4NC1E

Crystal structure of tcda-a2 bound to a20.1 vhh and a26.8 vhh
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
124
structure length
124
Chain Sequence
VKLEESGGGLVQAGGSLRLSCAASERTFSRYPVAWFRQAPGAEREFVAVISSTGTSTYYADSVKGRFTISRDNAKVTVYLQMNNLKREDTAVYFCAVNSQRTRLQDPNEYDYWGQGTQVTVSSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell wall-binding repeat protein
publication title Structural Basis for Antibody Recognition in the Receptor-binding Domains of Toxins A and B from Clostridium difficile.
pubmed doi rcsb
source organism Clostridium difficile
molecule tags Immune system
total genus 31
structure length 124
sequence length 124
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nc1E00
1OM3L 2OM5A 4H25A 3DHMA 4GAFB 4NOFA 2HG5A 5I73C 5SX4H 5DQ9A 2R8SH 1RZ8B 1CTNA 4E0RB 3BEWA 1WBXB 5LCVH 1I9JH 3D0LB 4GFTB 3KNBA 4LCIL 1T1WB 3C9NB 4HAFA 3PIQB 4NKIL 5DVKA 4YZFE 1CLYH 3NFPA 3PGFH 3VRLE 1NC4D 4O58H 4NRYA 3BDXA 1UB6B 4K8RL 1UH4A 4OCSL 4LRIA 1YPZE 5IV2A 1XF2B 5E94B 2FX8H 1RUAL 2HN7A 3QHTC 4L3EB 4I2XA 2P8PB 4R7NA 3KLDA 1QFHA 1CTOA 1I7RA 3EJZD 2FZ3A 3RZCC 2O61B 1WITA 2X4TA 1S8DA 3MRHA 2ADJB 2R0WL 4NNXA 3UJIL 5SWQB 3TN0B 4KK8C 3U7YH 1S7XA 2GK0A 2X70B 3GIZL 5J1SC 1FCCA 3LKNA 1J0YA 1XMWA 1HI6A 2NXYB 1IVLA 5DD0H 1R3JB 3GSWA 1ZS8A 3FO1B 4NQXB 1GZQB 4ESKA 2FR4A 4OLVL 3QA3A 4QHUA 4ZDHA 3ZTNL 3FT2B 2OTWB 5DD5L 2VLLB 3U4BL 4D3CL 3V5DB 1FZJB 2EIZA 5I17A 4MD5B 4JQIL 5C0FA 5H35A 2XQBH 3VXMD 3WHE1 3IS1X 2XICA 2VZSA 1O7SA 4YHIA 3KPOB 2PXYA 5B8CC 4JPIB 3ULUF 1C5DB 2R4RL 2A9NH 4P9HC 1PEWA 3TNNA 3ARED 1JGVL 1YNTA 3KPLA 3RX5A 1A3LL 4PFEA 4LVHC 4OLUL 1LEKA 1OAUL 5CJQL 5FHBH 1T21A 4R9HA 5CMAA 3PQYE 1VPOL 5DA4A 1ZK9A 1CLOH 4LF3A 2BOCA 2W9DH 3P4MB 4HUMB 3RZCB 1UT9A 4LLDA 5D5MA 2YD3A 1EEYB 4XNZB 1OW0A 3HC3H 2A73B 4HAGA 4JG0H 5CUSL 2LE9A 4QNPF 3BPOC 1NCBL 2JK5A 2HH0L 1Y0LB 3VFPA 2AJYL 4N9GB 1KN4L 4ZODA 1QSFA 1SYVA 1G6RL 1NCNA 1UENA 3D2UB 1NBVH 4PV8B 4OD2B 1FJ1B 4EKXA 2Q3ZA 1A6UH 1PQZB 5DYOA 5KVFH 2OMNA 4GLRH 5CBEA 3TZVC 3PP4L 2NNAB 4HFWA 4BQ6A 4I3SH 4M6NL 5C8JA 5FCUH 2AAVA 5I30L 3QCVL 1A6AA 4MVBD 2YXFA 2FIKA 1K3ZA 4X7CC 3BPNB 4RMUA 4URTB 4YJZL 1PLGH 1YEJL 3ULUC 1CFTB 4LARH 1YEEH 2AK4E 5F89B 5D2LE 1MAKA 4LVHB 3DV6B 4CBPA 4LEOB 3VD9A 4BSVB 2XKNA 2R2EA 2AK1H 2DF3A 3EO1A 1DBBH 2EE2A 4RAUA 3OKNB 3CFDB 3RNQA 3UAJC 3DXAB 5ANMA 3T0EC 3TT1H 3P0VL 5L2KB 3KR3L 3O3EB 3GSOB 1JGUL 3IKCA 2O5YH 4G8GE 4OV5B 2BNRE 1KTLB 5MEPB 2XZAL 4NN7C 5IMOA 2UZIL 3MJ8B 2LU4A 4M4PA 2GJ6B 4YHKL 1GHFL 2PXYD 2GTWA 5IB1A 1O5DT 2W0FA 1H15B 1CGWA 1I8LC 5EOCH 4K2UH 5DUPH 1QUNA 3BKJL 3FT4A 4X6CF 3TZVB 4YWGL 3GMRB 3FFCA 4PJ9B 4GSDL 3I3EA 3SPVA 3GUTA 4E5XA 1DQMH 1ZOXA 2DL9A 5T3XD 4WV1C 3NA4A 5IQ7L 2XRAH 3CJJA 3VDCA 1RIHH 5DMGD 4O4YL 1OD9A 4ZFFA 2CRZA 4RSVA 3ZSSA 2C3VB 4M8QA 3U0WH 1QSFD 2W0PA 5HHMB 1I3RA 1D6EB 2F58L 3PABA 4DOHB 2HFFB 2YC1A 1RIUH 2DLTA 2GKIA 3JWOC 4IOIB 4RMQA 3W2DL 2J3SA 5AG9A 5L88H 4HC1L 1K85A 3SKUD 3EOAB 1EJ6A 3T0EB 4QF1B 2A77H 5JMOC 2B4CC 2WIMA 3OR6A 3GMMB 1Q0XH 1XR9A 4G6FD 1BAFL 2V5MA 4TN9A 4QRRB 2A38A 1ED3B 3OPZL 3QBTB 4AEHH 4OAWB 4G43A 1VA9A 3BVNB 3HCVA 4LSVH 1UXSA 4NN7B 4L9LC 3R1GH 3V52L 2UUDK 2FJHB 1BQUA 4OFVA 3BP5B 1H0DB 5CJOL 3MRKA 2DRUA 4ODBD 5J56B 2OK0L 1KJ2B 3G04A 3BW9B 1Y18B 5ITFA 1HHGA 3PGDA 2LU3A 4NYLB 1DUZB 1M7IB 4HXAH 2N56A 3AFLA 1ODAA 4LPTA 1BVLB 5JHDE 2D03H 2UYLA 1RURH 2CUHA 4WV1B 4OCWL 1PG7L 2MFNA 1YDPB 3LHPH 5TE6L 2NY1C 4J4PC 4OQTA 2FX7H 4U49A 4X6BB 4W4NA 2L0DA 3ISWA 3QULB 2VQ1B 1IBGH 5I1DB 4PJHA 3MZGB 2CH8A 2YD7A 2DM7A 3EAKA 5C1MB 2NYYD 3HI5L 1NLDL 4PGDB 3U82B 5FB8B 1MPAL 3ULVD 1Q8MA 3QG7L 5JXAL 4XNYL 5F7EL 4YBQD 3QXDB 4LHUB 5TH2A 4P5KB 4FHBD 1CR9L 3IXAB 4XWOD 3MYZA 1TJIH 4C4KT 3QCUH 5DZLA 1CDBA 2OTUA 3BIKA 1ZLVK 3FFCD 3WS6C 3N1QC 2IG2L 1I1FB 1HNGA 3RX8A 3D87B 3QO0B 1N3NB 1UA6L 1NANH 5TE7H 4L9LB 3V0VA 4G80B 3WFBL 2EEAA 4L1HA 2Q6WB 1UEYA 1K9TA 3DMMA 3JUZA 2IAMA 2R1WB 4XP4H 1U8QB 2A0LC 4D2NA 4O51B 4DOHE 2WINA 2P24A 3OKKB 1A1MB 3H9YA 4Z76B 4LOUC 1HSAA 3MRPB 1CT8B 2X1QA 3ULSB 1CDJA 1XR8A 1BEYH 1K2DB 3TEUA 2IBZY 3W0WB 4KK9D 5CHNA 5D1ZC 3VGHA 5HHQB 4RFOH 5E9DA 1ES0A 4NNYB 2HT2C 1TTUA 4MNHA 2AJVL 2MWCA 3WO3B 1JNNL 2ENSA 1WZ1L 1ZTXL 1Z3GL 3K74B 4MJ2A 3W9EB 3SDAA 3RU8H 1JV5A 2DIBA 2QADC 5GS0L 3GNML 4HMCA 3FQRA 4X4XA 2HT4D 3L5IA 4ZYKB 4OLWH 3LKRB 4X6EB 4X9BA 3P73B 3JUYA 4HUXB 4HG4K 4LVEA 1LO2L 4LSTL 3T09A 3H7BA 4ZTPH 4BH8A 1WZLA 1BBJA 1BVKA 2IC2A 4HIJA 5CCKL 5FECA 2G5BB 4L3AA 1K6QL 5T33H 5J9PB 2P1YA 4ZFOB 3EOBA 4P4RA 1T0NA 2CPCA 3VE0A 4QCIB 4HS6A 3HZKB 4AM0B 1JZ6A 2DQFB 1RPQA 2IQ9H 3INUH 3BSZL 2FGWH 2ZJSL 4HS8L 3LSOB 3JSSA 4JPWL 1CN4A 1TTGA 2UY6A 3IJHB 1INQA 5D1ZB 1FO0A 4U1NA 2O93L 4HJ0C 5JIIA 4QRPA 4FABL 1WJ3A 1DBJH 5FKPA 3CPLA 1A7NL 1DEEB 2FX9L 3BWAA 3CVIL 1KXTB 3DUSA 5I8EA 2NY3B 4X9HA 3Q1SH 3S88H 3DMMD 1M4KA 3RVVC 1PGRB 3TF7C 2BC4A 3MFFA 3QHFH 2J8UB 4Z8FH 1UWXK 4JGUA 1MY7A 4IRZL 4N0UE 5DEFB 2JKXA 4X5WB 4GMTL 5ESVB 1E4WH 3E6FA 5HVHC 2YBRB 1YEFL 1MQ8A 4OUOA 1ULVA 3ARFC 3IYLW 1KIQB 2JELH 2BHZA 2ICWJ 1T5XB 1HYSD 4PJIA 5E9DD 3KJ4B 1MLCA 2ICWA 4LPUA 2VXVH 2R39A 7CGTA 5CJXA 3CFEA 1GVIA 4NBYB 3U9UB 4NJ9L 4BSWA 5E6IA 2EDQA 3MV9B 5C07A 4IDJL 2VXTH 5IB5A 3BQUD 5HYIA 3KXFA 1RZJH 3BE1H 5IVZB 1A7PL 3TBYA 5IBUB 2H41A 4JY5H 5C0BB 5BJTA 4KKBC 3BESR 3ZE0E 3GSXB 1WCQA 1JHTB 4D9QD 2X4PB 2D0GA 1KELL 2BERA 2KH2B 4DVRH 3AY4A 4JFEE 1FZMA 1MHEB 2Z35A 4CDGC 4WTXA 3MLXL 2YD9A 3NFNA 4LCWE 1ZLSL 2QJDA 2PO6C 1SJEA 2LQRA 4M02A 1YEKH 5J11C 1TVBB 1RMFH 1OWWA 1NAMA 3BAEL 4MA7H 4NWTL 5HVHB 1HHIB 2HRPL 1XGPB 1MI5A 5DUMH 5K93A 4ZTOL 5CD3A 1N5YH 4Y1AB 5GGQL 3KPTA 2Y5TA 3L1OH 2YPLB 4WFGD 3ARFB 3VI4F 4M7LH 1A6ZA 4YXLL 4XC3L 4MAYA 2BVOB 2UWEE 4ALAH 3H42L 4LSPH 3HE6C 4G8FA 2QL1A 4QRPD 3T3PF 1MCHA 4YBLC 3RBSA 4NQVA 3U9PH 1S3KH 3K7UA 4QYOB 4Z7VA 5JORA 1EEQA 4NUGL 5TQ0L 5HTSA 1BZ9A 3EYUL 4PGBB 2Z93B 1ZGLP 3TH3T 2EE6A 4NC2B 4DZBA 4KJPC 2I24N 3I6GA 3SGKC 1S7VB 1T2QH 1TQCC 4A6YA 1U8KA 2OSLA 3V79C 4PRIA 4G6AD 1RHHB 4WIQA 3F7PC 5DEZA 4JQVA 3BPCB 3C60C 2LTQC 3TWCL 2E6PA 1DBAL 1F6AB 1JTOA 1R3HB 1S7QA 1U8IA 3A67L 1D9KA 1NUGA 2VXUL 4V1DD 1BM3L 1FRGH 1FV1B 5ICZB 4Y5XA 3B8SA 4F37K 3D5OF 4C56B 1R24A 1GGTA 1BLNA 3EO9H 4PRAA 5E6ID 3S97C 4I18B 3QWRD 1QRNB 2VLJB 4GAJH 3L3DA 1S7UA 1HH6A 3KXFD 2L7JA 1RUQL 3U0PA 3QEQB 3CSGA 3FT3A 4F7TA 3RL1B 3HE6B 3U2SB 3S3JA 1C12A 3UDWA 2FJFA 4KUZL 3VFNB 1IEAB 1EO8L 3ARDC 4I8DA 3IGAB 3B9DA 4G9DB 3QYCA 4YDIL 5MENB 3VA6A 5KSAA 2DLGA 1GAFH 1JYWA 5EU5A 5FF6B 3F7VA 3K80A 1QBMH 2Y36L 2DWEA 1TQCB 1R3KB 5GSVB 1AD0B 4CU8A 4KDVA 4DUVA 4WEMB 1OAZL 5ERWB 1G6RB 3NZ8B 2YPLE 2LTQB 4RZCB 1ZT4B 3K2UH 3GSQB 4NDMA 3HMXH 4M5ZL 1UH3A 2FHFA 5B3JE 3BDBA 3VDAA 1N59B 4NC0B 4FQ1L 1HDMB 4KK5C 5DURD 1YJDH 5FKAA 5CEXA 1SEQL 4TULL 3EYSL 5TDNB 4OZHE 2W60A 1D6VL 5DJZA 1HKLH 1H3PL 1NC2A 1CGUA 1MCCA 4I0KA 1I7TB 3T65B 4FQHA 1OSPH 3TIEA 1C7TA 2NZ9C 1E6OH 2WQ8A 5FO9A 3PXJA 5E8PA 5BZWA 4L3CB 4M6MH 3BD3A 1AXTL 3MXWL 4PJXA 4JFHE 2FJGB 3O6FB 4WNQB 4PRID 3KYMB 2VAJA 4UINL 3CCHA 4HPYL 5I18L 3S7GA 1OQOA 2DYPB 1LEIA 1M7DB 3G9VA 3MV8E 1JYNA 3LKQA 1C5BL 3ZMRA 3HLAB 3CVHH 2GW5A 3QCTH 3F58H 4J7RA 5F8RC 4X0KA 1GSMA 4NM4L 4C56E 4Y2DA 1A4JA 3MRDB 3IDGA 5IMKA 5JUEL 3ROOA 5FA4A 4N8CL 2P42B 5K9OA 3IU3B 2QSVA 4EVNB 2GSIB 4CVZB 2BCKB 4P2OB 5DHVB 2ZPKL 5IB4B 3J8F7 4MA3B 5LVEA 2XYCA 3SDXA 1PVHA 4X99A 3PG2A 5HGDB 3VXNB 1YN7B 1Z6JT 4F2MB 3WYRA 3JV6B 4M5YL 3L95A 2EO1A 2E7HA 4XNUH 1LO5A 4Y5VB 1W72A 2ATKA 1S7TA 3X11B 2APXA 1NPUA 2EDYA 5HHOB 3NABH 3DX7B 5JW3L 1ZHKB 3HS0A 4G8EA 4U0QB 3AS3A 1MLBB 5KSAD 2R4SL 4ELMF 4LPXA 4BA8A 5DO2C 3LKOA 4P4KD 5A2FA 2AV1B 3UROR 3RDTC 3DBXA 1JGEB 3RHWK 4A2LA 5J1AA 3FAXA 2UV3A 3L3IB 3PWUB 2O5XH 2DDQH 4AH2A 1U58A 4P3CH 1MFBL 4OGXH 5AWNL 4Z95L 1BFTA 3HPLB 1PZ5A 1J87A 2DQCL 3UX9B 3D39A 3WHE0 5HYQB 4Q2ZA 5DLML 4R3SA 5HDOA 5DK0A 5A1AA 4KZDH 3S3SA 2C1PA 1YY8B 1NC2D 4ZXBC 4LP5A 1JIBA 5HYSB 1G1YA 1FNEB 1TTFA 4OV6F 2CDEA 5DEGB 5IT2H 1I1YB 1J8HB 2EE3A 3EJJX 3PNWB 4PR5A 4DGIH 1SMAA 3JVGA 2NY5H 1B0GA 3RIAK 1I8KB 1BECA 3QQ9D 5CILH 1WWAX 3BP7A 4Q6YA 1XF5A 2J12B 3FHQA 5C0AE 1VEPA 2K7PA 4ODSL 1NSNH 1YNKL 4G8IB 1CK0H 5IW6A 3UYRH 3VXSE 2CR6A 1KJVA 3VCLA 2XA8H 1MFCH 4K7PY 4HULB 1QO3A 4S11A 3GGWB 5F9AC 4OGZA 1MY5A 4PJCA 4X98B 4D9LH 2WP3T 2R1XB 4L9DA 4YPJA 2ZP0T 3CAFA 4YUEH 1RY7B 5AG8A 4OQTL 1YC7A 1OVZA 4BZ1L 5IWLA 5I66B 3FTGB 2VC2L 1ITBB 4JAMB 1F90H 3MGTA 5KSUA 5IW1B 1FG2B 2F5AH 1T22A 1NGYB 4LLVA 4ZXBB 2J88L 3B9VA 3X12A 2X9XA 2B1HL 4B0MM 3OMZA 1F3JB 3ZE1E 1KB5H 2NX5A 3NACH 3N9GH 3LEVL 5DGQA 4G6MH 3QZWB 4BQBA 2EXYC 1IFHH 5AD0B 1Z9SA 3IDIA 3U4AA 2NPLX 4OCLC 4EDXA 3MV7B 4JM4H 5FXCH 1Q72H 3LB6C 4KTDH 2XG5A 4BZYA 4GW5A 1F4WL 4LSUH 5EZJB 3QQ3B 4LCYA 4UV4L 1OGAE 4XCYB 4CL7A 1FVCB 1IKNC 3T4YA 3RWDA 4UTBH 2GJJA 2K7QA 4FXGA 1RJZA 3V5KB 1IMHC 4NZJA 4X6FB 2W9LA 4QXUH 1T1XA 2PCPB 4XC1L 4R6UA 5BS0A 4ZPTB 1F58L 4OKVA 5E03A 2KZ1B 3TH4T 1FL3A 5BCAA 1P9MA 4HKXA 4EDWL 1X7QA 5FGBC 1QBLH 1LO0L 2RHEA 5D1QA 5EBWA 1ZVSA 3EJZC 2BSTB 4KMQA 5L7XL 3VFSA 4ORZC 3TJHD 5IJVA 3HMXA 5D7IA 1EUUA 3G6JE 4NZTH 1CE6B 4QT5B 1C08B 3TCXA 3ARGB 2BY0A 2OJZL 1UWGL 4NN6C 3LQAH 3RY6C 4ZPVA 5IP4A 4K07A 5HGAA 1UCBL 2ED8A 1FPTH 4QRSA 3H3BC 4RX4A 3QDMA 3VJ6A 3RUGA 1G7PA 4M6OL 4AG4H 5GGUB 3VFRB 2OBGA 1J7VR 2ZSWA 5EZLA 5HHXH 2V9QA 3HI1A 3D85A 3UYOD 5ID1B 1NFDA 3BN3B 1ZT7B 2BMKA 1L6ZA 2ICEA 5JMRA 4KU1A 1T0MB 1NEUA 3T1FB 3KG5A 4D0CB 3EJYD 1QKZL 1MIEH 3EDDA 3ARUA 4Z7UE 1AI1L 1S7RA 5DJYB 4U1GB 1AY1L 5IW3A 4PS4L 5T5NF 2NX5D 3CVHA 5DJ0B 1U8LA 3AREC 3O6LH 4EBQL 1FO0L 1VEOA 1IZJA 4P59H 3DWTA 2CRYA 4D9RE 2OQJB 3TC9A 4HUKB 4S2SA 3R06B 3EZJB 4NO5A 5FUCC 2VDKH 3OG4B 3SGEH 5MP6H 2V2WA 3DVFA 1QA9A 5EO1A 1KBGL 2EYRB 1IGJA 3ESVF 5H94B 4U7MA 4O2CA 3T0WA 1PKQA 4EUPH 5C0DA 2VIRA 4PRPD 5DSCB 5D7JB 1LE9B 1AR2A 3T2NH 1FFNB 1ZV5A 4YHMH 1C16A 2B2XL 4X7TB 5B39G 4LRIC 1EERB 2VO5A 4X8XA 2BNQB 3M45A 1LD9B 3WD5H 1M05A 1SM3L 5D1QD 2OP4H 2CK0L 4MVBC 3WEXB 5D5MF 5HY9A 4OI7A 3RWIA 3S96A 5LGJB 4Q0XH 2G60L 1FIGH 1AO7E 1ZA3A 5T5FH 1I4FA 5DC0A 5GJTH 2PW2A 1FE8H 3C6LA 1H3VA 1H5BA 3CFBB 4HEME 1A6TB 4RX4D 3QDMD 2GK2A 35C8L 5IHBA 4ZSOA 4O9HH 1A6VH 3D85D 4NO0A 3C5JB 5HGHA 1NAML 4H25B 2RCSH 4JKWA 5D6DA 2HG5B 1YMMA 4LFHG 5DQ9B 4LFHD 1S5IL 2AXFA 1NJ9A 2PXYC 3KNBB 5C6WH 4HF5H 3NFPB 3GRWH 4WUUE 3H0TB 4C54A 4UT6L 3D18A 1VENA 2IF7A 3LN9A 4DAGL 2KDGA 4I2XB 2GJZA 4FFVC 4R7NB 3GSUA 1MFAL 3M17B 4U6XB 3ILPA 3LH2L 4NUJA 4RGMC 5J1TC 1U8JA 5DRNB 5DMGC 1S8DB 5I1JL 3MRHB 1JJUA 4PTUA 4UU9B 1KTRL 1L0QA 1UM6H 4HWEL 1UXWB 2A6DB 4A6YL 4XAWH 1GH7A 1V7NH 4DK3A 5FDYA 2NY4D 1D5XA 4KI1A 2ATPA 2GK0B 1CXLA 4OCRH 1G9MH 5DMYA 1LP9E 1GC1H 3GSWB 2FR4B 3PHSA 2VRAA 3WKNA 3QA3B 2R9HD 4X80L 1ZLVH 1A7QH 3EGSB 3HRPA 1EHAA 4GQ9L 1DE4B 1FN4A 1KB5A 2EIZB 1XCTA 5I17B 1EH9A 1WT5A 3O41A 3ZL4H 4XNMB 5C0FB 5HSFA 1IGFL 2IQAA 4I77H 4EQ3A 3L9RA 5KBNC 4YHIB 2PXYB 3VXRA 2HVKA 2FWOA 1F4XH 3TNNB 3MBEA 2ESVD 4MS8D 2AEPL 3WFEH 4NKDA 4JFZH 3WHXA 1LEKB 4F33A 2KKQA 5F9JA 4QTHA 3GMLA 3C6LD 4JRXA 1T21B 3QEGL 2CDGA 5CMAB 4PRBA 3ARZA 2CUIA 1CICA 1WC7A 5DVLA 4R90H 1ZEAH 5EA0H 3LRSA 4LLDB 5D5MB 1NBYB 2A6JA 3C08L 5I6XC 2JK5B 4NO0D 2WUBH 3QB7C 5E2UL 5T3ZL 1AKJA 2NYYC 5ALCH 5MHSD 2DWDA 4M62H 5EWIH 5BOPA 4Z7WE 2ICCA 4ZO6A 1YYLH 1TPXC 1MRDL 1MSPA 1QFPA 3D48R 3QXAB 4MB4A 4YBQC 2EDLA 3CH1A 5DYOB 1YUHA 3P9WB 4XWOC 4GUPA 4S0SD 3OB8A 1RZIA 4F3FA 4G6FB 1FSKC 2QQLL 1EEZA 2VZUA 3PWJA 1OCWL 3GZKA 5C8JB 2GITA 1E4JA 4UILH 4ODHH 4OF6A 1SEBA 4OFKA 4WHYH 5LAXA 1TQBC 3QDGE 3CFJA 5E2TH 2FIKB 4LMQI 2NMSA 5EORH 3E0GA 5DJDB 2VLKA 4PY8J 4XNQA 2A1WL 2WBWB 5B4MD 1P4LB 3MOAL 3OXRA 4PJHF 5L8LB 3MR9A 3ARBB 2YMXH 1TETH 3FRPA 1LVEA 4KPHH 3RTQA 5IR1B 1SQ2N 3KLHC 5GSRB 4NGHH 3EO1B 4GRWH 3UJTH 1TJHH 3IFPB 5ANMB 2G2RA 1AIFB 1L7TH 2RR3A 4JO3L 4DFIA 5EO0A 4ACPA 4XP6L 2BDNL 4QHLA 1ZHLA 5C0EB 1Y6KR 3MLTA 3G5ZA 4IRJA 5JOPD 5KS9A 4UQ3A 1D7FA 5FDWA 2HT4C 3I6LE 1A64A 3DURB 4HCRH 5IB1B 2W0FB 1ZVHA 5KAQG 1UWXH 1NMBL 1PJ9A 3MBED 4NP4L 5F3HB 4OB5L 4YX2L 5EOTB 2DI9A 3H3KA 4XVTL 4Y88A 2CIKB 1I9IH 3DO3A 2C5DC 4E5XB 1YEIL 3GUTB 1K4DA 1W72L 3F7YA 1TQBB 5JA8B 1V7ML 1XZ0A 4FQJH 1V3LA 3O0RL 4YE4H 5HI4D 5I8OH 2QQKL 3TPUA 4ZFFB 2JIXA 3V5HA 5BRZB 4EOWH 3BKCL 3IDUA 3KPSE 4HFUH 2HFGH 4M8QB 1I3RB 5EBGA 1AKJD 1YN6A 4HIHA 3CZJA 1EHLH 4HXBL 3B6SA 4NPYA 4GMSL 3O3DA 4GRMA 3CIQA 5L9DL 3VFMA 3VMPA 1CD9B 4MNQD 4KXZI 4KI5D 2SEBA 4PRDB 4OTXL 1FAKT 5F96H 3OR6B 4CGTA 3RI5F 4KRNA 3OQ3B 4LLQB 4OM1L 5DMIL 3RWEA 4PJFB 1R3IL 4HHAA 4G43B 2D4FA 3HCVB 1MCOL 1UXSB 5D7LA 5IG7B 3WNOA 4K3DL 4LLUB 5IBLD 3G08A 1CIDA 4L4JA 2VLKD 3DMMC 3E8UL 1Z9MA 2CKBA 3MACH 4FTVB 1XGQB 3FRPG 3G04B 5ITFB 4TSCH 1HHGB 3PGDB 2WK2A 4EEEA 5DA0B 3V2AR 4NRXA 1KCRH 5LQBH 3GJEA 2Q3AA 2UYLB 2DM2A 2EXWC 5EZOH 4Z7QE 3NFSL 2VH5L 3KPRD 2B1AH 4X7EC 1HYSC 1GOFA 3MRJB 1BD2A 1JPFA 1AQKH 2YHGA 4HK0A 4OCYH 4I4WA 4PJHB 2CQVA 3M1BA 3ZHLA 1P69B 1KCVL 3PWPA 4U1KA 5IEHB 4IRJD 3SCMA 3SDAC 5FIEA 4OZIA 3BQUC 4K94L 3R0NA 4NQCD 2AKRA 5T1DL 3QFJA 5TH2B 5BXFA 2R0KH 5GGVH 3VU2A 1UM4H 1QSED 1FBIH 1RIVH 5FYLE 3A6CL 4L4VA 3ZKMD 1HZHL 2ZUXA 2ZCKL 1G84A 3U7AA 1XCQA 1T5WB 1WCBA 5F1IA 3SKJH 2I5YH 2I9LA 1W0YT 1MRFL 4E42B 5DT1L 4EUPG 5BRZE 4PJIF 3U1SL 2CKNA 2VYRE 1WIUA 2IAMB 2JIXD 1S7SA 2WIIA 3ORJA 5GISL 1RVFH 3QEHA 5J13C 5TQ2L 2IH3B 2WINB 4U1LA 3KPMB 2NW2A 1HSAB 1LHZA 4FQIH 3CD4A 3H9SD 1XR8B 3MJ9A 1OAXL 5F9WC 4XI5D 1F42A 5CHNB 4IJ3C 1LE5A 1LDPH 3UPCA 5BVPH 4PJFE 4OZFA 1ES0B 1IAII 1JGDA 4JFDB 4LIQH 3DGGA 2MQ3A 3KVQA 4MNHB 2V5SA 2GHWB 2H6PB 3L5XL 3PDOA 4JE4B 4PY7B 3O3BA 2WZPD 3SDAB 1JV5B 5BV7L 5D7LD 3B9AA 4X4XB 1PY9A 3FQRB 2HTLD 3BX7C 4FTVE 4LDLB 3OKLB 1UZ6E 2CIIA 2EDDA 1CFVL 2IPTL 5GGSA 3UO1L 1QP1A 3FL7A 3H7BB 4G6AC 3QUZA 4JN2B 5C0CE 3S35H 2FB4L 1BBJB 2F8OA 4PJDA 2LFGA 4HIJB 5D1XD 5IJKA 4QO1A 1QBBA 3CX5K 4N8VA 3BDYL 4ONFH 4PJAA 4WRLA 3CMOL 2EH7L 4JO4L 4YEFA 4OM0L 1BOGA 1T0NB 2VN7A 1BD2D 2VZTA 2ZZUT 1FVEA 3NAAL 3BJ91 4LSDA 5CJXC 4CU7A 1AGBA 4Z7VF 3SO5A 3PWPD 3SO3C 3SCMD 1ZHBA 5E6IC 3TT3H 2H9GA 4IOFD 4LLYB 1QHPA 5E5RB 5KSBE 1NUDA 3LMJL 4Z7NF 5F9WB 3QFJD 4E9LA 4NM8L 1IQDA 1INQB 4IJ3B 1FO0B 4U1NB 4U2ZA 4U1SA 5IVXB 2CLRA 4P5MA 2FHBA 4KJQD 1WTGT 1YNLH 3Q6FB 4L4VD 3IDJB 2H32A 2GIYA 3OZ9L 1CGSL 4EJ1C 3CPLB 3AY4C 1U91A 5AZEL 3DRTA 1GGBH 3MXVH 5I2IA 1DJSA 3DUSB 5I8EB 2QKIA 4L4TA 4CVUA 2VMFA 1BGXL 4YNYA 3PHOA 2BC4B 1GRWA 3MFFB 4R2GB 4TTDD 3EZ8A 5ADPH 2PW1A 1QYGH 2PYFA 4FZEH 1L9NA 3B5GA 1NCWH 1NMCC 3BGFC 4KROD 3WKMH 1KLUA 1U41A 2PYEE 4YHOL 1UACL 2X1XR 1ND0A 2HAZA 2BJMH 3CDGA 1JP5A 1INDL 3FCTA 3MODH 2XTJD 1EK3A 3FQUA 5CEZL 4HCRA 3LKSB 4PJIB 4PJ5A 1A0QH 2ADFL 1MLCB 2WWKT 2ICWB 3MRCA 2JJSA 4JY6B 3NCJH 3CFEB 2M26A 2BVPA 4XPGH 4BSWB 3BPLB 5C07B 1U3HB 4UOW1 1OP3K 4U6HA 3RIFF 1WGOA 1TZGL 3FOMB 4G5ZH 1B4JH 2MNUA 5CJ5A 5EU6D 1V3KA 5DJ8A 2YPVH 1IGCH 5KSVA 2GFBB 1TZHA 4XCCH 4JQVC 4OIIH 4OFPA 4UT9H 1WBYA 2ZOLA 2BVUA 3WFCH 4Z18A 5D2NB 1FYTE 1N7MH 4PP1D 4L8BA 1D9KC 2Q8BL 2Z35B 4JCMA 3NFNB 5L6YH 2R2CA 5LG1A 1XAUA 3V7MA 2I07A 2HP4A 1N64L 4Y5XC 4FP8L 2D4DA 3OHXA 2HVJB 1KFAL 4FN0A 4X6DA 4HH8A 1E27A 3OX8A 1NAMB 4ZS7L 3UZQA 1FZKA 2A6IB 4OD3L 1F6FB 1KENH 1MI5B 4GBXB 3UTSB 1UGNA 5DK3A 4XBGB 3IB4A 3A6OA 4N0YH 1B90A 4WHYG 4PJXF 5GIRA 5IVXE 2XZCL 1H8NA 1LNUA 2ADIA 2IALA 1B2WL 1A6ZB 4M3JA 5IHUL 4MAYB 1NGPL 1KIPB 3MO1A 3RAJL 2R0LL 3UDWC 4CN6A 2FBOJ 5ICYA 3QG6B 3MV11 3ROLA 3RKPA 5I1EL 4NQVB 1NGQL 4Z7VB 4NBZB 1IM3A 1MVUA 4Z7OE 5ISZE 3NTCL 1C1EH 4HGWA 1AQDA 1DZBA 2NLJA 4L4TD 5C92A 5KSAC 3GBMH 1CZ8H 3N06B 4N1EA 1TZIB 4TNVF 3QIBA 4JFYB 4A6YB 3MUZ1 1J5OL 4XMPH 3AGVA 4M48L 1WIPA 5F7FA 5EUKA 3DX6B 1S7QB 1U8IB 3MLRH 3FMGH 1D9KB 3SDXF 3ZO0A 5E2VH 3TGXA 5I1AB 2BNUA 4AENA 4RCAA 1WBZA 5I8KH 3ELAT 4PJ5D 1MFEH 2QBWA 3HE7B 4M8VA 1H3UA 1E6JH 2FRGP 4YXKH 4RRPG 3K46A 5KZCD 3H3PH 2EKSB 1MEXL 3VRJB 5IROA 3MGOA 1HH6B 3PUCA 1JK8A 3PF2A 5LWYL 3BIAX 3FT3B 4F7TB 2F53E 5D2NE 3QQ9C 2EH8H 4JFFA 4U7SA 1C12B 1OP9A 3QWQB 3WSQH 2FJFB 3GHEH 3V8CA 4H88H 5C6TL 4WY7L 4PB9H 3MA9H 5FFLA 3C2AL 2C3HA 5HDQH 3AVEA 25C8H 2D7PA 4XCNA 5FHAL 1BX2A 2IADA 3F7VB 4QTIH 4Y2DC 5EU5B 2DQIL 3QUXA 4HWBL 5EULV 2JJWA 3IDMB 4R26H 4TOYH 1RUPL 3BP6B 1J1XH 2DBLH 4J3OC 4LNVA 1JZ4A 3M8OL 3BKYL 3F7RA 5FUZH 5C2UB 4R7DB 1YPZA 2X4UA 4XPFH 4EN3D 5CEXB 1JHLL 2DLEA 3MMEA 1RU9H 4JRYE 4YAQA 5F88A 2FATH 1FNGA 4MNGE 4JR9H 3TV3H 2C4FT 3Q5YA 2MKLC 3IFOA 5T1MA 3FFDB 2C26A 3MNVB 4KY1H 4LRNL 2XQYK 4HT1L 5E4EC 2QEJA 4WWKB 1P7QA 3QIBD 5E8PB 5BZWB 2BFVL 3U7WH 2JCCE 3HNSH 4PJXB 4HUVA 2CSPA 3RWJA 4HIXH 2VABA 1DQQB 2DQDH 4JLRA 4Q7DA 4PJCF 1RFDL 3CCHB 1RJLA 4R97C 3N1PC 5I0DA 1LEIB 3CLFL 4WTZA 3QEUA 4NJAH 1S7WA 3LPGA 4RFNC 1U92A 4O2EA 5IQ9A 3OXSB 3DVNA 2Z31A 1CXHA 1C5CH 4Y2DB 2Y1VA 1A4JB 3QDJD 4JPVH 2R69H 1GPOH 1UFUA 3ROOB 1WQVT 2VDOH 6FABH 4RFEB 2P5WB 3EO0B 2WBJD 5I8CA 2VUOA 4P2YA 4MCYA 4HLZH 1NCUA 1FAIL 3JVGC 4X99B 4XPBH 3D25A 5CP3H 3SDXB 5TFSL 4I9WE 1IAOA 1KJ2H 4WI6A 4JDTL 1EV2E 1LO5B 3DSFH 5DJ6B 3PQYA 1W72B 2H1PL 1S7TB 4HKJA 4B7LA 4MLIA 3VWJB 5F7NC 3BGMA 4PRHD 3TJHC 5E4EB 1RZ8A 3ZZ1A 5FM5O 5T3ZE 4E0RA 2WNGA 5HGGS 3DBXB 5ALBH 3C9NA 3KYKL 3PIQA 3SE3A 5J1AB 2HKFL 3WDIA 4R97B 4XBEH 2V5YA 1LO4H 1U58B 3S6CA 2XT1B 4XVJL 4K94C 5BMFL 4QRQA 4UIKL 3GB7B 1XF2A 3JWOH 4ETQB 5HDBE 1UH2A 4L3EA 3D39B 3JWDL 2P8PA 2VDLH 4TPRL 5IWLC 4HW6A 1BWMA 5I1LA 1QZ1A 4X5LA 4IIQA 1HYRC 2OL3L 1TFHA 2O61A 2B4CH 3NIDF 2PF6A 3MNWA 4ODXB 5ACLA 2AJ3B 4LCCB 3TN0A 4ONOA 5D7IF 4LDOB 2AK4A 2DD8L 5EU7C 2H8PA 1N5AB 5D2LA 4LSSH 1B0GB 1Q9WB 1LGVA 3NIFF 1R3JA 4YHZL 4NQXA 4WTZG 3WV0A 3FT2A 1XF5B 2VLLA 3RUGF 4P2RE 1EO5A 4K9EL 4UDUB 3L5HA 4IHOA 2Z31D 3DO7A 1NFDF 3GBNL 1KJVB 1NCCL 1KEGH 2CKBL 4G6KH 1ORSB 4G8GA 2BNRA 3FQNA 4TYUA 4FQCH 3HMWL 3KPOA 3Q6GL 1C5DA 2FD6L 2YEZB 2NTFA 2ORBL 2ICWI 1RK0A 3I9GH 1CLCA 4HIEA 3FO9B 4PJCB 2B0SH 3DX8A 2VXQH 4K7PX 4HWZB 1KGCE 1P9MC 4H20H 5ITBH 4Y19E 5E99L 1YECL 3P4MA 5KSUB 1MQKH 5SWZE 2B5IC 4OT1L 1EEYA 5D1QC 4NNPH 1T22B 4LLVB 1XF4B 4XP9H 4YHLL 1Y0LA 1RK1A 4LNRA 2P44B 4N1HB 5TDPA 4N9GA 3MOBH 4MA1B 4KTEH 2NX5B 3T3PE 1EMTH 4PV8A 1R5WB 4OD2A 1FJ1A 1U36A 2A9MH 1YJDC 1T03L 5I1HL 5IKCA 5IHLB 3EIFA 1PQZA 4EDXB 2CJUL 3W11D 1JI1A 2NNAA 4GW5B 4RAHA 4JM2A 4BQ8A 4EXPX 4KZEH 2EDNA 4L3ED 4NCC2 4LCYB 2XN9B 3T4YB 3RWDB 1RJZB 1JPST 5GHWH 3VGAC 1CFTA 2DMCA 5BV7B 3FQXB 2OR9H 3GSNL 1FGVH 1QFWL 3GMPA 4ZMAT 5F89A 3TN0D 5BS0B 1DN0B 4GRLB 3MJ9L 3HG1B 4LEOA 3EOYG 4OKVB 4BSVA 5ELIA 2W92A 3MRRA 1FL3B 2NXYD 4HKXB 3FQTA 3B2UD 2VWEE 3K3QA 5F9OH 4KHXL 3DXAA 5INDB 3MLZL 4OJFH 1K3IA 3X14B 2I60L 5D1QB 5EBWB 3O3EA 4DGVL 1UYWH 4OLYL 4F7PB 3IJYB 1ZVYA 2DIAA 4RGOH 4OV5A 5MEPA 2HWZH 5D7IB 3RY4A 1KUMA 1NGZB 3N1FC 4G8GD 1VFAA 1XT5A 2BNRD 2NY4C 4N90E 4W6XB 2C4FU 5SX5H 4Y5YA 5IM7A 2AJUH 4XXCA 1K8DA 1BFSA 3ZDXE 5HGAB 1KYOJ 1WEJH 2EEDA 4PJ9A 3UZVB 3QDMB 4WI8A 3VJ6B 2R9HC 3RUGB 5DRXA 2LAGB 5LXGL 1FNAA 2ZSWB 4F58L 1FVDA 1PSKH 3HI1B 1IAKA 2YK1L 3CZFA 4MQ7B 4GG6E 1NFDB 1HN1A 4DW2H 1X5GA 2ICEB 5F7HA 3FZUC 3VGAB 2LAAA 4JKKA 2M1KA 2HFTA 3DOSA 2C3VA 5DGRA 4ZUWB 1KF9B 1D6EA 4ZD3H 1U8NB 3BKML 3PWLA 3P11L 5DJ2A 4CN1A 5EIIB 1U8LB 2HFFA 4DN4H 5ENWA 3D2UD 4M93C 3DV4B 4QLRA 4FQXA 5L0QC 3O3AB 2E27L 4WU7A 1OM3H 3N85L 1MAML 2EDOA 3EYVA 1OWRM 4QF1A 3C6LC 1B0RB 2IPUK 3A6BL 3GMMA 4S2SB 5TJWK 2XN9E 4I13B 1KNOA 3VXUE 4JM2D 4QRRA 4LCIH 4NKIH 5DHXB 4AEIL 1MAJA 4DVBA 3W81A 2Y06L 3BT2L 1QBAA 5JIHA 5EO1B 1RD6A 4K8RH 5D6DC 3B9KA 3BP5A 4OCSH 1H0DA 1IGJB 4YPGA 5E8DL 1KJ2A 2WANA 1RUAH 1Y18A 4U1HB 5C0DB 4NYLA 3MRIA 1DUZA 1L0XA 1H3TA 1BVLA 1I8IB 4CUCA 1JMZA 3T0AA 3CMGA 2R0WH 3UJIH 5F1NA 2R0ZL 5DQJA 4TVSa 4AK1A 3DXAD 1YDPA 5H8DA 4MXQC 1RZKL 1M05B 3G6DL 3GIZH 4X6BA 1HINL 3UEZA 5HY9B 1CDUA 4YDLC 2AXGA 4ZUVB 3RWIB 5B4MC 3S96B 3WIFB 4OLVH 4PGDA 4OZ4A 3MC0A 3ZTNH 5DD5H 3U4BH 4D3CH 1ZA3B 5L0QB 2V2TB 2WLZA 2PW2B 3QXDA 4LHUA 4CU6A 5JOFB 4JQIH 1I9RL 3IXAA 1U2CA 5IMLA 1BQHA 1H5BB 4ELME 2D9CA 4KI5F 3VXQA 4PJ9D 4DZ8A 1FHGA 5I16A 4ZSOB 3RBGA 3VFTB 2R4RH 4UUJB 3LDBC 3TT1L 1N3NA 4GW4A 1OAQL 4ODWB 4LGPB 2EKJA 3TO2B 4G80A 1JGVH 1A21A 1NGWB 4U1JA 4GXUM 5HGHB 1A3LH 2Q6WA 1WT5C 4OLUH 1YMMB 1OAUH 2R1WA 1U8QA 5CJQH 3ESUF 4WDIB 1UEMA 3OKKA 5HHMD 1VPOH 1AE6L 3MBEC 4MD0B 4N0UA 4UV7L 1CT8A 3D18B 3ULSA 5KVMC 2EC9U 5CUSH 4FQXD 1NCBH 3UAJD 1K2DA 2HH0H 2AJYH 2ZUVA 3T0ED 1KN4H 1JE6A 3ES6A 2GJZB 5HHQA 1G6RH 3GSUB 2I25N 5CEZE 3KGRA 3MNZB 3JTTA 4QHMB 3FB7B 2JF1A 1J0JA 4QRRD 2WWMC 1U8JB 3RI5K 4PTUB 5HI4C 2F54E 4HLZG 5KS9F 2NY6C 1D5XB 3B9KD 4X6EA 3VXTA 3PP4H 3D3VE 3GBLA 4M6NH 3ZYOA 5I30H 3QCVH 1JGLL 4KI5C 3AMKA 4ODUA 5D6CA 1BOYA 1XIWA 1YEJH 4K7PL 2DM3A 5EBLB 1XCTB 1P6AB 4JHBA 1UJTA 4GS7C 4MJIE 3O41B 4Y7MA 2PR4L 1KPUB 3P2TA 4LCWA 4QCIA 2IQAB 3LQAC 5IBLC 2XOTA 3VXRB 2DQFA 2HVKB 5FGCB 5F7LB 3MBEB 1MNUL 3P0VH 3OR7B 3LSOA 3I2CL 3KR3H 2X4RA 4NKDB 1JGUH 3ET9F 4HKBA 3RTQC 4F33B 4GXVL 1BHGA 4LHUD 1FFOA 1ZT1A 5CGYD 2R29L 3IJHA 1FNHA 4CRPA 4JRXB 2UVEA 1JF1B 4FQLL 2CDGB 3AS0A 2XZAH 1CICB 2UZIH 5DHVH 2DQUL 3LRSB 4YHKH 1GHFH 4GKOA 4WFED 2YOCA 1NLBL 3GJFB 4MXWL 5I9QC 2A6JB 4UOW0 1WFNA 3BKJH 3B8YA 3Q5TA 2NY6B 4IRJC 1FLRL 4YWGH 2DWDB 2J8UA 4GSDH 3P9MB 2CGRL 5C0JB 5GZND 4M4RA 3ZDYE 5IQ7H 2YBRA 3CH1B 4J3UA 3V6ZA 1A1NA 3H9HB 3VXME 5JLZA 4O4YH 1RZIB 3BOVA 5DRWB 2V7NA 1EEZB 4N8PA 3ZKMC 4MAUL 4L1DA 3W0WD 3DYOA 3I75A 2DLFL 4GS7B 2F58H 4J4PD 1SEBB 5LAXB 2J2ZA 3CFJB 2AJZB 1Z9LA 4MJ5A 3W2DH 1NDMA 1A14L 4RA0C 2DM4A 4HC1H 4MZ3A 5ECJE 1P84J 3MR9B 4D94A 5JW5B 3UYPA 2ITDB 1T80A 2X89A 3HFML 1BAFH 3RTQB 5D8JL 5FUCE 4OZIF 3OPZH 3R8QA 1X5AA 3GHBL 3R8BB 3S5LA 1SBBA 4JFPA 5GPRA 3GSXA 3V52H 4XI5C 1NBQA 2G2RB 4WVRA 3V6BR 1XIWD 1AH1A 2N7AA 3TBVB 5CJOH 2KUTA 3L3GB 1MHEA 1ZHLB 4QHLB 2O5ZL 2OK0H 5GS2H 3MLTB 1J8KA 2OR8A 4LCWD 3RGHA 2HTLC 2DTML 4JGMA 4C83B 5C0NC 5F44A 4OCWH 1HHIA 1PG7H 5TE6H 5HHVL 1T1ZA 2QHLA 3G5YA 1TVDA 2YPLA 3Q3GB 4ZOEA 3IF1B 1K4DB 3S4SA 2BVOA 3V9FA 2VDNL 3HI5H 1NLDH 3F7YB 1CFSB 4OD1L 4UDTA 1G7JB 5GRVL 1MPAH 5JXAH 3QG7H 3T3MF 1FORL 4XNYH 5F7EH 1DFBL 1HQRB 1CR9H 2Z93A 4OZHA 1QVOA 2NY3D 1T7WA 1VESA 3SCMC 4HIHB 1YN6B 5BQ7B 2D31B 1S7VA 2WM0A 5FYKU 3B6SB 2IG2H 5J6HA 1TNNA 4NPYB 4L29A 2DQJL 1NCTA 1RHHA 4GRMB 2AQ1A 43C9B 3RJDA 3VFMB 1NGXB 1UA6H 4UI2A 2DQGL 4PYGA 3BPCA 2DAVA 4POZC 3WFBH 2SEBB 3QWOB 4FFZL 1OARL 1MCWM 4WW2A 5IK3B 1G1CA 4KJQC 1ZA6B 3RWEB 4NRZA 5T1KA 3EYOA 1WLHA 3ME0A 4P5TA 3NIGE 5F7DB 3SN6N 1J10A 1GC1C 4C56A 4J3TA 2OTPA 2CKBB 1ACYL 3HA0A 3MV9D 4I18A 4HS3B 1ONQB 1CFNB 2EDWA 4KROC 5H2BA 3RIFK 2AJVH 3GJEB 1JNNH 5IBUG 1WZ1H 1ZTXH 1Z3GH 3RL1A 4PREB 5FV1L 5GS0H 3GNMH 1WAAE 4GAGL 4KQ4L 1KCUL 3SE4A 2XTJC 1CXFA 1F11A 2W91A 4BKLB 2J1KA 3IGAA 1LO2H 3FRUB 4LSTH 4HK0B 4G9DA 3M1BB 2C7UA 1UQSA 4U1KB 2D7TL 5CCKH 5HYFA 1BFVL 5GSVA 3RWHB 4QRTA 1K6QH 1AD0A 4OZIB 1VFOA 2AKRB 4YIQB 4RZCA 3ZKND 4Y1AD 3QUZC 3OV6A 1II4E 1QR4A 1WTLA 2YPLD 1T04B 1N59A 5IJKC 3ZDZE 1NUFA 1HDMA 4K8RD 4PP1C 5JIKA 3VMNA 1WCBB 5F1IB 2I9LB 2EO9A 3HTLX 3BSZH 4HS8H 2ZJSH 4JPWH 5TDNA 1I3VA 3SDYL 3AU1B 4Q9QL 1MCFA 4XT1C 4UB0L 2HFEB 1S7SB 1CLZL 3B5TA 1I7TA 4KTYA 2QSCL 4U1LB 1J12A 1G7QB 1HSBA 2NW2B 2PTTA 4KROB 4OGAC 4TSAL 5E5UB 4L3CA 4FABH 1DL7L 3GSNB 4HLJA 5GGRA 4TNVK 3OAUL 3O6FA 1EAPA 1A7NH 3VW3L 2O26U 2FX9H 3CVIH 3LS4L 4JFHD 4KXZH 4WI3A 3K1KC 2GYSA 2XTJB 1XGRB 4QXTB 4OZFB 3HLAA 3TH2T 4LAQL 5JPNA 3DGGB 2IANB 3C8KA 3ULVE 2W07A 5C0AA 4IRZH 3PDOB 4YHYB 5C2BL 4GMTH 4P5TD 2V9RA 3L3KA 4RIRB 3VI3E 3VXSA 1YEFH 2ICES 5EUOE 4LLMA 3VGBA 3ZHKA 1QNZL 2CIIB 3FFCE 4C56D 4X6DF 2YUXA 5GGSB 4YK4B 3IU3A 5IGXL 4CVZA 4KV5E 2BCKA 4P2OA 3WUWA 1MJ7L 4Z6AT 3DTXA 5IB4A 3VRIA 4MA3A 2VLJD 3WXWL 3QUZB 4FQQB 3DROA 3QEQD 5IB2A 5HGDA 3LZFL 4N8VB 1YQ2A 4NJ9H 3HE6D 4RDQF 4F2MA 4M43L 4IDJH 5IVNA 4Y5VA 4HH9A 3GSVB 1J0HA 2X2YA 2YR3A 1UCTA 1S78D 5HHOA 1FVEB 1A7PH 2YA0A 2JJSC 1X6LA 5MEND 4F8QA 4XPHL 1AGBB 1RZKC 4NKOB 3F5WB 1ZHBB 5DWUL 1QACA 3OSKA 2H9GB 1JGEA 1KELH 3QHZL 4X5XB 3L3IA 3VA2C 3MLXH 2NY0C 2XKSA 4JG1L 1ZLSH 1ZXQA 3TA3A 1IQDB 4GH7B 5EB9A 3AM8A 4P46A 4AEFA 4MDIA 2CLRB 3P3YA 4HC1A 4P5MB 4BFBD 4PV9A 5E7BA 2H32B 3BAEH 1P2CB 4ONHA 1KLGA 5HYQA 4NWTH 4KKCD 1QLEL 4ISVA 3DRTB 2HRPH 1HHHB 1Q38A 1F2XK 2IBBA 4ZTOH 5GJSL 2QKIB 5GGQH 1OGAA 3Q5OA 3KLSA 3TFKC 1YY8A 2ERJC 3E3QC 4FQ2L 2PYFB 4O00A 1IGYA 4YXLH 1FNEA 4XC3H 3BZEA 1R5VA 4QWWD 1X4YA 2WSKA 1F2QA 1I1YA 3H42H 3TCLA 3PNWA 1KLUB 5DVOA 1CBVL 4HG4J 4NHCL 3O6FD 3W5NA 1ND0B 2ZSVA 4NUGH 5DTFA 5TQ0H 3O9WA 2YD8A 1QLFA 3EYUH 3NGBC 3CDGB 2XPGA 3EHBD 2XXMB 3FQUB 3JTSB 1F97A 2X4NB 5A2IH 3BRGC 2AV7A 1U8OA 2BVPB 1LMKA 3VXSD 3TWCH 3OKDB 4U6HB 1DBAH 3A67H 2MOVA 2VXUH 3QIBC 4UZGA 2NY0B 1BM3H 1A4KB 1CDYA 2QTEA 4P2OD 4FXKA 5DJ8B 3MREB 5JQ6L 5KVDL 3ZSTA 5KSVB 4PY8I 1TZHB 5CGTA 3TLRA 1OF2B 4YZFF 2ZOLB 4J23A 1M6OA 2J4WL 5IFAL 1DQDL 5D70L 3VRLF 4L8BB 3WBDA 5I15L 1ACZA 3FTGA 4J3SA 5D93C 1YPZF 1EDQA 1DBKL 2I07B 1F4AA 4KKLD 5DJAA 1NGYA 2Z8WC 1RUQH 5HHOD 2ERJB 3OX8B 4JN1L 1DTUA 5HYJE 2P5EE 3UP1A 1FZKB 3F6LA 4I0CC 5IROC 2Q8AL 4KUZH 1MHCA 1EO8H 1REIA 5AD0A 4HX1A 4S1QL 2IALB 3NGBB 2ADIB 4YDIH 4IOSD 3TA3D 3O6ML 4G42B 4AIZA 3LD8B 1ZWIB 4MWFB 4P46D 1GCFA 4PGJA 5E08L 1OPGL 2Y36H 3MO1B 4J1UA 5EZJA 4Z5RA 3ROLB 1OAZH 2W38A 4IEFB 4XCYA 1FVCA 4L8SB 3VFVB 2WAHA 1IM3B 3B83A 2ED7A 1FGNL 1MCRA 2A83B 2NLJB 1OGAD 4M5ZH 2N4IA 5DMKB 3QIBB 1D5MA 5AAMA 4OBRA 5HYSG 3PV6B 3QUXC 4LP4A 3BUTA 4FQ1H 5CP7A 2PCPA 3QUMA 4H1LB 1SEQH 2FLRT 3L7EB 4TULH 4F80A 2NXZB 2VISA 3EYSH 3HUJB 5EUKB 5GS2D 4U3HA 3GIVA 1D6VH 1YY9C 2W0LA 1H3PH 3QJHA 3WMSA 3O9WD 4N5UA 4UQ2B 3LS5L 4XVUC 5INCA 5EFIA 1WV7T 2BNUB 4B5EA 2VSDA 1IEHA 1CFQA 4GT7A 3MXWH 1AXTH 2CR3A 1YMHB 2BSTA 3S37L 2ARWA 4UINH 5I74C 1A6PA 4HPYH 4HUWA 5I18H 5DR5L 4QT5A 3WIIL 3MGOB 1C5BH 1XGYL 4QRPE 4XP5L 4HPOL 1JK8B 5GRJL 1SBSL 3ZYIA 1I75A 2ZUQC 4PG9B 2XIDA 4NM4H 2MKWA 3IDXL 4JFFB 2DQTL 2OR7A 4LPWA 2OYPA 3DRQB 5JUEH 5GGUA 4N8CH 5ID1A 2GI7A 2ZPKH 3UTPE 4D0DB 3U48A 2Z31C 2GQHA 4IM8A 5D7SL 4XCNB 2IADB 2YN5A 2V7HB 2CLVB 3QUXB 3MRBA 4LGRB 1SYSA 5DJYA 5LKNA 4I3GA 4RBPK 4V1DE 4XRCB 2XFXB 5DJ0A 4M5YH 2VDRL 2QR0B 4W6WB 3QZWG 4AZ8A 4WUUA 5F6IC 3CNKA 1MHHB 2P8LB 5D2LF 1H3GA 4QOKE 2JB6B 5JW3H 3GI8L 3TO4A 3CU7A 2R4SH 1SVZA 3KPPA 5J89A 3O45A 5F88B 4YR6A 3NCCB 4XWGL 3RQ3A 4F8TA 3IFOB 2KBGA 1A7OL 1L4IA 3C5ZB 2EYSB 2EYRA 2VAAB 1X5FA 3U4EB 3QPXL 1ZLUK 1MFBH 1P7QB 3HZYA 5AWNH 4QHKJ 4AEEA 5FO7B 1IJ9A 1MRCL 4LHJB 2R1YA 4Z95H 5H94A 5GS0D 2DQCH 4LU5L 4ZAKA 3RWJB 5IVOA 3SE3C 3HUJE 5DLMH 4X4YB 2VABB 5DSCA 1I1AA 5D7JA 1LE9A 1LP9A 1FFNA 2BSRA 3QEUB 3W11C 5D4QA 1S7WB 4JM4L 3VH8G 2B8OT 4JVUA 1QFWI 4O2EB 3T77B 4LASL 2Q86B 5IQ9B 3UTQA 3ILQD 2NQCA 5EOQL 1T7ZA 3UC0L 3MV01 1EIBA 1I3GL 5EC1A 3MROA 4IIQC 3RPIA 1ZSDB 1G9NL 3OJDA 4F9PA 1DVFB 1WISA 2IFGA 4MD4B 2UZXB 5KTEL 3ARGD 3TN0C 2ZCLL 5I19L 5F6IB 4ODSH 4ZFZB 1YNKH 2Z4QB 4MCYB 1PG7X 3PE9A 2NXYC 4YO0A 3STZA 3B2UC 3MQIA 4F15B 1A6TA 1IAOB 2X44D 5BZDA 3V6OE 3PQYB 4JM2F 1HHJA 4HKJB 1INEL 5JW4M 3C5JA 2EEBA 3BGMB 1E28A 3CDYA 4PBXA 1MCBA 4FFYL 4Y16A 4OQTH 1OD7A 4BZ1H 4Z7WA 2VC2H 1BQLL 1GOHA 3H0TA 2FLBT 1KB9J 4L8CB 4PRNB 3SE8L 3ARVA 1BJMA 3GMOB 4QRQB 3ECBA 2J88H 4LHQB 2COQA 3MUJA 1I85A 2B1HH 3T0DA 1KLFA 4DCQA 4PJ8A 3M17A 3REVB 4U6XA 1OY3B 3LEVH 5I1LB 4IIQB 3VFWB 5DRNA 4HJGA 4XNZC 3QDGA 4UU9A 4H0GA 4KC3B 1T83C 3MNWB 1UXWA 2A6DA 3MLSL 4HJJL 3SQBA 1BBDL 2AK4B 2HLAB 2H8PB 2A2QT 2AJXL 1F4WH 3EDFA 5D2LB 2YPKA 4ZAKD 1IM9A 2EICA 5JDSA 4UV4H 1I1AD 5D7JD 3C8DA 2G9HA 2CMRL 1WUNT 5SV4A 3I02A 5DFWH 1EZVX 3EGSA 3OB0K 4OLXL 5TE4L 1DE4A 4JM2C 2XQYG 4LEXL 2BNQD 4XC1H 4IHOB 1I9EA 4XNMA 1MREL 3DO7B 1IKFL 1F58H 4X7SL 3TM6A 3MJ6A 4G8GB 2CDFA 2BNRB 3FQNB 3BPNC 5DD6B 2NTFB 4EDWH 1RK0B 1WZMA 4K23L 1LO0H 4HIEB 3QRGL 1Q94B 2EDBA 1JWSA 5HJ3B 1OGTA 3DX8B 3ETBF 2ITCA 1FIEA 1AFVL 5DJXA 4RGNE 4Q58C 1OAYL 2J8OA 4Y4FB 5L7XH 1MJ8L 2HTKD 4OF0A 3HKFA 4N0RA 2OJZH 1UWGH 1NBYA 5BVJB 1NQBA 1RK1B 3VXOB 4LNRB 5TDPB 4Y4KB 1UCBH 1ZGLB 4Q9BA 5DK2B 3KPSA 1MCEA 2EECA 4M6OH 1LK2B 3HZMB 4Y16D 1V3MA 5DVMA 4XXCC 1P6FA 3QXAA 5IKCB 5B38B 2Y5EA 4FOMA 3WO4C 3R4DA 4L5FL 1F3DJ 4PJ9C 4JM2B 4Q6IB 1QKZH 5TF0A 3BP4A 3L5JA 1AI1H 3QUKA 1AY1H 3FN0L 4PS4H 1D5ZB 2OZ4L 4X83A 1JPSL 3KPQB 3ZKSD 3W39B 4OFYA 4MGXA 5DJDA 4OFIA 4EBQH 3TIDA 1FO0H 4AL8L 1P4LA 3VG9B 1DP0A 5T5NG 3ARBA 3GMPB 4ZG1A 1MCKA 4XNXL 5IR1A 2CLZA 5GSRA 3WUZA 1GIGL 3V7AG 1UKSA 3MRRB 3AC0A 3FQTB 2VZ3A 4FQXC 5JHDB 3IFPA 1MCLA 5IBTL 4QXGL 1AIFA 1KBGH 5L8KB 3OWEA 4HEPG 1EFQA 5D9SB 5BO1L 1MF2L 4KMTL 5C0EA 5F1SA 4JHWL 2MCPL 3S3PA 1IEBA 3C09C 1VFAB 4N0FA 2D0HA 1BP3B 3PWNB 2B2XH 2ZUSA 3B9KC 3DURA 1T89A 4Y5YB 5IM7B 4APQA 4RNRA 3I50L 1RULL 1IC4L 1K8DB 5F3HA 4PP2A 1D5BB 5EOTA 1O0VA 1SM3H 3WO4B 2CK0H 1MWAL 4PJ7E 5IHZA 3OF6A 2CIKA 4OSUL 4IS6B 5DRXB 1KN2L 1BJ8A 1FVDB 4FFVD 1IAKB 4G7VL 3CZFB 2G60H 4F7MA 1VADA 1U9KA 4WTWA 1A22B 2Y6SC 4MA8L 3QXTA 3L3HB 1ZE3C 5BRZA 1MFDL 4LAJH 4JZJA 3W9DB 5DJ2B 1HWGB 3PWLB 4ODTL 2ARJQ 3QH3A 3ZE2E 3C5SA 35C8H 2R2HB 3S36L 3GK8L 5ENWB 5ILTL 4KHTL 2YWYA 4FQXB 1XFPA 4WU7B 5CGYC 3EYVB 4PRDA 1NAMH 5GS1A 2PUQT 1S5IH 4ZUTA 2W1NA 3PL6A 1JFQL 1KNOB 4J6RL 5IFHL 4LLQA 4DTGL 4PJFA 3OKEB 1IT9L 2PTVA 4DVBB 3C09B 5IG7A 3O11A 5C0RL 4UT6H 4LLUA 4YFEA 4OFYD 2ZG2A 3VGDA 3B9KB 4YPGB 3SOBL 2Y07L 4FTVA 4YHNA 1XGQA 3ARBD 4DAGH 2PN5A 5CINL 3VD5A 4XTRD 5GZNC 3MRIB 1MFAH 4I5BA 4Y4HB 3LH2H 3WNNA 1IQWL 4DN3L 1E4KA 5C0CA 5I1JH 2GY5A 3PDDA 1CYGA 4XCFL 1JPTL 5F1NB 4HWEH 5DQJB 4A6YH 4YFLF 2V2XB 5FYKL 3MRJA 2UY7A 3K8LA 2AXGB 1L6XA 4MYWB 3VD3A 1DQTA 1WIOA 1TNMA 5IEHA 1M71A 1SY6A 4PPTA 2WQRA 4OZ4B 4X80H 2FH8A 2J8UF 5GRUL 5J6GB 4GQ9H 4O2FB 3MLYL 4M7JL 3QUYB 1QFWM 3UTZB 5IMLB 4YH6A 1BQHB 1HXMB 1IGFH 1VFMA 1P4BL 4K3GA 4TUKL 3VXQB 3OF6D 4DZ8B 4TSBL 1DANU 1XIWC 5I16B 2BZDA 1T5WA 4GW4B 3IU4L 1MCPL 3VFGL 4PRPE 2AEPH 4E42A 4U1JB 1U93A 5BRZD 2UVFA 2IH3A 3QEGH 4WU5A 3KPMA 2VE6A 4Q97A 3KLHD 4N0UB 5IIEB 4HSQA 4P48A 3KLAB 1P53A 32C2B 3C08H 1KCSL 2PYEA 1FFQA 4L8DA 5E2UH 5TPWL 3ES6B 3LEXB 5T3ZH 4U3XA 2VLME 2Q76A 4JVWA 4JFDA 3JTTB 3FKUS 3RPKA 2H6PA 2E7BA 4NQEE 1MRDH 4PY7A 3IFNL 2D0FA 5HD8D 4JO2L 2NY3C 3BUYA 3OKLA 5F7WC 3QUML 3VXTB 4MDJA 2QQLH 3QR2A 1YC8A 2IPUG 5E1HB 4X7FC 1OCWH 4FTVD 5JXEA 4W81A 1TVHB 4JN2A 4YDKL 5ACMA 1A3RL 5GGTL 4ODUB 5D6CB 1XIWB 2A1WH 2IGFL 4Y8DC 4YQXL 5C0CD 1VKXB 2FCBA 1KTDA 3MOAH 1DQLL 1A5FL 1FYTA 3U36B 2NCMA 1PG7W 5B3JF 2OJEB 4JFEB 5GS3A 4LCWB 3KJ4C 3O4OB 2BHUA 3PHQA 5CSZB 1IC5L 4CJ0A 2A74B 4OZHF 3HI6L 4ZO7A 2VB5A 4JO3H 3LIZL 1B6DA 1G6VK 4LLYA 1DN2A 2X4RB 3MSPA 4XP6H 2BDNH 4HKBB 4J2XA 3L7FA 1FFOB 1ZT1B 2LVCA 3BEVB 5IVXA 3TBWA 2HT3D 4KH2A 3TPKA 1XH3B 1IGML 3Q6FA 4YGVA 3BN9D 3IDJA 4WW2F 2UWEB 1X6NA 4AMKL 4NZRL 3QIUB 1OP5K 1NMBH 2OX5A 4NP4H 1PKQE 4OB5H 4YX2H 3RJQB 1SJVA 4XVTH 2R15A 3P0YL 2IAMD 2VR4A 1YEIH 1WZKA 5F8QC 1W72H 2XNAB 4U2YA 3RVWC 1I7UB 4K55A 1V7MH 5J4MA 3V6ZB 1A1NB 3ZKNC 5JLZB 3O0RH 2QQKH 3ARSA 2V7NB 2EXWD 3I75B 3BKCH 4YHPA 1EFXB 1XGTA 4K8RC 4NC1E 2ESVE 1MCIA 3LKSA 1U6AL 1XGUA 4HXBH 4JFDD 4PJEE 4MJ5B 1NDMB 3LVEA 4JY6A 4GMSH 3Q48A 1IE5A 5L9DH 5E95B 4LLAA 2APFA 5T1LB 3SDAD 4J3XA 3V95A 4BZ2L 4OTXH 4TVPL 1A1OA 2ZCHL 1U3HA 5EDXA 2YRZA 3FOMA 1MOEA 3GMQA 2XI9A 1PX4A 1K8IB 4OM1H 5DMIH 4PGCA 1ITCA 1R3IH 2EIBA 5JXED 3S5LB 1G7LB 2GFBA 4JFPB 1MCOH 3L5WB 4K3DH 5GRWA 4LBEA 2VSCA 3DHJA 4JEGB 3GO1L 4ZO9A 5D2NA 4KRLB 4WW2C 4PJGE 2RB8A 3E8UH 5I1IL 4E41E 1DDHB 5IB3B 1TXKA 3FB6A 4OZGE 5HI3D 4P5TC 2HVJA 4XX1G 5FYJU 3WN5B 4UAOC 2A6IA 2X42A 3HNTL 2BY2A 1YEDB 1W0WB 4I18C 4D0BA 3NFSH 1T1ZB 2VH5H 3IAPA 4GBXA 3UTSA 4JO1L 1KCKA 3G5YB 4XBGA 3MZTA 5EU3A 4NZUL 5CLTA 3V6FA 1BJ1J 4ZS6D 1FH5L 1KCVH 3S4SB 3RFZC 1KIPA 1NAKL 4AT6B 3QNYB 4R4BA 3BISA 3V4PL 2HLFD 4UDTB 5EZIL 1CWVA 3QG6A 3SE4C 4K94H 3G5VB 1S78C 4JRYA 5J8OA 5T1DH 4S1DC 4MNGA 2J6EA 4OZHB 2OMBA 1QVOB 3AROA 15C8L 3C8HA 3A6CH 1TZIA 3K4ZA 5C71A 4JFYA 4NCDA 4R2GD 3D0VB 5HI5C 5ABDE 1HZHH 2ZCKH 5J6HB 4L29B 4BH7A 1NL0L 5JW4R 2JCCA 1YQVL 3DUUA 3O6KL 2J7LA 5FM8A 1MRFH 4U1IA 5KJRL 4HGMA 3VG0L 5DT1H 3DX6A 5JOPE 5KG9B 4WW2B 3U1SH 1IC1A 4GG8A 3BRFA 5GISH 2F9BT 5HGBA 3MV8B 5I1AA 4NRZB 5T1KB 5TQ2H 3EYOB 4KKCC 1Q9LA 4P5TB 5HYEA 3HE7A 4MCZA 3QI9B 2E3VA 4U6VL 3UTTE 1JF6A 2EKSA 1VGEL 4X7DC 2EDHA 4UAOB 1OAXH 3PWVB 3VRJA 1N6VA 1AC0A 4U0RC 2VL5A 1LO3L 5C07D 1U3HD 4QWWC 3AS1A 4XPAL 5H2BB 3NZHL 1T3FB 3ZE1F 2DQHL 3L5XH 3UJJL 3O6FC 1CVRA 5BV7H 1BZQK 3RGVB 3O8XA 1UM5L 3EHBC 4QHNB 4QGYA 1F11B 1CFVH 2IPTH 1KV3A 3LKPB 3HC4L 3STBA 3UO1H 3CFIC 1OTUD 4NSKA 3CDFA 2C7UB 5IESL 4CVWA 1UQSB 4ZFGL 4MNQE 2BXZA 4KI5E 2FB4H 4JKPL 1KJMA 4MSWB 2APWA 2P47B 4QRTB 2BRRL 3IDMA 2X4OB 2EDRA 1OAKL 5JR1L 4XCEB 1BIHA 3BDYH 4DQOL 3CMOH 2EH7H 3BP6A 4JO4H 4P2OC 4OM0H 1MI5D 5FOBB 4GBXD 3UTSD 1PYWA 3L3JB 1UJ3B 2CD0A 3NAAH 4U33A 4R7DA 4MAYD 3RNKB 3THML 1JTTA 4O5LL 4Y5VC 4KKLC 2AABL 3LMJH 4JRYD 3FFDA 4JB9L 4U0RB 3MNVA 1OHQA 4NM8H 4XMKL 5JA9A 3SGDI 4WWKA 1HSBB 5K9JL 2PTTB 5EO9A 2ADGA 3ARXA 4BQCA 3JXAA 3KPRE 5ACZB 3OZ9H 5GGRB 1CGSH 1CDGA 1EAPB 1DQQA 2DI7A 1AP2A 5AZEH 4N5ED 4XMLL 3TJEL 4LQFL 2MPAL 3TA3C 5KS9E 1BGXH 3AM8C 4P46C 1D9KD 3FO2A 3WJLA 5JPNB 3C8KB 2GCYB 3RWGB 5C0AB 3OXSA 4DJMA 1KXVC 4NQCE 7FABL 5DUBA 1I3UA 5A2KH 3HE7D 3L3KB 3VXSB 1QSEE 4YHOH 1UACH 2W9EL 1ZANL 4YC2C 4LLMB 1JI2A 1MUJA 3BH8A 4RFEA 4B50A 1FQ9C 2P5WA 3EO0A 3WUWB 4RBPH 1INDH 4MJ4A 5CEZH 1J88A 3DTXB 3VRIB 5JIPA 3FJTA 4RISL 2ADFH 4Z0BL 3MUY1 3DROB 4CAGA 2VQUA 5IB2B 3O9WC 2VTFA 3HRZB 2XKUA 3O8XD 1TZGH 5DJ6A 4Y19A 4HH9B 5DVNA 3D69B 4I9WD 4N9OB 5SWZA 3H9SE 3CGTA 3VWJA 4C57C 3KYOA 4QRUA 4NQUA 3VGGA 1ZLUH 1K5NA 1HK6A 1GGIL 2RGSA 1EA9C 5T3ZD 2Q8BH 4M1DL 4JZNA 2Q7YA 3DX9A 3TA3B 1N64H 5FYLL 3SDDB 5D7LE 4FP8H 4P46B 1Q1JL 4MDIB 1KFAH 3GB7A 2WLYA 4ETQA 4P9HL 4P23A 4PV9B 1FC1A 4R96A 4ONHB 1KLGB 4ZS7H 1MIML 4OD3H 1NCDL 1LEGB 1G7IA 4ISVB 5ESQA 1YEHL 4YFLI 5E0QA 2RQ8A 4YC2B 1OGAB 5GZOD 3KYAA 1F45A 2XZCH 4ODXA 1B2WH 2AJ3A 1U8PB 1IGYB 1W8OA 3EDEA 3EFDL 4LCCA 5IHUH 5TGBB 3U30C 1R5VB 3BZEB 1NGPH 4GKNA 4WWKD 3TCLB 4J3WA 3RAJH 2R0LH 5L2JA 1N5AA 4ZOBA 3V4UL 1Q9WA 2VR5A 5I1EH 1NGQH 5FOJA 3NBNA 2ZSVB 5DTFB 3O9WB 1QLFB 1DLHB 3NTCH 3PWPE 2FYYA 2XPGB 2KQNA 4JJHA 1TMCB 1DUYA 4QEGA 1J5OH 4UDUA 2X6MA 2AV7B 3WS3A 2E6QA 3NCYP 1U8OB 3IDNA 4M48H 4FMKA 1F4YL 1ORSA 4Y2DD 3REWA 3DVIA 3WXVL 2YEZA 5SWSB 3RX7A 3UBXB 1ZGLM 1MHPL 3O2VL 4L4VE 3G6JB 2X09A 2P5WD 5GS0C 2Q7NA 3FO9A 4FXKB 4H0HB 4WW1B 1FNSL 4NO2A 2VLRE 3ULUL 5EU4B 1M6OB 2VOTA 4HWZA 4WUKL 5JHLL 1AGFB 4KKAD 4RAVB 1MEXH 4B41A 3QSKB 1KGCD 1KTKE 4JRWA 3SGJC 2EYTB 3TNMA 3ILQC 4G9FB 4GG6A 1SY6L 5GRXG 5DJAB 1J1OL 1XF4A 5LWYH 1KULA 3VWJD 3NPZB 3U30B 1GZPB 3CSPA 2DLIA 4NO3A 4AIOA 4Z7UB 1DLFL 1GYAA 1NEZA 3ARGC 1MHCB 1R5WA 2W59A 2ZUYA 4WY7H 5C6TH 1DQJA 4HX1B 3C2AH 4PIRF 3MA7B 5H37H 4AIZB 4ETYA 5FHAH 1LP9F 4XXDB 4NCC1 4MXVE 2DQIH 4HWBH 4P23D 4J1UB 3OB0H 4Z5RB 4N0CD 3RL2A 3D39D 5A3ID 2XN9A 3RDTA 1RUPH 5EU6E 2KPNA 2AJSL 2BP3A 2ID5A 3M8OH 3BKYH 1X5LA 4LGSB 4PJDE 2VXSL 1D5MB 3TYGL 5D72L 3FQXA 5CP7B 3GJFH 4N68A 4U1GC 2NY7L 4HV8B 4PJAE 3QUMB 5DDHB 4WHTA 1DN0A 4GRLA 3HG1A 1JHLH 4LL9A 4JANA 1JPGB 2VISB 3LEYL 3S9DB 3GIVB 4HKZA 4QKXB 3QJHB 1EGJA 1VFBA 3BHBA 5INDA 5INCB 4LRNH 5EFIB 4HT1H 3TO4C 2D7OA 3X14A 4GKSA 1CFQB 3ZKXB 5FYKE 2XWBA 2WUCL 2BFVH 1P5UA 4F7PA 3IJYA 1CS6A 1KYOK 4KGJA 3FQWA 3FHAA 1TJGL 1VGKB 1RFDH 5SWSE 4LLWB 1NGZA 2Y7QA 4HUWB 4ZQKB 5CKGA 3CLFH 3DYMA 2BOBA 2DJSA 3QIWA 5E6YA 4BELD 1C7SA 1QFUL 2AEQL 4U4BA 1ZLWH 2FEDD 5E8NA 2OS7A 3WFHA 1AO7B 1CD0A 4ZAKC 4Z7WF 1I1AC 2VZOA 5D7JC 4L4TE 3QXWA 4GRWE 3EDJA 4OQ1A 4G9FE 4KRPC 2Z92A 4MQ7A 2IH1A 2NW3A 4LVNC 1NMAL 1CQKA 4YGAB 5DQDL 1FAIH 3MRBB 1SYSB 4ZUWA 5E56A 4F9PC 5TFSH 1U8NA 4CNIB 4JDTH 5EIIA 2P8MA 4WFFE 2H1PH 3DV4A 1VACA 4QXWA 5DHYB 4WUUB 5CIPB 4HBQA 3O3AA 3QJFB 3WNLA 3GKWL 1B0RA 3TO4B 2HTKC 3KPPB 2BXYA 3X3FL 4FNLL 4DGYL 3O45B 2GUOA 4YR6B 3KYKH 12E8L 2HJKA 2HKFH 2XN9D 2DJUA 4CKVX 1FDLL 4XVJH 5BMFH 4UIKH 2F54A 3HZYB 2QQNL 2LV4A 2R1YB 2IMMA 4F7CB 3DETD 4U1HA 4Y16C 4ZAKB 3JWDH 3D3VA 4TPRH 1I1AB 5E8EB 5BS0D 4LSQL 4GRLD 3P4LA 1ADQA 3HG1D 2OL3H 1LP9B 4WEUD 1I8IA 3K4AA 2BSRB 1IGIL 3OGCA 3SDCB 4NHUA 4KRPB 3E3QE 1CD8A 1QQDB 4HD9A 5DFVD 1F8TL 4LVNB 1I85C 1HILA 1F3RB 3V4VL 3UTQB 4JDVA 1AJ7L 5HHPA 2DD8H 4PJ8C 2QSQA 8FABA 1FNFA 5EC1B 3RPIB 3MROB 1B0WA 4MJIA 1NC4A 4ZUVA 2RJMA 3OJDB 2VERN 4YHZH 5EH1A 3GDBA 3WIFA 4M9PA 3GKZA 3U6RB 3QIWD 2FBJL 3MLUL 1N0XL 2HMID 2V2TA 4U1MA 3CC5A 4K9EH 5JOFA 3OL2A 3B5HA 3B2VL 4YO0B 3STZB 3GBNH 2CXGA 5EIVA 1NCCH 2CKBH 4KQ3L 4K71C 3HMWH 3SKOA 1TIUA 5BZDB 3Q6GH 3RA7L 2FD6H 3VFTA 4UUJA 2ORBH 2ZKHL 5J3HD 1HHJB 4ODWA 4YEEA 3TO2A 1NGWA 3CFCL 3MRLB 1E28B 1WFUA 4PD4J 1PBYA 3FOLA 4WDIA 2B7DT 2EDTA 4Y16B 4XH2A 1GJIA 5E99H 2X7LA 4Z7WB 3D9AL 5CAYB 1YECH 4MD0A 4M1CD 1D3CA 4ERSL 4OT1H 3VGFA 4DUWA 3QDJE 3ECBB 5FK9B 4YHLH 3VXMA 2NY2C 3FO0L 5DS8A 5B3NA 4UOJA 5LJYH 1U3ZA 5M95B 1D5IL 1CL7L 1RZFL 4LKXA 4DCQB 1FL5B 3LRHA 4PJ8B 5JZ7D 3MNZA 3STLA 4QHMA 3J7HA 3FB7A 2J6EL 4HJGB 5E8OA 1OW0C 5CEZD 3QDGB 1IZKA 1T03H 5I1HH 2CRIA 1EAJA 2CJUH 1JWUA 3MYJA 4TVPE 1AHWB 1YYML 2EIDA 5JDJA 2YPKB 5JDSB 1IM9B 5AZ2L 3ZKQD 2AXHA 2HRLA 4PLJD 1OTSD 4K71B 4PRHE 4X4ZA 2G9HB 2P7TB 2Y23A 3I02B 4NWUL 1J05B 5TF1L 2G75A 3CK0L 2YA1A 3GSNH 5EBLA 4HUUB 1QFWH 1KPUA 3FZUD 3MJ9H 4LIQE 4Z77B 3NN8B 2CDFB 4MJID 2R23B 2GT9A 4OZFH 2HJFA 4KHXH 3ARBC 3MLZH 3OR7A 3AAZB 1MJUL 4HWBA 4I48B 2I60H 4XTRC 1JWSB 5EN2B 1OGTB 4DGVH 1HHKB 4HK3J 2ITCB 4OLYH 5DJXB 4EXKA 2NY2B 4JQXA 3UBXI 1A6WL 2JJUA 3MCLL 4MB3A 1JF1A 1T1YB 4UIMA 1U3YA 1QD0A 4I3RL 4XP1L 3WDHA 1VEMA 3GJFA 3RRQA 3K4DA 4NKMB 2NR6D 3EW3B 3AMLA 4PJFF 3O4LE 4AJ0A 1YMMD 5SX5K 3MX0A 3KPSB 3P9MA 4POUB 5LXGH 1QEWA 1G7MA 4F58H 1A7RL 5C0JA 1EVTC 3T4AB 1T89C 5K9KA 4APQC 3V0WL 4S1SL 2YK1H 1UZ6F 1OSZB 4PJBE 5A2JH 3H9HA 1FYHB 1P84K 5DRWA 2BVQB 1UADC 5I73B 3BP4B 3QUKB 4KKNA 3BYTA 2AEIT 3UXFA 4KJWD 4MXQD 3BKMH 3P11H 1FL6A 3G5XA 3MLPA 2AJZA 5DD3L 3TIDB 5JO5A 1JNJA 2E27H 3KJ6L 3N85H 1MAMH 5JW5A 2VDML 2H32H 3KS0J 1ZKAA 3X13A 3A6BH 4JZJC 2ITDA 3NA9L 5CZXD 5SV3A 1WICA 3TYFA 3BO8A 1AXSA 2CLZB 2EC8A 5C09B 4AEIH 3WIHL 4BYHA 2Y06H 3BT2H 5GRYA 1RQ5A 3NH7L 4Y0GA 5KSBF 5GS1C 5F93C 3MLVL 3TBVA 1EBPA 1WAAA 3L3GA 4P2QB 3PL6C 1DBML 5E8DH 4HBCL 1OP5H 1F02I 5FUOL 5HD8C 3SKMA 1IEBB 2DMKA 5FGRA 5H37G 2YSSA 4N0FB 4C83A 5K59E 2N7BA 3VXRD 4APQB 1KEML 4RNRB 1RJYA 2R0ZH 1JTPA 4Q9RL 4L3EE 4BFEA 4PP2B 3EBAA 1RZKH 5CZVL 1T7VA 3G6DH 1MCWW 1HINH 3Q3GA 4K3JL 4P9ML 5IHZB 3IF1A 1GL4B 2FNBA 1E4KC 1IRAY 3LQMA 4JRXD 3RVUC 1RUKL 5B8CB 4WWID 1CFSA 1CICD 1G7JA 1UWEL 4F7MB 1VADB 2AEWA 2WWMD 1OTTD 1N2RA 1HQRA 2OL3A 1I9RH 4MJ6A 2AVGA 4JZJB 2NY6D 1CG9B 1LK3L 3QH3B 5BQ7A 2D31A 5FAAA 3C5SB 2YKLL 3UPRA 2QHRL 43C9A 4DKEL 1OAQH 1NGXA 3RP1A 4GAYB 3JV0A 3QWOA 5GS1B 3BPOB 5IK3A 5FYJL 2HT3C 1CE1L 4ZUTB 2VITB 3PL6B 1CIUA 3BN9C 5FM5M 1ZA6A 1MJJA 3QT2A 4YFDB 4P2CG 2FO1A 3NPSC 4UBDD 1AE6H 1X4XA 3O11B 4JKLA 4XPTL 4UV7H 5F7DA 3C87A 1KJ3L 4R4NC 4DKFL 2XWJB 2IAMC 5EBMB 2EDJA 5EUOA 4YHNB 4HS3A 4LSRL 3C2SA 1ONQA 1CFNA 2W65A 5DC9B 4KAQL 2IEPA 4I5BB 3UMTA 5C09E 3RTQD 3MLWL 1M7XA 5C0CB 2ZUUA 4GKZA 4PREA 5CKAA 4P2QE 4QHKI 4C4KO 1SVCP 5IVXF 1IC7L 4BKLA 4K3HA 4H1LH 5HVFB 4M03A 3FRUA 3RWFB 1L9MA 5F71A 2VDQL 5F1OB 1M71B 1JGLH 3RWHA 1A8JH 1L7IL 4M7KL 4AIXA 4YXHL 4H8WL 4Z7OF 5J0BA 4K7PH 4K7FA 4YIQA 1J18A 2F74B 2X10A 5KSBB 2VDPL 5JXEC 2PR4H 2HJLB 3QQ4B 5C0IA 1P4IL 1T04A 1RI8A 1DSFL 5D96C 3WFZA 4HIIA 3U0TA 3NPSB 4NT6A 2Y4SA 3O2DA 1R0AL 1MNUH 3MOQA 4G6JL 2APTA 3I2CH 4LVOC 1U93B 5HI3C 5KVGL 3AU1A 2HFEA 4GXVH 3CDCA 5HPMB 4OF5A 2R29H 4NQDB 1FZOB 3IETA 4FQLH 4WU5B 2EDKA 1G7QA 1RZ7L 2VE6B 3DXAE 3OJVC 1CXEA 2IFFL 2A6KA 2DQUH 3F62A 3GSNA 4JCLA 5L2KE 1EXUA 2I9TB 4OCMC 1NLBH 3MRFA 4MXWH 3BH9A 2PYEB 3DNKA 4ZS6C 1VDGA 3AUVA 4L8DB 2WW8A 1FLRH 2RAMA 1XGRA 4QXTA 2Q76B 2HLFC 3SQOL 2CGRH 2GJ6E 2IANA 3FONA 3HNVL 4M7LT 3PV7A 2JTDA 2IBZX 4RIRA 1KACB 3TBSA 3BUYB 5C0ND 2D7QA 1T20A 4MDJB 4R2GC 1KT2A 4MAUH 1KPVA 4OI9A 2DLFH 1TCRB 1EGJL 3OBAA 4FQQA 1A14H 1T2XA 5F21B 4R4FL 3ULUE 5D96B 2DKMA 1G0XA 3JV4B 1KTDB 3EOTL 3CXHJ 4OUUA 1FYTB 5HHME 4PG2A 4JJ5A 4LVOB 5HVWA 4P3DB 3GSVA 1HCFX 3HFMH 5D8JH 4ZNEA 1J0KA 3OAYK 3WE6B 4X6CB 3PHQB 4PGZA 3GHBH 5ID0B 5I1GL 4NKOA 2X4QA 3F5WA 5B22A 3T0EE 3BPLC 2FL5B 1BREA 1U3HC 5HYJA 2P5EA 3DGCR 2DJ4A 3IVKA 4X5XA 2NY1B 4QRRE 4QNPE 1XF3B 2O5ZH 3N50A 3BIBX 4AYFA 3L7FB 4POZD 1U0QA 4RWYL 2JCCF 3N1GC 5E00B 3TBWB 5KANI 1G0YR 4WFHD 4YGVB 2DOCA 1Z0NA 2DTMH 1A02N 1P2CA 4HZLA 5D2NC 5IMMB 5AYUL 2QSTA 5CZKA 3BQUA 4ORGA 3VWKA 5ETUA 1OTUC 1HHHA 1HIML 5HHVH 3CUPB 3MRQB 5DD1L 2MHAB 4NQDE 1FC2D 5E6ZA 5ISZB 3SE9L 2JB5L 2PNDA 3O2WL 4WEBL 5CJBA 1NCAL 2VDNH 3ARRA 4OD1H 4GBXC 4JHAL 3HAEB 1FORH 4TQEL 1DFBH 4ONGL 3GFUA 1AGDA 1NUNB 4YHPB 1XGTB 3JTSA 4MAYC 1E4XL 4OZFG 2R56L 4NOBA 2X4NA 1XGUB 5LGHL 2IAND 1CGYA 2DQJH 2JJTA 4RMVA 3CLEL 5K9QI 4WCYL 2DQGH 4CMHC 2YZ1A 1A1OB 4FFZH 1OARH 3OKDA 4NIKB 1N6UA 5E2WL 2AGJL 1BIIB 2V9TA 3GMQB 4WFEE 1A4KA 1ADQL 2VUYA 4PGCB 3TBTA 3MREA 3CSBA 5FCSH 4JZOB 4RQQB 3BZ4A 3QUZD 5C0GA 3K1DA 4N5EC 1OF2A 4LBEB 2F53B 2RFXB 2QADB 4WI9A 1JMXA 4N8VG 3BWUC 4IMKA 1ACYH 1AGEB 3P0GB 3FB6B 3GEWB 5HDBF 4X6CE 3S34L 4LCUB 2PETA 3ZYJA 1S9XA 3HE7C 3NCBB 5ICXA 4B53A 1X5JA 3IAQA 3OKOA 2YA2A 3N0PB 1W0VB 3W0WE 4OGAD 3GSRB 3VFUA 2E7CA 4GAGH 4D0BB 4KQ4H 4V1DA 1KCUH 5HYJD 2P5ED 5KVEL 1QFOA 5EU3B 4MB5A 3I84A 4O02L 3V6FB 5EOCJ 1NH6A 5GQBA 4G42A 2XZQL 1FFRA 1ZWIA 4MWFA 2D7TH 4QOKA 4R4BB 4MLSA 1BFVH 2AERT 2K1MA 5CWSA 3O8XC 1AC6A