 1WZ1H 3KXFE 5GRXG 3QUML 1K8IB 5D7KD 4KUZH 1J86A 3HPJB 1P7KB 1ACYH 5DJXA 3HZKA 5DEFB 3LB6C 1S7TB 5FF6A 3KYOB 1A21A 4HS3A 1TPXC 2GCYA 3BDXA 2J8UB 4PJEE 1BOYA 4R26L 4U05A 2CUIA 4G7VH 3V5KA 2R2EB 4KDTC 4Y19D 4DEPB 1YNTB 2KQNA 1FORL 4ZAKC 5FO7B 4QRPA 3C6LB 4WWID 5FECB 4G8GD 4TRPL 3NFPB 1RZ7L 1S9VB 4FZEH 2XWTA 3OB0K 4JY6A 3RDTD 3DYOA 2CK2A 5D2NE 3OKOB 1PKQE 2VDMH 1FZKA 1YEIH 1PQZB 5IGXH 1BP3B 4O2CB 3BESR 3C6LA 3R8QA 1H3XA 3H9ZA 3S37X 1ZT1B 3E6FB 4LEXH 3HCVA 3D25B 1HXMB 1FL5A 3FJTA 1JZ7A 1CIUA 2A74B 3HG1E 4O51A 4N0UE 2BY2A 3C5SA 1L0YA 4PTUB 4CVWA 5DVMA 1RUMH 4V2BA 3WFDH 3VWKA 4C56B 2HWZL 5FYJH 4UB0H 1BHGA 4XP5H 1YMMB 1UM4H 4JKPH 3SJVE 3OKDA 2DJUA 2PO6C 3BDBA 1VFMA 4NKOA 1C16B 3VWKC 3CNKA 2V5TA 3PWVA 4LSSH 5HGAA 1YYLH 3G04B 1WK0A 2R23B 4JQXA 2NY1C 4P5TC 3C6SA 4PD4J 5FKAB 3WIHL 1NGPL 1U3JA 1N8ZB 3BP7A 5TF1L 1BEYH 4HFUH 4D0BB 1UWGL 3NA9L 2AJVH 4TSAH 4HD9A 4P3CH 4WV1A 4YBQD 3VGEA 3LS5H 1KLGA 3QDJA 4RAUB 4XX1G 1K8DA 3VRIB 1A7RH 1URLA 4BSJA 3Q2CA 5DQ9B 4N0RA 4FTVD 3VRLE 3WIFA 1K2DB 4Z7OF 3U30C 5CD3B 3X11A 1NC4A 3O3BA 2P5WD 3CFBB 1T89C 2DM3A 1A7PL 1WZKA 2DQDH 2ICWA 2IPKB 3TA3D 1KLGB 3EYOA 4YFEA 1JHLL 1EXUA 3DXAE 5IESH 2OJZH 5L2KD 5E7BA 3O41B 4EN3A 3X12B 3DARA 4OFYD 3UO1H 3IU4L 3U36A 4P5TA 1U2HA 2ZNXA 4ZD3H 2MOVA 1D5XA 1T2QL 3WO4B 3GM8A 3RL1A 4YK4B 5FYJE 3V0WL 5IMMB 4C4KO 3SGJA 2PXYD 2SEBA 5CINL 3MLUL 4JB9H 5BCAA 1P6FA 4Y4KA 4JFYB 4U1SA 5DD0L 3C09B 5GS0L 2HTKD 4JQIL 4JKMA 2YA0A 1CICB 1RMFL 5MERB 3V5HB 3DBXA 2AXGB 4OBRA 1M05A 1WV7T 4G8IA 4JANA 1T83C 1QLRB 5GRVL 2VR5A 2X4NA 3V6OA 4X7CC 4CNIA 1T0NB 3FO0H 5K33A 3MC0A 4M8QB 3FQXA 3X3FL 5DFWH 5C0IB 5GS2H 2F74B 3ZHKA 1SEQL 2AW2A 1I7RA 2ICWI 3EO9H 1F5WA 4ACPA 3HNTH 4S2SA 1MPAH 3MRKB 3CFJA 4MJID 1QFWM 4P2QB 3KYAA 2J8UE 3MV8B 4TTDC 3LPFA 3GSWA 2VLRD 1QQDA 4QRSA 4N0UA 1X6LA 2ZSVB 2PW1A 5DHXB 1KIPB 4AZ8A 1QUNA 3MRCB 1YDPA 5DZLA 4GRLD 3B2UD 4M7JH 4ONFH 4PR5A 4BSWA 8CGTA 2CDFA 3HS0A 3NAAL 3VWKD 3QEHB 2H8PA 2V2XA 2HKFL 5SX4H 3UXFA 1FZKB 5IBLC 5HHOB 1MQKL 4ZAKA 3RU8H 4U3HA 4GMTL 1JWSB 1A3LH 3BSZH 5FYKD 3V7AE 5IVXE 3HC3H 3B5TA 4RZCA 4XWOC 3L5HA 3LRSA 2FB4L 3IFNH 5EDXA 2Y5EA 4HWEL 4H0HB 5TGBA 2B7DT 4PS4H 1REIA 3QZWG 2DQIL 4D9LL 4OLUH 1WCBB 2CXKA 1UB5B 4IRSB 4PP1C 3TVMC 4QNPE 4ODSL 1FO0B 4C56D 3DURA 1S7QA 3QUZA 3JV4A 1ZVYA 1F3JB 5CJOH 4PJ9A 2H26B 4P4RA 5JZ7D 4PRBA 4JHAH 1KENL 2M1KA 4GFTB 3P11H 3HZMA 4L29B 5I1CL 3ZYZA 1ROWA 3IVKB 3SY0B 4PTUA 5FUOH 5E8DL 1U8IA 3IFLH 4MX7A 2MQCA 2FHCA 1RK1A 3CZJA 1N3NB 1XIWA 2YBRA 5T1DL 1MFEL 2VLRA 5FB8B 5EBWB 3STLB 4APQA 3TYGL 3QNXB 4CW1B 1EO8H 4L3ED 4TTGA 4LVOC 4LLMA 4B50A 1AR1D 2A6KB 5FYKL 2Q7YA 2J6EH 5GGVL 5C0CA 1HINL 1S7VA 5CWSB 5KOMC 5GGVY 2O5ZH 5TJWK 5FYLL 4XCCH 4MNGA 3UC0H 4OCXH 1G1CA 1PQZA 1EEZA 1KEMH 4RWHA 2MKWA 1BF2A 1KOAA 1N5YL 1KFAL 3Q5TA 4XMKH 4ZFZB 3V4UH 3LIZL 5F1KC 3ARTA 5EIIA 1CGSL 4QRRE 2DWEA 1HXMA 5L2KB 2DQFB 3QI9B 4NQCE 3QB7C 4I5BB 3W0WA 3I2CH 4TTDD 2LU4A 3BOVA 5H8DA 4OZFB 5MEQB 1QFOA 5J57B 3RGVB 3V52L 1G6RB 4PJCA 3S36H 3BDYH 4U1SB 4I3SH 1HQ4A 4RMVA 5MEPB 5C2BL 4GRMA 4M5YH 1I9JL 1E27A 3HN3A 5IBLD 2HJKB 3O2DL 3N1MC 4LLYA 1D5XB 3WXVL 1H5BA 1Z9SA 1GPOH 3UTOA 2Q86A 3FRUA 2O5XL 3BPNB 5A2LH 2J6EA 4Z7WF 2YRLA 4PJHF 1Q0XL 4Z7QF 3F7QA 4UI2A 1UQSB 5ACMA 5CD5C 5JO5B 3TZVD 1CFNB 1I7TB 1EK3A 5T3XL 4QRUA 1Z5LB 1QLFA 3MRNA 1P7QA 4FQJH 1UA6L 5E2TL 5GIRB 5KSAA 4LAJH 2UWEE 1T5WB 3WIHA 3PABA 1HXYA 5C92A 1HOCA 1I8MB 3H3BC 3VG0L 1G7LA 5IMLA 2A83B 1U8NA 4JFFB 2VLJE 1ES0A 3ARDB 1P7QB 5D9SB 4UTBL 3QUYB 3HUJE 2XNAA 2AEQH 5B39B 3ULUC 4UMGA 5KVFH 3VXUA 4KI5F 4HG4K 1T1XA 4XVTL 2YD6A 3TBSB 5DHYB 2H8PB 1OWRM 1YEEH 5E5MB 4ZO6A 2L7JA 4M5ZL 4IOSD 1NC2D 1WBYB 5B39A 1FIEA 1CQKA 4JVPA 4BZ1H 4YO0B 3SDAB 2CDGA 2A77L 3IKCA 3FO2B 4LLVB 4LVNB 5J6HB 1XF2A 1JGUL 5IK3B 4NSKB 4AENB 3D85B 4P2OA 5D1QA 2E5EA 3HRZB 4HKXB 4KZDL 2WINA 4PJDF 2KBGA 3NZHH 4I77L 4YUEH 2VNCA 5C0JB 2AK4B 1A3LL 4TUJB 3IRPX 5FO9B 1IC5L 2YD4A 1WAAE 1AGDA 3QIBC 4P4RB 1N0XH 4JFZL 4PJAE 2FGZA 3PL6A 4JPVL 4WY7L 3MXWL 3UP1A 3MJ6A 3BJLA 4H1LA 1SVCP 2GQHA 4ODXB 5HY9B 1TTUA 4M9PA 4XZUA 2EH7L 3U4EA 3BVNA 1SJXA 5F9JB 1DLFL 2HWZH 3RWHA 3G6AA 5JOEA 4QYOA 5C0ND 4R4BB 3L6FB 5TF0A 1LILA 3WEXA 3SPVB 4CMHC 4LLMB 4ZAKD 4DFHA 5F88B 2CKBL 2BVQB 2OZ4L 2ADGB 4U1KA 1FO0H 2YHGA 4YGVB 4WO4B 2OQJB 3EO0A 3AS2A 3TZVC 1E4XH 1BJ8A 2IPTL 4XMLL 3QULA 1TZHB 3QCVL 4J3TA 2C3VB 4R8WL 5IQ9B 4ZFZA 3OTTA 3BUYA 1IKFH 2O5ZL 3QEGH 3EO0B 5HVHB 1ZT4A 4YHNA 1LP9E 3SDXB 3GK8H 1S5HB 3SKNB 1MCHA 3U1SL 2FBOJ 2VL5A 3QG7H 4HGWA 2UWEA 5LGHL 4Z95L 5HI5C 1IBGH 2FNBA 3BYTA 2VITB 4POZD 5C0GA 2A9MH 4UINL 4OI9A 5INCB 1FORH 1S7UB 4AH2A 1A7PH 1RK1B 3VFUA 2FO1A 4GXVH 2BOBB 2H32B 5BMFH 2IG2H 1MI5D 4GRMB 3C08L 2FJHA 3SO3B 4X98A 4RMQA 3UJTL 4NIKB 3F5WB 2ZOKA 4K7PY 2ZUQB 4BZYA 3CH8A 5IFAH 3UMTA 5FM8A 1OM3L 2ZCHL 1DQJB 1GGBH 3AS3A 3CVHB 3HNSL 4QXGH 4XNQA 3VCLB 1X7QA 4P5TD 4PJDA 1DN0A 3WJJA 2GJ6B 1C5CH 5D6DA 2NY3D 3N06B 4P9HL 4NHCH 3IAQA 4F3FA 3VD3A 3WXVH 3BP4A 1S7SB 4R90L 5C08B 3CC5A