4NC1E

Crystal structure of tcda-a2 bound to a20.1 vhh and a26.8 vhh
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
124
structure length
124
Chain Sequence
b'VKLEESGGGLVQAGGSLRLSCAASERTFSRYPVAWFRQAPGAEREFVAVISSTGTSTYYADSVKGRFTISRDNAKVTVYLQMNNLKREDTAVYFCAVNSQRTRLQDPNEYDYWGQGTQVTVSSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell wall-binding repeat protein
publication title Structural Basis for Antibody Recognition in the Receptor-binding Domains of Toxins A and B from Clostridium difficile.
pubmed doi rcsb
source organism Clostridium difficile
molecule tags Immune system
total genus 31
structure length 124
sequence length 124
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nc1E00
1KIPB 2IPKA 2WBKA 4J3TA 1PBYA 5GRZA 3GSWA 4PRHB 3SE3A 3P2TA 4EN3C 5EPMB 2Y5TB 1DQMH 2B7DT 3VXSA 1KT2B 3B4NA 3U4EB 3X12A 3HC4H 3WN5A 2ZSWA 4NP4L 4OSUL 1RJCA 2XQYK 5CEZL 5ID0A 5C0IB 1D5IH 5GGTH 1OB1B 1CD1A 1GGBL 1M4KA 3IAQA 4O51A 1IJ9A 1OY3B 3WIIH 4LRNL 2BP3A 3QNXB 2BY2A 5C92A 3ARSA 4UTBH 1NAMH 1KG0A 4WEMB 2XKSA 1AD0A 3RWGB 4JN1H 4LHUD 4WUKH 1V8HA 4ZUWB 5C09A 1KIRB 2ADFH 5F3HA 4XMKH 3T0AA 2NY3C 3BSZL 4D0CB 4WRLA 3ZTNH 5CD5C 1PJ9A 5CP3H 4HAGA 3I50L 4ZYKB 4XPTL 1JHLH 1S7VB 4JN2A 2YKLH 3HE6B 2X2YA 3ARVA 1BGXH 1A3LL 3EHBC 4KPHL 3SO5A 1KYOJ 5D71L 3SQOH 4S1SH 3E3QC 4FN0A 1S9YB 3MV11 4RDQF 4BZ1H 4S1QL 4ZDHB 1M7XA 2ICWI 4FQJL 1T04B 5I19L 1DQLL 3CDFA 5T1KD 1FN4A 4G8EB 5J57B 4P2QA 2BSRB 4NBZB 1UZ8A 4GMSL 4ESKA 4YIQB 2GIYA 4HAFA 1ZEAL 2VXSH 3MLTB 5IJKC 2A6IA 3IXAA 4IIQA 4ISVA 1A2YB 3QCTL 5B38B 4PJDA 2DOCA 2HFFB 5EZLB 1RIVL 3N1MC 3WNKA 5C0BB 3C5SB 1W0WB 5E08L 2VABA 1U8PA 3JVGC 3FHQA 5KS9F 3U83A 5FXCH 3Q6FA 4GAJH 4OJFH 3DX9B 1U6AH 4JM4H 3R4DA 1FG2B 3WS6C 2AK1H 5E9DE 3P11L 5H2BB 3BGFC 3D18A 5IFJA 4PJAA 3H3KA 2KQMA 5JIPA 1Y6NR 4ZQKA 4OZGF 4EXPX 4OV5B 1MHPH 1DQDL 5SWSD 2FBJH 4GFTB 3TO4D 2YUWA 3P0VH 1LE9A 3MOAL 3GBNL 1MFDH 4NO0B 4PV8B 5IFHH 5F9OH 1U41A 2R0WH 4WV1B 4XX1G 3FQTB 2BOBB 3CK0H 4EQ2A 1NFIB 3FFDB 2DJUA 4FZEH 4UQ3B 1S7SA 2DI8A 1HXMB 2Q7YB 2EEDA 1S5IH 3V4PL 4HXAL 3RHWF 1FLRH 2IAMB 1V05A 4KZEL 5CEYA 5EUOF 2A38A 1KJMA 2ZUUA 1A7OH 2VQUA 3BP7A 3FOMA 1WZ1H 5ICZA 1RAMA 5T5NG 1B0GB 4P2OD 3WFHB 4HIJA 5CSBA 1EJOH 2F54A 2WLYA 1U8JA 1JPFA 2YA2A 4ZFOA 4TVPE 5GZOC 4M7LH 4XPHH 4I9WE 3CNKA 5DRWB 3SHSA 3CLFL 4QHUA 1J11A 1B6DA 2VYRE 4GRLB 3I3DA 1VCAA 1BIIA 5I1CL 2V9RA 4I5BB 3M1BB 3R0NA 4JFFD 1PYWB 4U6VH 5LQBH 1X7QB 4RFEB 3VXOB 3C8HA 4Z7VB 2CKBH 4U0RB 2DQIH 1F00I 2DLEA 3DIFA 3U2SB 2NXYD 4N1EA 2BDNL 3O6KH 2C26A 1Q38A 1WEJH 1CS6A 1DP0A 2MOVA 2DIJA 1H8NA 2XXMB 3HE7D 3LCYA 1P4BL 3LKNA 4JRXB 1T1YA 2BOCB 1YEGH 3MXWL 4FQIH 4QCIA 5IG7B 3FHAA 5IEHB 3L6FB 1QFPA 3LS4L 1X4YA 4WHYG 2RFXA 3GKZA 5ANMA 1HKLH 4GW1A 3QRFM 5IHBA 1CFNB 4ZO9A 2IFFH 3NAAH 4X99A 1OT1A 3B9VA 3QO1A 1XGUA 3HZKB 3MLZL 5I8KH 5D4QA 1MFNA 3R0MA 1H9VA 4ETYA 5C07B 1S8DB 4NNPH 3EOBB 1DUYA 3DSFL 4N0CC 4P57A 5BS0B 4NO5A 4EEEA 4JZNB 3RA7H 3KGRA 1RULH 5HJ3B 2WIMA 5JPNB 4TVPH 1DVFA 1HEZA 1IC5L 5F7DA 4QXGL 5KVEH 3BKJL 1XR8A 2BHZA 4IRJD 3E1F1 3QFJD 1WAAE 4QHMB 5MERB 1TZHB 3G6AB 4WU5A 3BMWA 3AS2A 4L8DA 3HRZA 2FJHA 3GSOA 2DI7A 4KROB 4BQ6A 3V2AR 4KAQH 4I3RL 3RKDD 5F9DC 1HH6B 4XBPA 4IM8A 2D7TH 1KJ2B 4PGBB 3VFUB 3MGOB 1AY1H 5F1OB 4BKLB 3ECBB 5ERWA 4RDQG 3VG0H 2RR3A 4QOKA 3H3PH 5J6HA 3MRQB 5HD8D 1JGUL 3ZKNC 1ONQB 1NBYB 2XN9D 3B5TA 1X5LA 1XIWB 4ALAH 4E41E 2HLFC 3AROA 5H35B 3B2VL 5EORL 2MTPA 5GS2D 2V5TA 3RVVC 1LILA 4OKVA 3FTGA 4GW4B 5FO7A 2C3XA 4N0YL 3MJ7A 3EYFA 3B5GA 4R9HA 3T2OA 1TENA 2X7LB 3DYMA 1EO8H 4RMUA 4XBEL 3O3DB 5DRZB 5KANI 1NMBL 2XKUA 4HJ0D 3ARGA 3FB8A 3BW9A 1ZT1A 5FHAH 1WF5A 5DD1L 5EO0B 1EMTL 2HVKA 1K2DB 3U4AA 5HHNB 2BCKB 1YEHL 4DCQA 1NJ9B 5F89B 3IVKA 1BQHA 3SDDA 1NBQA 4OF8A 4PJ9B 1T20B 3TIDA 5I76A 5DHVB 1QNZL 5GRUL 1BJMA 1HHJA 2NZ9C 1GOGA 5IM7B 1UWXK 5J1AA 1QLFA 1PLGH 3VXQA 4W68A 4AT6B 2AJZB 5FCUH 3PGFH 5CJQL 3U36A 4X98A 3O4OC 3IFPB 4ZOCA 4PJFF 2YD9A 1AGFB 1H5BB 5JR1L 4QF1A 3MMEA 4PP2A 1E4XI 2XI9A 4N5EC 5BV7H 2DM3A 5DSCA 4X6FB 1EEZA 5F1IB 1VEMA 2ZCLH 2GUOA 3MV9B 2NY6C 2UWEF 3AREB 4WDIB 2R9HC 4ODVL 3NGBC 2XPGA 4X6DA 3TBVA 4HH9A 4F37F 1FCCA 3HKFA 3VDCA 5JIIA 4X5WA 2PO6D 4O2CB 3BAEH 5J56B 3UTSE 4HHAB 1N5AA 4FTVD 4OZFA 5E9DD 4GUPB 1QG3A 4RMRA 5FKAA 1U3HA 1MRDL 4MJIB 3G5YB 2AV7A 4MA8H 4JFQA 1FORL 3A6CL 3L3KB 4PJBE 5EO9A 3BGMB 2FO4B 4PRHD 1QD0A 5IBTH 3ETBF 1KGCD 3LIZH 4RISH 4PGEA 4PRPA 2GK0A 1E27B 3QXDB 1NCCH 3GO1L 4X7SH 3G5VB 3CH8A 3V6BR 5IROA 4M1DL 2DF3A 1UH2A 4AH2B 1DL7L 4GLRI 3M8OL 2NY2D 3CVHH 3MA9L 3VFMA 4GT7A 1J5OL 2VDML 2J6EL 4FRWA 5EO1B 4PJ7F 1QBML 4JFXB 2G60L 4UBDD 4MB5A 2X4NB 1N0XL 5CJOH 3T3ME 4NM4L 5JW4N 1JWSA 1OM3L 4KKNA 1AXIB 3KPTA 2ZUYA 1CGSH 4PRID 4JQIH 1I8KB 1OWWA 1HQ4A 2ED8A 3RVXC 4PJIF 5F7MC 3G04A 3SKOB 3VU2A 3RFZC 2GSGB 4S1RH 1RIHL 1UH4A 4MHHI 2ZJSL 5E24E 3GBMH 4I9WD 4YDJA 2FYYB 4YGVA 2PUQT 4ZS6C 4G80A 5ICXB 5KVDH 3HC0B 4ZD3L 3MV7E 4XPBH 2W0PA 3CDYA 2NY1B 3SE4A 4TUKH 3IJHB 2IPTL 2XZAH 1AGBA 3BP4A 3IAGC 1AE6L 4S0TD 1AJ7H 2JF1A 2CGRL 4UAOC 5I75B 1VPOH 1F13A 2BFVH 2D31A 1EHXA 1CFTA 5IT2H 1NBZB 1RVFH 4HUVA 4G8GA 5CZXD 1XH3B 4C58B 2Y25A 1FYHB 4P5TA 5HVFB 4QO1A 4FQQA 3TO2A 1BBJB 5C0GA 2R1WB 3KR3L 1SY6H 4YH6A 4XH2A 4NQCE 1A7NL 3T1FA 1SVZA 1NDGB 3E2HC 1F2QA 5D1QC 5F7FA 3A6BH 1EAPA 1MQKH 1OP3H 2JIXD 3W81A 4G6AC 1CLCA 3HZMB 1T21B 3DWTA 3ARFD 3BKYH 3BPNC 1MCSA 1F2XK 2OTWA 3NACL 4R3SB 3LN5B 5I66A 2X1XR 5F21B 2AKRB 3O3BA 1IC1A 3QUXA 1SBSL 3EJZD 3QEHB 3VWJA 4EDWL 1Y0LA 3VCLB 2DQGL 2P5EE 4MXQC 2YD4A 3O3EB 5EDXA 4QRRB 3S37H 1XT5A 2R1XB 4GBXA 4RWYL 1N6QL 1P4LB 3E8UL 4Q0XH 1HH9B 1OAYH 4TVSa 4JY4B 1P1ZA 4FQ2L 4TN9A 4F7PB 2OM5A 4UT7H 5DR5H 2ATKB 2R2HB 1FZKB 1CFSB 1T22A 5E4EB 2HT4C 4JM2B 3UBXI 2J1KA 4CMMB 2CDEB 4F58L 4WHTB 3OGCB 1F6LL 5DI8A 3NCMA 4E41D 2MPAH 5FGBC 5GPRA 2IPKB 4CVZB 4HPOL 1MFAH 3GSWB 4K8RC 1L4IA 2VISA 4I48B 4XCEA 3I75B 4LHQB 4LGSB 3O2DL 2DD8L 4LRIC 4KRPC 3CPLB 2R1YA 4NUJA 3X12B 2DICA 2BC4A 3WN5B 1KPRA 1YMME 2AEPH 5ID0B 2P1YA 5GJSH 5KSBE 1L0YA 4YDIH 3BDYL 1WVZA 1AIFA 1MCHA 4KDWA 5CJBA 5DUPH 4O51B 3NZHH 4Z95H 5DRNB 5B3JF 5GHWH 1H3WM 1KG0B 4OCXL 1AD0B 4I18C 4WY7H 1KLGA 2R2BA 2A0LC 3QPXH 5JHDE 1BX2B 3VXTB 2D2OA 3QNYA 5E1AA 5D70L 5C09B 5E7BA 5F3HB 3K2UL 3MV01 5E70A 4R4FH 5E6YA 1UJ3A 3C5JA 4Y16C 1ERNA 1RMFH 3SO3C 4G42A 4M03A 1A6ZA 2QHLA 4LDOB 4HFUH 3HTLX 3Q3GB 3B5HA 3BN3B 4JN2B 4K94H 1B4RA 3WDIA 2FDBP 3O6MH 5J3HD 5EZIL 4JGUA 1TCRA 3S36L 4JFDD 5BS0D 1F3JA 3HA0A 3NCCB 4KHXH 8FABA 4NQDD 1FN4B 5IQ9B 4P2QB 1WWWX 1UZ8B 3OAZK 5I8OH 4KTYA 4GRWB 4JRYE 3EFDH 4S10A 3GSNB 4TUJA 1KJ2L 3NCYS 3SBWC 2A6IB 3ZYZA 3FQNA 4IIQB 3OF6D 3IU3B 4LLVA 5EOCH 5HSFA 3TCLA 1T1ZA 4FNLL 5FYLE 4QT5A 3UTSD 3K3QA 1GL4B 3MGTA 4PJGE 3LAFA 4Y1AE 4ELMA 4KFZC 2VABB 1IKFH 1N8ZA 1F11B 3QUYC 1P69B 1UZ6E 4N0FA 3OKEA 3Q6FB 2VLRB 3QDGB 3RBGA 4U1KA 3MUGA 3D18B 3NCJH 4PJAB 1NLBL 2X89A 3BO8A 3VFRA 4CDHA 2VLJE 3FFCA 3QUZC 4ZQKB 2OS7A 3UZQA 1LE9B 2X4QB 5BMFL 3U0WL 3QB7C 1XGTA 1VDGA 4OBRA 5A2KH 1X6NA 4MZ3A 3IETA 1RZJH 3KDMB 2VZ1A 3T08A 3ZSTA 5D1ZC 5EC1B 2FECL 4WTZA 3QQ9D 2Y7QB 2OR8A 1S7SB 3E3QE 3VG9B 4TNVK 4KH2A 2IAND 2ESVE 3SGJA 4WV1C 2NTFA 1DDHA 1KJMB 4PJ9D 1ZLUH 4LEXL 4PREA 3WKML 3FOMB 4XCFH 3VXMA 4Z5RB 2ZP0T 4QHNA 3D9AL 5J1TC 1N64H 2OTUA 4HIJB 2IAMC 5FYLH 2F54B 2EDRA 2K9UA 3RIFK 3MV7D 4YWGH 3T0EB 4XRCA 5A2JH 1JPFB 1OL0A 3EYUL 5D7LA 1ZKAA 35C8L 1I9IH 43C9B 1GCFA 4Y4KC 5KZCB 2VDNL 1F4WL 1BIIB 3IFNL 1RZ8B 2QQKL 4KI5C 3QEQE 5F7NC 1BZ9A 2X4OA 1QSFE 5IQ7H 3U9UA 3BYTA 2NX5A 5C2UB 5J6GA 5TE7H 4GRLC 4W4NA 4V2CB 3HUJE 3V6OA 2V2XA 3U1SL 1YECL 5D2LE 4YLQT 2E7MA 4UOW0 1DUZA 3LQZA 1AXTL 4F57L 5E95B 5HTSA 4DOHB 4S2SB 3LKNB 3RL1B 1RJLA 1T1YB 4JR9L 3RWFA 3EOYG 4QCIB 1F58L 2WLZA 1A4JB 4PJEF 1QYGL 5DYOB 1I85A 4TQEL 5KVFH 2ITCA 2RFXB 4PYGA 4QRTA 5ANMB 1G7MB 3FQUA 4GW1B 4HUKB 3TZVB 5IWLA 4X99B 1NANI 3QO1B 4JHWL 4UILH 1ZV5A 5FGRA 1WCBB 3UJTL 2RCSH 4YC2B 4XXCA 4G3YL 1YEIL 3NIGE 4P57B 2P5ED 4RFNB 5AG8A 1VFMA 4NO5B 4OGYH 4E42B 3O9WC 1RUAL 2G9HA 3KPRB 1NGYB 4JG1H 2FX9H 5TGBA 1YPZE 1OGAB 4G9FA 1HEZB 4O5LL 3VH8G 4LARL 2WMPA 1OAXH 3D3VD 5HGAA 4Y2DC 4M02A 2P5WE 4L8DB 4DGVL 4WI9A 3HRZB 4Y8DC 1CXLA 3DI2B 1OTSC 2YPKB 2FJHB 3GSOB 1MPAL 1KTDA 4CBPA 3IXTA 5FECA 1NGZA 3FB6A 5K9JL 4U1MA 1FH5H 3DI3B 4X4YA 3OAUH 4EIZC 3C08L 5ERWB 4K07A 1QFUL 3EO1A 4X6BA 4ZAKB 5I74C 5I8CA 5DQ9A 3PP4L 4Q9RL 4M9OA 4KROC 4YBLC 1B2WL 3FB7A 3CSGA 1RUMH 3DJ9A 2Y07H 3SGEH 2B1HH 4K3DL 3VFPA 4LPVA 2NY1D 3BHBA 3I2CL 5CMAA 1T03L 1FVEB 1C7TA 1N4XL 4PJ5A 2GKIA 3T2NH 3J8F7 4N0UA 4OKVB 5SWQA 2VLKE 2B1AH 3EYSL 5I8EB 1DTUA 2ADGB 5FO7B 3EYFB 4UQ2A 1LWRA 4H20H 1OAZH 4ZNCD 1RUKH 4FFWC 3ARGB 3OXRA 3FB8B 1MJ7H 1WAAF 3HZYA 2NW3A 2E8YA 2H32B 4FG6D 1NFDE 4D9LH 4Z77A 5B22A 4KGLA 1RUPL 5EU5A 2AXGA 2VH5L 3KNBA 3S9DB 2APVA 5DURB 4DCQB 1BREA 1C1EH 4JJHA 3IVKB 1BQHB 1EH9A 3WS3B 1CLZH 3K7UA 5FIEA 4ZUSA 3THMH 1HHJB 4NQEA 1W72A 1A21A 4U3XA 2XZCH 2YN3A 5BJTA 1S9XB 3REVA 4ONFH 1QLFB 3VXQB 3EO9L 1Q9OA 1UCBL 1U58B 4HBCH 3K81A 5DFVD 2Z31D 4X98B 1CQKA 4AMKL 1CBVH 4QF1B 3HFMH 4NN5C 4JRYD 1RURH 4R8WH 5TF1L 1PW3A 4XPFL 4PP2B 3C5ZA 5DSCB 3H7BB 2D03L 1KUMA 3QIBD 1JIBA 4WW1A 5FYLD 4IDJL 3D39B 1ZTXL 1H5BC 2ZUWA 1R24A 3LMJH 3MBEB 5F72S 4HWEL 3TBVB 4HH9B 1JHTA 2AI0L 4OQTA 1QKZL 3BFOA 1G1CA 3I9GH 4HT1H 5CWSA 3AREC 4NP4H 1H3XA 4IRZH 1NC2A 4FZ8L 5DVKA 5CEZH 2FH8A 3JXAA 3RBSA 5FKAB 4YHKL 4PJHA 1OCWH 2Y23A 1GGBH 4JKWA 2AV7B 4JFQB 4LRNH 2MQ3A 1V5JA 1VFUA 2NY3D 1ORQB 3NZ8A 1A1NA 4KKAC 2BX5A 2ZG2A 4NWTL 4XVTL 3FT2A 4JHAL 4PRPB 2GK0B 1VHPA 1YA5A 3B9KD 4XNUL 4A6YB 2R29H 3BSZH 1DLHA 3EHBD 3AY4C 4K3JL 3NFNA 1ZWIA 3F58H 4J6RL 1WIUA 3I50H 4XPTH 3MJ9A 3HS0A 3KPLA 1A6PA 4LCUA 5DLMH 1NEZG 5HXMA 1A3LH 4KPHH 2PW1A 3PWNB 4M4PA 5D71H 4ENEC 4HKXA 2Z8RA 25C8L 1JWSB 1M6OA 4ONGH 3SKJL 4S1QH 3L7FB 1U2HA 1O7SA 3BPLC 1DQLH 4GH7B 5I19H 5SV4A 5TQ0H 5JUEH 1HQ4B 3PP3H 2BNQA 3PGDA 3NFSL 4LP5A 3S8WA 2ZKHL 2JB6A 5TJWK 4J4PD 3G04B 2PYEB 2B2XL 1ZEAH 1HOCA 3MV8E 4PJBF 5T33L 4LDEB 3UYPA 1A6VL 3QHFL 4M7JL 1JTPA 3QCTH 3OZ9H 2Q3AA 5E6ZA 4L8SA 1CE1L 3GSNL 4PRBB 1RIVH 4G80B 5ABDE 3O81A 4TSAL 4NWUL 4PUBL 3IDYB 4JFOA 1Q0YL 3CFEA 4LAJH 2OJZL 3QEQD 4NN7B 1T7XA 2IBZX 1IEAA 1AGBB 5DVMA 3U7WL 3BP4B 3IDNA 1ODAA 4PJXF 4LCCB 4AM0A 5HDQH 3ZKMD 3G5XA 4WVRA 5DVOA 3GMRB 1K4CA 1F4AA 4PRAA 1G7HB 2DQTL 1CFTB 4OZHB 3T3MF 4HUVB 4G8GB 4X5XA 3VXRA 3DO3A 2P44B 4X5LA 2ILLA 4P5TB 4FQQB 4M3JA 2F58H 1SM3H 4B7LA 5C0GB 2WP3T 3KJ6L 2HWZL 3AS0A 2GT9B 3T1FB 4OIBA 4KK6C 2VLRD 1IM9A 3MRRB 4JHBA 4YEFA 2EDNA 5HYJE 2VR4A 3ABZA 1EV2E 5J0BA 1WWAX 3V0AC 2ENYA 3V4PH 1EAPB 1ZS8A 2FB4H 5JQ6H 4HXAH 1ADQH 3MCLL 5F44A 3A0OA 3CUPA 3OQ3B 4DN4L 4KZEH 1MAML 4JFHE 2OTWB 5I66B 1DBKL 1J0IA 2CQVA 5D96B 3RWDA 5JIKA 3O3BB 4NM8H 3STLA 2OL3A 3VXUD 2VN4A 2EZ0D 4MD0A 3RWEA 4MJ6A 1Y0LB 4PJCA 1BJ1J 4JZJA 4QRPE 1JE6A 4ZXBD 5J4MA 4LKXA 2AABL 1BECA 4GBXB 4LOUC 4OGAD 1BLNB 4WWKC 4ZS7L 4M1GL 1LK3H 1P1ZB 3CLFH 3I6KB 4L9LA 3CSBA 3DV4A 5I1CH 2DLFH 2B0SH 3EFFA 4ZFOL 5I15H 2XQYG 1QHPA 4JY5L 1LO4L 5CZVL 1K4DA 2DQUL 4I4WA 3R06A 1MEXL 5DHXB 4N8VA 3G6JA 3T0ED 4Q6YA 4YO0B 3CAFA 1F4XL 4N5UA 5HYQB 1S7WA 2WM0A 4JM2C 1Q9KA 3FQXA 2X05A 5KZCD 1MCBA 1J8HB 2VISB 3FKUS 4XCEB 3MXWH 3QO0A 4XP4L 4YHLH 3ILPB 1DN2A 5HY9A 4LCWE 1RZFL 5I1GH 2R1YB 2YUVA 2BC4B 1CICA 1KPRB 4EI6A 3L9RA 1C5DA 1SYSB 2O61A 1V7NH 3WUWG 3SE3C 1INDL 3HB3C 1JBJA 2V7NA 1R5VA 4PLJC 3BIAX 3MLZH 1AHWC 2FGWL 1U93B 4XCYA 3BZ4A 5TF0A 5F7WC 3WN5C 1KLGB 2BHYA 3OKOA 2R2BB 1O5DT 5L2JB 3IS0X 4P2YA 1AI1H 3N9GL 2Y72A 5D93C 5F97E 3GMPA 4GKZA 1BM3H 3C5JB 2R4RL 3TJEL 4G42B 1IC5H 1DEEB 1A6ZB 4QXGH 3H9HA 5MHSE 3BKJH 2BVTA 3TZVD 2XA8L 5I71B 3SDAA 5D8JL 3N50A 1CFVL 4H88L 4POZC 4F9PA 3TWCH 2RBLA 2VE6A 1YMHA 1TCRB 1F3JB 2EDQA 2YN5A 4OQ1A 3KPRD 1S3KL 3C6SB 4ZFGL 1SYVA 4S0SD 3Q5YA 5KSBF 4V1DE 1U8HA 4DVRL 1MH5A 4X9HA 1XGYL 5F88A 4TUJB 3H9YA 3RVVD 4U6HA 2E8ZA 5DDHB 1WT5A 1S9VA 2AGJL 3FQNB 5J8OA 1FL5A 3U7YL 2C3VA 4LLVB 3TCLB 1T1ZB 4K3EL 3BPCB 4CJ0A 1L7IH 4QT5B 5F1NA 1RU9L 3MGTB 4XGZB 1RZIA 2FLBT 2VRAA 5DJYA 1BFVH 1FNHA 2DMCA 4ELMB 3VW3H 1MCWW 1N8ZB 2FIRT 1A5FH 1BQLL 4XBEH 3QXWA 4LNRB 1NMBH 2VXTL 3GKWH 2CK0H 1TVBA 5ACMA 1MAJA 4NQSA 4YDVB 3QDJD 4U1KB 3U0TA 1EMTH 3Q6GH 2IJ0C 1ZXQA 2NZ9D 3VFRB 3FFCB 2YA1A 3H9SE 3HNVL 3S37X 5JW3H 2PTTA 1NANH 1ITBB 5K33A 1QNZH 5A3IC 5GRUH 3IDJB 1EO7A 4B50A 3IETB 1QBLH 1BVLA 4LVHB 2A2QT 4GQ9H 1B9ZA 4M48L 1X5JA 2QLVB 5CJQH 4HLJA 4RX4D 4KUCD 1IGML 3VXNA 1YZZA 4K2UL 5HHXL 2NTFB 3LEVL 1CLOL 1DDHB 2R9HD 2EC9T 3CC5A 2HKHL 4Q97A 1LO2H 1UZ6F 1YY8B 4AEHH 4QHNB 1FPTL 4YHZL 1ZHKA 2FBOJ 2OTUB 4ODVH 1EXUA 3EDEA 4XVJH 5D7LB 3PL6A 1HDMA 1IQWL 1R5WB 1IBGH 3DXAB 5GRVL 3GB7A 1IGCL 1JF1A 4XWGH 1YQVL 3ROOA 3WFCH 1MRDH 4UV7H 1QSZA 5GJTH 5F7EL 2HT2D 2V7HA 5TE4H 2X4OB 3DOSA 4DEPB 3U9UB 3MBED 4NKIL 5CAYB 5J6GB 4U1IB 1EVTC 2KUTA 2V2XB 3NIDE 2ZNXA 4MMXC 3QUMB 3FT4B 2IG2H 3LQZB 3DROB 3T0BA 2VZTA 4M1DH 4Z7WB 5IK3A 1DL7H 1UB5A 2E27H 3K1KC 5D7SL 4A6YL 3IDMA 2X1QA 5HDOA 5L0QC 1VGKA 1Q94B 1XGPA 1N0XH 2ITCB 4JFHD 2XWBB 1OM3H 4QRTB 2DJ4A 3FQUB 4YDKL 3QDMA 5BO1L 5C7XL 5EA0H 5DD6A 3WLWC 4AQOA 3O4LE 4NKDA 2I60L 1VA9A 1I8IB 3CXHJ 5HVWA 5I1AA 2G9HB 4H0IA 5T1LB 1CVRA 3QWOA 4G9FB 4YC2C 2ZCHL 3HUJF 4OIIH 4R26L 4OD1H 1Z0NA 3F62A 4WENB 5D2LF 4ZD3H 4KWUA 4IS6A 1LEKA 4X9BA 4O02H 1HNGA 5TE6L 2BNRA 3RPIA 3SDXA 4KI5E 4CW1A 1AE6H 1GZQA 2G75B 2O5XL 4KJQC 5FECB 2PYED 1DVFC 1NGZB 2IH1B 1RK0A 3FB6B 1M7DA 2CGRH 3RKPA 2YHGA 4X4YB 5GGRB 2H6PA 2A83A 2NY5L 3EO1B 4MXWL 3RNQA 3DARA 5CZKA 1HSAA 1YNLL 1X4XA 1A7RH 5FO9B 5D1QD 4UIKL 5DD5H 3UTPE 4Z7UA 3BHBB 5CMAB 4BUHA 2A6KA 3EJJX 1FNGB 3NIGF 4PS4H 5KW9L 3HCVA 4W4OC 3ULUL 4G6AD 3JTTA 4GKNB 5BVJA 4NZUH 1KPUA 3VDBA 5EOTA 3D85A 1JGDA 5HVHB 1FSKC 3QRGL 3BVNA 4M1CC 4UQ2B 4PBVC 5D7JC 1U92A 1L6XA 3L7EA 3SJVB 2OR9H 1FYTA 1FHGA 4LVNB 4YUEL 1H15A 3HZYB 3ALXA 3I85A 1QZ1A 5BRZD 5EWIL 3WD5H 1A3RL 3QAZB 5DJCA 2AEQL 3S88L 3VRJA 1MY5A 3KNBB 2HA1A 3BEWA 5EU5B 2EE2A 5SX4I 5M94B 1CN4A 3HLAB 3TP4A 1RZGB 1SBSH 2X6MA 1NAKL 4JKLA 5MHSD 1CR9L 3BYYA 4EDWH 2A73B 2FHCA 3ARGC 5C6TL 4ZUSB 4ELKA 4BH8A 2EYSB 5CIPB 1DBAL 4M6AA 4NQEB 3JWOC 4MJ5A 5BJTB 3E8UH 2HT4D 4KJPC 4HS6B 4FQ2H 3GI9H 4U7MA 4N90E 3SDDC 4FABL 3DMMA 3OR6A 4JVUA 1BHGA 4K23L 4MA1C 2XNAA 5ISZE 4FOMA 2W59A 3TYGH 3CFBA 3RZCA 3AXLA 3MRJB 4NRYA 1JPTL 4P2RE 1JV5B 3C5ZB 3GM0A 4YR6B 4K8RD 2DBLH 4WW1B 1JZ6A 5C0RL 4KRPD 4ODXA 3FONB 4HPOH 1R24B 1NFDF 1JPGA 4LIQL 5D1XB 1JHTB 2DD8H 3GSRA 3QIUB 1EZVY 4PJ8A 1IGTA 1ZSDA 4R2GB 1GXEA 3OKNA 3TN0A 1NC2B 4L3EA 1KLUA 1NCWL 1MI5E 3MACL 4YNYA 3ULSA 4PJHB 3WFEH 1S5HB 2A0LD 5KANG 3H9SD 3KS0J 5I2IA 3V7MA 5D6DA 4Q9QL 2QHRL 1A1NB 2O93L 3PUCA 4Y16D 4OCXH 3FT2B 2J2ZA 1PKQA 1U3HC 2XOTA 2EDFA 5IB2A 4NOFA 4OLXL 4PG2A 1RZKL 3T4AA 3MR9B 2IBBA 1DLHB 5IB5A 1HHHB 4JDVA 4R97C 1UWEH 3NFNB 1ZWIB 1EO5A 1CTNA 3ULVC 5KOMC 3QG7L 4KU1A 3GJEA 3KPLB 1QO3B 4LCUB 2CIIA 4LF3A 4MAYC 3N1GC 2ZOLB 5F9JB 3VGFA 2HTLD 5ICYA 1UADC 5KSAA 1JPSH 5EZIH 4HKXB 2O5ZL 3LRGA 5IROC 3DYOA 1YEEH 4LSSH 1E4WH 4JO2L 2OI9C 1ZHLB 5FA3A 5L6YL 1U0QA 4RQQB 5A2IH 2BNQB 4QYOA 3I84A 3PGDB 2I9LA 1C5CL 5FO8A 2JB6B 5E2JA 4XNXH 2YBRA 3AS3A 4P46D 4ZSOE 2J8UE 2EKSA 5E6IA 4FQXC 3P0YL 1WBZA 7FABL 1AD9A 1RZ7L 3QUYD 3KPOB 4L8SB 4Z0XB 4L9DA 3T77A 3DBXB 1TITA 3MV9E 1ZLVH 1HWGB 2E6QA 4Y19B 4RBPK 4Y4FA 1N2RA 1AKJD 1E28B 5I1JL 3VFSB 2D7PA 1GZPA 3SGDI 3QULA 4NNYA 3IDNB 4DKAA 2E5EA 3BKCL 3QUZD 4AM0B 15C8L 1SEQL 5HDBE 5KS9A 5JOFA 4F7TA 2H3NA 1HK6A 4PRAB 4ODSL 2N4IA 5FV1L 1NLBH 1OARH 3SE4C 1QPPA 4R6UA 4FFYH 4X5XB 3VXRB 4EUPG 5D1ZD 2XZQL 2NY5C 2AEIT 3MC0A 4R90L 1Z3GL 5BMFH 3U0WH 4KUCF 4HFWA 4OZGA 4XNZC 1NDMA 2X4SA 5C3TA 5HYSB 1FC1A 1IM9B 5DHVH 3U30B 2FEDC 1CQYA 4TUOB 5DJ0A 3RJQB 2O26U 3FO2A 4B7IA 4I3SH 4YHIA 3NVQA 3L3GA 2HT3C 1TZIA 3TVMB 3FRPA 1I7UA 1P7KA 2W65A 4P3WA 4LEXH 3WKMH 4XXDA 3MRLB 5FHBL 3HNTL 5EUOA 4YDLB 1BBDH 3KLAA 3RWDB 3STLB 1NC4A 3D9AH 2OL3B 2Q8AL 1L9NA 4L5FL 4OLEA 3RWEB 3NH7H 3QZWG 4MHHG 1PG7L 4JZJB 4UUJA 4LKXB 1ZGLP 1HI6A 4KI5D 4BFEA 4UU9A 4ZNEE 35C8H 3KXFE 1UC6A 3HN3A 1SQ2N 3QUXC 3QEGL 2FNBA 1F4WH 3VWJC 2APBA 3EFFB 3VWKA 4HWBA 2QQKH 3ARPA 1K4DB 3BQUA 4RMSA 4PGCA 4I0PD 4GBXC 2W0FA 4M4RA 3KVQA 1V3JA 2WBJB 4I4WB 1ZE3C 5C0CE 5HGGS 3G6JB 1UM5L 1QRNB 3P9MA 4M93C 3RWJB 1T89A 5FUZH 5DQDL 1AXTH 1Q9KB 3DXAD 4KMQA 4WFFE 3FQXB 1I1CA 1II4E 4OLUH 4JR9H 3PWPB 4APQD 3QUML 3QO0B 3S34L 5HY9B 4MQXD 1G6VK 1QYGH 2PCPB 4XCCL 5D7KD 1CICB 4EI6B 3VGGA 3L9RB 1C5DB 2O61B 1CXEA 3ME0A 4XAKD 3CMGA 2A1WH 1B0RA 1ZOXA 3U7AA 3O9WD 4FXKA 1M7IA 4XCYB 3BZ4B 4BK5A 4PLKC 2EDHA 4G3YH 5DZLA 3GHBL 3OR7A 3OKOB 5JQHC 5JXEC 1NCDL 2I24N 1RUAH 4Y2DD 2JCCA 3GMPB 1JYNA 4GKZB 2WSKA 4XNMA 3RU8L 1X9QA 4N90D 4OD2B 2N7AA 4O5LH 1RZKC 5E8PB 2DQFA 3CIQA 3H9HB 1KCUL 3QI9A 4LARH 4HG4K 3SDAB 2YS4A 2R15A 4PFEA 1UJ3C 1CXFA 1MPAH 4J1UA 3W2DL 4QRRE 2LAAA 4RRPG 1H3UA 4KQ4L 5K9JH 3VD9A 4CAGA 2M2DA 5BZDA 1UYWL 3UBXG 3C08H 1L9MA 1P7QB 1SYVB 5T1LD 1QFUH 2A9NL 4OUOA 3UPCA 1U8HB 1MH5B 5F88B 3NCYP 4GOSA 1Y18A 4NHCL 1MUJA 1S9VB 1I3UA 1UB6A 1CE6A 2LVEA 2C3VB 3NBNA 5F7KC 2DIBA 4HJJL 1T03H 3I2CH 3ARQA 4GXUN 4N1CA 3JWDC 1RZIB 3GEWB 4FFWD 1CK0L 1MI5D 1XF4B 2PKDA 3KPSA 1R6VA 1WZKA 2EDDA 4OF6A 5DJYB 5A2LH 1QFWI 2AK4A 4RGNB 3H42L 3C60C 2Z93A 5L2KB 3VXSE 4YHOL 4HW6A 3ARDC 1LD9A 2DLIA 4NQSB 3U0TB 3PDGA 5SX5K 1PAMA 3LKSA 1RUPH 4LQ1A 3D48R 4QXTA 3PHSA 1X5IA 3BJ91 1XF5A 4JO4L 2BSTB 5F9WB 4C83A 3RI5K 1T7YA 4KK9D 3TT3H 5T3ZL 4OF0A 3KJ4B 4MLIA 4DN3L 3OKKA 1LMKA 3OKDA 5MI0C 3VD4A 2IC2A 4JREC 5BQ7A 4YHYB 3O3UN 4AIZB 5AAWA 2BMKA 1UCBH 4NO3A 3QQ3A 5F7UA 1IAOA 2B4CL 1ND0A 3NCEB 3CU7A 4M8QA 4MCZA 4H25B 5EU6B 4XPFH 3S4SA 4PJFA 3CC5B 2DS4A 3BUTA 3MLVH 2EDLA 1R0AL 1WFUA 1TQCB 2RAMA 1DZBA 4TRPL 2QJDA 1ZHKB 2JLLA 3QJFA 1EUUA 4HSQA 4HWEH 1IEBA 3L1OL 1EXUB 4P2QE 2AI0H 3IF1A 4GRWE 3PL6B 1HDMB 1J1PL 2CJUL 3WHXB 1OOAA 2CLVA 2BNUA 3O2VL 4KKAD 4JKPL 1LHZA 3GB7B 4YHKH 1JF1B 2BJML 4PJDE 3ROOB 5DJ6A 3JV5A 4LLMA 5DD0L 2YPLE 4LHUA 2XICA 4BQ9A 1YNKL 1N59B 3FMGH 3E0GA 5DJ8A 4N9OB 2D3VA 4XVTH 1B88A 5D1XD 4L3CA 5JOPD 3RWIA 2XYCA 4H0HB 3QIUD 4TNWK 2DTML 2MNUA 4K3JH 1IZJA 5IK3B 3NA9L 4J6RH 1RJYA 4LGPB 3W0WA 3WIFA 1UB5B 5SX4H 5FEBA 4JO1H 4TULL 3KLDA 2I26N 5DJAB 4JZOA 3SOBL 1I8MB 1LO5A 1XGPB 3D6GA 4L4VB 3WCYA 3RGVB 25C8H 5B4MC 5T1KA 5D2NC 3MJ9L 4OLZH 4PJ7A 1NUDA 2QKIB 5KJRH 1RFDL 1RK1A 3NFSH 1I85C 2ZKHH 3BDBA 4NKDB 3LV3B 1A1MA 4GAFB 1RHFA 2B2XH 1W0VB 2P24B 5AZEH 1BZ7A 5DK0A 4NDMA 1A6VH 3DGGA 3KXFD 3QHFH 2Y9RT 3SDYL 4GRWH 3QWOB 3NIDF 4HMCA 4JY6A 4PUBH 1PX4A 1Q0YH 1EX0A 1LEKB 5D72L 3RPIB 3U7WH 3SDXB 4WW2B 5C0CD 4X6CB 4S1DC 4DTGH 2A6DA 1FRGL 1RK0B 2XIDA 1M7DB 3LEYL 5SWSA 2ERJB 2DQTH 5K9OB 2AJXH 2H6PB 2PW2A 5DRXB 1JRHI 2A83B 3BUYA 1T4KA 3RNQB 1HSAB 4D9RE 4IRSA 4KK6D 4OBSA 4Y19D 2DQEL 2Z8VC 1Q72H 5IMMB 4GAGL 5IMLA 4JANB 1DBBL 4Z7UB 3KJ6H 5TPWL 4BJLA 2A6KB 5DJ2A 3WFZA 1I7TA 2F8XC 3Q5OA 1E6OL 3HCVB 4F33A 1DN0A 1PG7W 3JTTB 4NOBA 1R3KA 3CJJA 1KPUB 3QYCA 3D85B 2PXYA 3BVNB 4DOHE 4JFEE 1U92B 3L7EB 3MCLH 1FYTB 1GIGH 2XWJB 5DMGC 4DN4H 5GIRA 4MNGA 1GGYA 1EEYA 4UT6L 4XVSH 5TH2A 3RUGE 1VKXA 4P2OA 1DR9A 3SY0B 4NC1C 3DPBA 4KI5F 5D9SB 3VRJB 2MKLC 3BEWB 3HR6A 5ANME 2YSSA 3VFVB 2EDKA 3WIHA 3QH3A 4EI5C 4P4KC 4LOUD 4WWKD 3LPFA 1YEDB 3OJMB 4HEPG 1ZLWK 2DKMA 4BH8B 1OPGL 1Q9LA 1RY7B 1A7PH 1C08A 3SE8H 3MLWH 2OL3L 3BGAA 4NRZA 2BVOB 5CD3A 4JFFA 4ZS7H 1NUFA 4M1GH 5TQ2H 4OAWA 3VFNB 3TVMD 5KOVC 3DMMB 4P23D 1TVHB 2YXFA 2XNAB 4CGTA 4JY5H 1LO4H 5CZVH 1A6TA 3CFBB 3RZCB 1OQXA 1Z6JT 3AXLB 4ORGA 4JG0L 1ZANL 3WDJA 3ZE0E 5A2FA 1C5BH 1CCZA 3HE7A 2EH7H 3SGDH 5JO5A 4G6ML 5K9QI 1F4XH 4C59B 3FO1B 5M7QA 3B6SB 3HMWH 4ODXB 3WL9A 1JPGB 1U91A 2LTQC 1JNNL 2AVGA 3C5ZC 4PY7B 4QOKE 5E00A 3HB3D 1EPFA 1OW0A 4KVNL 5F8QC 4PJ8B 3SDCA 2FGZA 2H1PH 1ZSDB 1ORSB 3LHPL 1RZFH 1HQRA 3OKNB 5CCKL 1JGVL 4L3EB 3GSVA 1KLUB 4YNYB 1I3RA 2QADC 4KI1A 1RSFA 3GDBA 1QRND 2J88H 2EIZB 3WFBL 2YC1B 1MCKA 3CGTA 3RY6C 1J9CT 1PKQB 3MLUL 3PWPD 2Y6SC 3N9GH 5IB2B 4KHTL 3R8BB 5GS1A 4IRJA 3T4AB 5C9JA 1P2CA 3TJEH 4JDVB 4POZD 3VH8A 2OXGA 3HI6L 4DAGH 4EJ1C 4P59H 3GMQB 3N1FC 2ATPA 2CIIB 4DUWA 4KVCL 4OCYH 1CFVH 5ICYB 4H88H 5KSAB 2N1KA 5GISH 5ALBH 2F53E 5SWZE 1CGXA 1I8LA 3PABA 4DUXA 5HYIA 3OXSA 5FA3B 1S3KH 4G7YH 4RGOL 2XN9A 3CFDB 4QYOB 2XA3A 4JFPA 2I9LB 1NQBA 4MDIB 3UTTE 1XGYH 2YBRB 3RVTD 3AMLA 3BKML 3ZL4L 4ETQA 4AEFA 2AGJH 1WBYA 2EKSB 1N26A 5E6IB 1WBZB 3U7YH 3TBYB 1AD9B 4PRDB 2GCYA 3T77B 5HHPB 4XB8A 1MAKA 4BELD 2Q3ZA 1CU4L 3KG5A 5B39G 1E6JL 4Y4FB 1N2RB 5DTFB 4LKCA 2YPLD 1IC7L 3MOQA 1BQLH 4X6DE 2LE9A 3PF2A 4NNYB 5EN2A 2VXTH 4PPTA 1U8LA 4K7FA 2D0GA 3WEXA 1GC1C 5KS9B 5JOFB 5DUML 2GY7B 3S98A 2BVUA 2I5YL 3V4UL 1Q1JL 3S35L 5CJ5A 1PGRB 4X9GA 1CDGA 3UJJH 1B90A 3GSUA 2X41A 1EVUA 4OZGB 5B8CC 2PR4L 3ULVE 2QSCH 1NDMB 2X4SB 2VXVH 3NFPA 2J8UF 3ZKSD 4M48H 4XBGA 4X0KA 2NW2A 3BT2L 4LSTL 1MHCA 4R0LA 5GGVY 4LK4A 1IGMH 5DJ0B 1EHLL 2PYFA 3FO2B 4DW2L 4YHIB 5HHXH 2XTJB 3L3GB 3OAYH 5H37H 4RMTA 4IBLT 1I7UB 1P7KB 2W65B 2HKHH 2ZNWA 5D6CA 2WQ8A 4XXDB 5CLTA 4HG4J 6FABL 5EUOB 2AP2A 4IMKA 3KLAB 1NC4B 4YHZH 3WFDL 4MS8C 5HDBF 1AC6A 2PO6A 1FFRA 5E5UB 1EHAA 4IJ3B 5FYKL 3LDBB 3T2QA 4R7DA 1F3RB 1MHHA 4FTVA 1TJIL 5E9DA 4WO4B 1HI6B 5FF6A 1IQWH 4UU9B 4G6JL 4NJ9L 1U2CA 5IBUG 3A67L 2EIDA 5C0EA 1IGCH 2C3HA 5GGUB 1KIQA 3VWKB 4PRHA 5E2TL 5IV2B 5DMIL 5JDJA 3BQUB 5EPMA 2Y5TA 4PGCB 3BE1L 4ODHL 4D9QE 5F7EH 5IESH 5DZNA 4OZFH 1UCTA 3OMZA 2E7BA 4NKIH 3FN0H 1KXVC 4EDXB 4L9LC 4UTAH 2FO1A 1MFBH 1X5ZA 3ULVH 4G6KL 1P84K 4QHKJ 4RMQA 1FAIL 4A2MA 1Q9WB 3QNXA 3S36X 4ODTL 3V6ZA 5D7SH 4JFED 5EUKA 5E1HB 1NEZA 3RWGA 1J8KA 4PRIA 3HR5B 3PXHA 4PJEA 4ODBD 4YDKH 2J6EA 5BO1H 2AJYL 1LE5B 4FXKB 1M7IB 5HI3C 3LB6C 4F37K 4ZYKA 1ULVA 3QXVA 1S7VA 1LDPL 2I60H 2WIIB 3L3OA 4WGWB 1CXIA 3WJJA 2DM4A 1X5KA 2JCCB 1K8IA 1URLA 1MVUB 1T04A 4L4VD 4XPGL 4R26H 4Y5VB 5T3XD 2DQFB 3W9EB 4KTDL 1S78C 4JPWL 4ZPVA 3BMVA 3I6GA 5ELIA 1WWCA 4EKXA 3MLTA 1QSVA 1N5YL 5ADOL 3V95A 4H0GA 4YX2H 1A2YA 1IAMA 2DQJH 2FCBA 1T80A 4C56D 1QVOB 1T2QL 1IILE 2W1NA 5EZLA 3ZDZE 1HKFA 5JDSB 3C5SA 1W0WA 4E5XA 2NY5H 4AYFA 4MXWH 1MHEB 3TA3C 4F9PC 5CLWA 3D1MC 5HHOD 1PVHA 4UIKH 1UB6B 1CE6B 3DX9A 1FG2A 3K0WA 5D7JD 1TCMA 3ULUH 1UA6H 3X3GL 5H2BA 2JIXA 2IQ9L 3MREA 4PLNC 2HJLB 1VENA 3ES6A 4L4TE 3ARFA 4GQPH 3I6LE 1J05B 3TF7C 4KKBC 4UDUB 4AENA 2Z93B 4YUEH 4Q6IB 3ZE2E 5I1IH 1OP9A 3ESVF 1JFQH 4LQFH 4PV8A 4U49A 1YYLH 1LD9B 4WEBL 5EWIH 1A3RH 3IKKA 3BISA 4RGNC 2XY2A 3LKSB 2AEQH 3S88H 3FQTA 2BOBA 1WAAA 4BFBD 1FG9C 1NFIA 4UQ3A 3VE0A 4TOYL 1HXMA 2Q7YA 2E7CA 1BQSA 4C83B 4FA8A 5C0AE 3QJHB 3B3IB 3PQYE 1DBAH 1XGRA 5MP6H 4OCMC 1EA9C 1PQZA 4NBXB 3OKDB 3F7YA 5C8JB 1QA9A 5BQ7B 5LGKA 5CUSL 2F53D 3TJHC 5SWZD 1NGWA 1YY9D 4QRUB 5IEKA 2BMKB 5JW4Q 5CSZA 4FABH 1ETZA 4NO3B 3VD3A 2YD8A 1B0GA 1TZGL 3RZWA 3QHZH 3QWQB 3GMOA 3KJ4C 3UTTD 3IS1X 4E41A 4U4BA 3EYQC 2Q1EA 4PYHA 4YHYC 5IVXF 4PJFB 3LZFL 3H9ZA 4RMVA 1QLEH 2B5IC 1Q0XL 1P6FA 1FJ1B 1YUHA 3REWB 3QJFB 1NGPH 4RFEA 1RUQL 3HAEG 5GGVH 1KCVL 4LIQH 4NHUB 3TIEA 4Z7VA 2UWEB 2YXMA 5FK9A 5C08E 3OB0H 3IF1B 1WLHA 5HHME 3U2SA 4JPKL 3WXVH 3GMNB 4XHQA 2CLVB 3AU1B 4U1HA 1ZVSB 3GHEL 3MUY1 1NCNA 2JJSC 4FQCL 1JZ2A 2Y36L 3MRNA 1BVZA 5FAAA 5DJ6B 4Q9QH 2QHRH 3PL6C 1ZMYA 2BOCA 5HPOA 2FLRT 4MNQB 5DJ8B 2W9EL 2IF7A 1HZHH 5J12C 1LO0L 2R2CA 4L3CB 4BQCA 5DK2B 4U2YA 4JCLA 3ULVD 3V6FA 3RTQC 2P46B 1EK3A 2JB5L 5JORA 2AQ3A 4MAYD 1BAFL 1RZKH 4X4MA 12E8H 5AD0B 2L0DA 2HKFH 2DLHA 4IMLA 3WIFB 1S8DA 4JFDA 5BS0A 4EXKA 2XRAL 1KFAL 2D9QB 1YC7A 5DWUL 1FVCA 2P43B 2O5ZH 1MCOH 2QR0B 5CKGA 4NQDA 4JZNA 4QRSB 5T1KB 2ICEA 4PJ7B 4MJ4A 3QT2A 4JO2H 3LKQA 5JPNA 1JNLL 5L6YH 4FQXD 1G0DA 5E2UH 1KEGL 1RK1B 1VFOA 2ARJA 3OF6A 1C5CH 5MERA 1JHKH 1A1MB 3KS0H 4PJDF 5I6XB 1KLFA 3MFFA 4YE4L 1EGJA 5GSRA 3KWWA 1BZ7B 3UTSA 5TDNA 1R3IH 4NDMB 4PJIB 4F7CA 3DGGB 3JWDH 1RZ7H 4WTWA 1Z5LA 4MD4B 5ACZA 1KJ2A 4PJBA 4AEIL 3VXME 1FGNH 2CMRL 4JY6B 3MCKB 3VGDA 3JTSA 3MRQA 4HKJB 5I1JH 1ONQA 1NBYA 3MRGA 4J8RA 2OQJB 4XP6H 3NOIA 2G5RA 2X9XA 3MLSL 3BRDA 2HVJA 2A6DB 3VJ6A 1SEQH 4OLYL 2R0ZL 2KZWA 3OJDB 3X3FH 4PJXA 1SY6A 3SGKA 3T09A 2PW2B 1OF2A 3TO4B 2E3VA 4OCSL 1YEKL 4OTXL 1T4KB 1WQVT 4LLDA 3ALPA 2XZQH 5F3BA 3PV6B 3V7AE 1G7PA 4UV4L 1PEWA 5FM5O 3O3DA 4LSVL 5DRZA 4R90H 1Z3GH 2NX5E 3BJLA 2FRGP 1SJHA 3LKOA 1I7TB 3MA7A 4K9EC 1ZLSH 3IDIA 3V0WH 4RGMC 1K2DA 5HHNA 2BCKA 2HT3D 2IANA 3AB0C 1K8DA 4WFGD 4M6OL 5F89A 4FP8L 1S7RB 1UQSB 3O0RL 4UT9L 5D2NE 1EDQA 2BRRL 4LDLB 2C5DC 1RI8A 4PJ9A 2ICWA 4KZDH 5GIRB 3WO4C 4MAUL 4YXKL 1VKXB 5TH2B 2AJ3B 4KMTL 2AJVL 5D7IF 5FHBH 2AJZA 2D7OA 3HNTH 4RAVB 1K6QH 3MV7A 4D3CL 2OTPA 3QUXD 4Y5YC 5L8KB 1NBVL 1AGFA 2AJUH 1OQOA 2RQ8A 2VR5A 1Q9LB 4X4ZA 1MLBA 3BOVA 1C08B 4I3GA 5FGCE 5BVPL 1M71B 4NRZB 5AG9A 3RNKA 1NCBL 4JFFB 2FHFA 2VDLL 4JFZL 5IGXH 4LMQI 3QEGH 4L3AA 4OAWB 1NGXB 5DA0B 5E94A 3UX9B 2NQCA 4HJGA 1JK8A 2NXYB 5J13C 1XR9B 1VGEL 2K1MA 3MLXH 2Z35A 5E2WL 2AQ1A 2RJMA 3DRQA 4O2CA 3HE7B 4NCC2 4P2CG 1UM5H 3GIZH 3W9DA 3QPQC 4H8WL 1QLRB 5DEGB 4HIIA 3PV7A 3RUGF 1KBGL 3WL9B 3WSQL 1U91B 1CDBA 5GRJH 4L4TD 4HGWA 5E00B 3BGMA 3VGAC 3NIFE 3TNNB 3S34H 1T66C 4XCCH 1U8QB 1E27A 3G5VA 4AG4L 4PJ5E 5JXED 2H41A 5DJZA 3UZEA 2CUMA 1A7BA 1CL7L 4N0UE 1NCTA 4PJ8C 4NC1E 3DX8B 4L1DA 3TN0C 3EYOA 5C0AD 1T2JA 3PQYD 5EO1A 1R3LA 4JFXA 4HH8A 1NCDH 4XI5D 1J1OH 2OR7A 4WI2A 3TNMA 5DGRA 5GS1B 3ZE0F 4IRJB 3QFJB 3D3VA 5D6DC 3AMKA 5C9JB 1P2CB 3RU8H 3TPUB 5IMOA 1SBBA 3UTZA 5IP4A 3VH8B 4FQLL 3GI8L 1A6AA 3FO0H 5FUCC 4R4NC 4P9HL 4FFVC 4PG2C 3W2DH 4WTXA 4G6FD 4P49A 1U3JA 1CLYL 4KQ4H 1MELA 2CIKB 3VMNA 2Q76A 2R69L 1UYWH 4HS8H 1CWVA 2WUCL 2A9NH 3MLYL 4JFPB 3RY4A 4KTEH 4U7SA 5C08D 4ETQB 4K94C 5HHMD 1YN7A 3LRSB 4QXWA 4D8PA 5DC9B 3C60D 2GCYB 1CK0H 2EE9A 5IHZB 2NY4C 1NBZA 3ARDD 1DBJL 1XH3A 1CF8L 4U05A 5HI4C 4BFIB 2OK0L 1GGCL 2JK5B 4RAUB 4YHOH 5I73B 4GG8A 4CN1A 4CMHC 4IOFC 2VSCA 3QFDA 3P30L 3WEXB 1P84J 1VERA 5ENWB 3K2MC 4Y4FC 1NDGA 3EO0B 4F80A 2WW8A 4U1GB 2RGSA 4M62L 1CFQB 5EU7C 2QSQA 2C1PB 4AJ0A 2Z4QA 2HP4A 4JO4H 4LHJB 1NL0L 1MIML 1UM4L 3ARYA 3HZMA 3GSUB 4ZFFA 2GSIB 4DN3H 1BD2D 3MXVH 3UAJC 4R3SA 2MKWA 3VXPA 4LLAA 1FL3A 1A1OA 2AKRA 1S7QB 3P4MA 4JRYA 1W72H 4HZLB 2GJZB 1MHCB 3WXWL 4R0LB 2PYFB 1RJZA 4OLWL 3QIBA 2EEBA 1JZ3A 3DECA 2F5AH 3O3EA 4E9LA 4U1NB 3MROA 4Y0GA 1EAJA 2DYPB 5JPMA 2R1XA 2GJ6E 1UJTA 4X6DF 3GJFK 4TSBL 3HZVB 1HH9A 2R0KL 3IJSB 4TNWF 4JY4A 1R0AH 1XMWA 3DUHA 1OSPL 5E5MB 3MPCA 4F7PA 1OHQA 4AL8L 3VXMD 3GGWB 3QISA 4HWUA 2XTJC 2ATKA 2CO6B 4WFHD 4XWOC 1K85A 1QSED 1OWRM 2B20A 5I9QC 1D5XB 1CXKA 2JJTA 3ZMRA 4CMMA 5BCAA 4FTVB 1AXSB 5E9DB 5EZOL 1J1PH 2VZVA 4WHTA 5FF6B 1RV6X 2CJUH 3FZUC 5J9PA 4WUUE 4OQTH 1U42A 5C0EB 3ULVF 2WQRA 2BJMH 4CVZA 1KIQB 1A14H 2YWZA 2F74A 5DD0H 4YXHL 1AO7E 2DQCH 3B8YA 2W9LA 3IT8D 3G5ZA 4I48A 5MENE 4KQ3L 1YNKH 3I75A 4LEOB 5CP7A 4YXLH 2R0LH 1LEIB 1TPXB 5C9KA 3B9KA 4NO2A 5H8DA 2VNCA 3CPLA 2NX5D 4OB5L 3BPOB 2VC2L 2OJEA 2NY2B 5CINL 4H8WC 1S7UB 4LASL 4XCNA 4ZPTB 3UTQA 4KRMB 1CDJA 3NA9H 5DRNA 1FNEB 3C6LB 3V6ZB 3VXRE 5EUKB 5T1DL 1NEZB 2ARWA 4G5ZL 1NSNL 5DC0A 5DF0A 3BN9C 3VXTA 1BX2A 2NY7L 4PRIB 1T89C 2DM7A 1J1XL 3C2AL 4QTIL 3SOBH 3B9DA 4MNQD 3MZTA 4X6EB 2AJSH 4PJEB 1ROWA 2ZG1A 3HMXL 4FQ1L 4J4PA 1RFDH 4M43L 1G9ML 3Q3GA 2KBGA 5DZOA 2I25N 1I3GL 3L3OB 3V5DA 3F6LA 4DK3A 1OTTC 3K8MA 3WJLA 4ZTPH 1NEUA 1K8IB 5J1SC 4JJ5A 5KN5A 3EBAA 4DQOL 1YQ2A 3FQRA 3WS6A 3QEQA 4S1DD 4Z0BL 4YHML 4XTRC 5IQ9A 1WZLA 4ZPVB 1OP5H 2YWYA 3N06B 2X4PB 2GAZB 3I6GB 2WWMC 4PJCE 3K80A 1X5YA 3GSNA 3IFLH 1GC1H 5D2LA 1ED3A 3IU3A 5E0QA 4NQUA 1NMCC 3ARBD 1FRGH 3LEYH 5A16A 3QI9C 2RIKA 5SV3A 2IBZY 3QUKB 1CVSC 2QQLL 4E5XB 4GKSA 2VLLA 2NR6C 4EUPA 1F11A 3HPJA 4NQXA 2DQEH 4GAGH 2YA0A 2DL9A 2VLRA 3JSSA 1DBBH 3QDGA 5TPWH 4GO6B 2NXZB 3QCUH 1FQ9C 5JXAL 3O6FB 4NC2B 3ZYIA 2JIXB 4PJ5D 3MREB 3ES6B 1NPUA 3QEUB 5IBLD 1LK2A 3ARFB 3MRBB 2EH8L 4AENB 2EE3A 1F5WA 2X4QA 1GAFH 2CR6A 3T65A 4EI5D 4P4KD 3GZKA 1YEJL 3QQ4A 2W9DL 1KOAA 4Q74A 1V7ML 3KDMA 3VXUA 5GS0C 4C57C 2H2PD 2O5YH 5EC1A 3VRIB 3VE0B 4Y8AA 1EEUA 2Y7QA 4ZXBA 4F7EA 1C16A 3KLSA 3QZWA 3ZDZF 1NH6A 1OPGH 2CRZA 1XGRB 4GS7C 5LCVH 3WIHL 3KYKL 2JJVA 3LKRB 4QHLA 1P9MC 1PQZB 2YMXL 4HC1H 5I1HH 3F7YB 1QA9B 1F4YH 5H37G 4M7KL 1NGWB 3IDXL 5IEKB 2D0HA 1D6VH 4Z5RA 5CSZB 3LVEA 1ETZB 1PZ5B 2Y06H 4MX7B 4HKZB 4DZ8B 4WCYL 1INEH 3GMOB 2J7LA 1OP3K 3WDHA 3T0EA 4E41B 3FO9A 1ZANH 3MRCB 1JTOA 4LPUA 3T2PA 4MVBC 1XZ0A 1GHFL 5IMKA 1G9NL 43C9A 4LMQE 4XHJC 4G6MH 4NSKA 3X13B 1YUHB 4M7LT 1DQML 1RZ8A 4X7TA 2Q86A 1UGNA 1JNNH 4KUZH 3T0WA 3TIEB 5FK9B 3SCMD 1AGDA 1ITCA 1NKRA 3BESR 5CCKH 4OZFG 4U1HB 1D5IL 5GGTL 3WUWB 1KB9K 4YFDB 4C55A 3MRNB 3QWRD 3VGHA 2D9CA 2Y6SD 5F9AC 4S2SA 3RL1A 4RGNE 3BI9X 4JN1L 5EOQH 3O8XB 2JTDA 2ZUVA 2ADFL 1A4JA 5DYOA 3VFTB 1W2KT 4XMKL 3MLUH 3V6FB 3DETC 5JORB 3AUVA 3CX2A 3Q5TA 1G7MA 4ZO8A 3TZVA 1AFVH 4LPWA 3INUL 2AXJA 1JHLL 1WCBA 1KNOA 4IMLB 3R8QA 1WTGT 1BGXL 1MFEH 1OAKL 3HI1A 4JFDB 3RIAF 5T1MB 3SQOL 3ZT6A 1FVCB 4E42A 5DD3L 3KPRA 4RRPA 4NQDB 1NGYA 2GJ6D 2ICEB 4Y5XC 3RDTC 1M1SA 1H3VA 2VXUL 3LKQB 5BXFB 1OGAA 4GJTB 4YGAB 1U8OB 3QIWB 4RA0C 3NABH 2ARJB 2V2TA 5J06A 2VXSL 3G6DH 3B2UC 3ARWA 3MFFB 1CG9B 3EGSA 5GSRB 3KWWB 2WZPD 4NZDA 3Q2CA 3UTSB 3V79C 2YPKA 5TDNB 1HCVA 3EDJA 4F7CB 4MZ2A 3UJIH 4RFOH 1IRAY 1Z5LB 1IGIH 4WUUD 3QCVH 5ACZB 3BX7C 3JBG7 5FYKE 4PJBB 4P0DA 1MCFA 3U79A 2VDRL 5HGDA 3G9AB 4ZAKA 3JTSB 1IC7H 1AO7D 5MEND 3GNMH 2X1WL 1FCGA 3MRGB 4J8RB 3EZ8A 1SJEA 2AXFA 1I3VA 1U6AL 3QDJA 3TV3L 2HVJB 1QP1A 2WBWB 3VJ6B 1D9KD 2J5LC 1T0MA 1FVEA 1HSBB 4K71C 5DUMH 4HPYL 5E8NA 4PJXB 2V17L 1A8JH 1GH7A 1OF2B 2I5YH 3CDGB 4MWFA 3V4UH 1XCQB 3LD8C 5I8EA 2ADGA 3P0VL 4LLDB 5F3BB 1G7PB 1IGFL 2OZ4H 1KACB 1X5XA 2M8XA 2R0WL 5DO2C 2PR4H 1SJHB 1ADQA 3LKOB 2H32A 3CK0L 3MA7B 3IDIB 3GJFH 4RX4A 2VWEC 2IANB 4IRSC 1K8DB 2YD6A 4WEUD 1H3PL 1FLRL 2LU3A 5L9DL 2FJGB 1JN6A 1EHLH 3FRUA 3WS3A 1KN2L 5F6IC 4CJ1A 1S9KC 2ICWB 2YRZA 4MNHA 1WZ1L 2MQ0A 1S9XA 5E2VH 1YNTA 4CVXB 3LQAL 1IGYB 6FABH 2PXYC 2X1OA 1U58A 3MV7B 1T0NA 3QDME 3WFDH 1MRCL 3E6HA 1T7ZA 1IAKA 2YUXA 5FYKH 4FMFA 3RVUC 4P2OC 4HF5L 1MLBB 2XXCB 1TJIH 3KLHD 4U1JA 4WNQB 3H7BA 1BOGA 3RNKB 4G6JH 1QQDA 4LVOB 3ZDYE 3D39A 3A67H 5E94B 5LQBL 2DYPD 4LCYA 2CRIA 4HJGB 1JK8B 2DQIL 5BW7A 5E2TH 3MBEA 3BE1H 4ODHH 4JB9L 2Z35B 4NZJA 3STBA 5CHNB 1QFWM 3VFGL 3MODH 3DRQB 2BNRE 1AQDA 2ZUXA 3SDXE 3NTCL 1ZLUK 2ZG3A 2XG4A 3W9DB 3IAPA 4HIIB 5L88L 2L7JA 3QNZA 1FAIH 4D94A 4FQIL 4FFZL 3SGEI 4HGWB 1ORQA 4ODTH 3HE7C 5J11B 1I9RH 2ZUQB 1WGOA 3G08A 3AVEA 5HI3D 3LB6D 1EFXD 2IPUG 3H6JA 5L7XH 4A6YA 2FD6H 5GSVA 5I8KL 5DJZB 5GRWA 2AJYH 4BFGA 2DWEB 2IH3B 2P5EB 4J23A 1OW0C 3SDCC 1PY9A 2ZCKL 4NUGH 4GG6E 1FV1A 3EYOB 3FQWA 1JUFA 1FNSL 1R3LB 3C6LD 4HUUA 3PWNA 2VZUA 1WCQA 3TNMB 1RULL 1Z9MA 4CU8A 4XP1L 3L7FA 3D3VB 1B6UA 3QG6A 2CLZA 5IMOB 1MCPH 1RIUL 3DX6A 3UTZB 4CN6A 4KTDH 1A6AB 1MLCB 2PYEA 2E7LC 4AEEA 5DFWH 1W0YT 1JWUA 5GS1C 1YN6B 5ADOH 4LCIL 4DVBB 2CDFA 4TVPD 2VUOA 3TA3D 3NIFF 1IFHH 2EIBA 2Q76B 3VG0L 4PRBA 4W6XB 5AWNH 3H3PL 4PGZA 2F19L 1FVDB 5D1QA 1F42A 5JMRA 1TFHA 5K9QG 5DK3A 4JKMA 1I8LC 5KSBB 5EZJB 4K9EH 2CK2A 1YN7B 4LCCA 5HD8C 4D8PB 4KKBD 3C8KB 1J87A 3GMRA 4Z18A 2DWDA 1G7HA 4OZHA 2NY0B 5E8EA 1R5IA 1WBXB 1EO8L 4DWHA 1RD6A 5JHDB 2R23B 4J3VA 5BRZA 1A7QL 3NPSB 5DVNA 4GG8B 1FGVH 4RA3A 1HXYA 3QFDB 1I1AD 2GT9A 3KYMB 4L3EE 1IAIL 1PG7X 4HJ0C 3EZJB 3MRRA 4NPYB 1DQJA 4OFDA 1D5MB 2V5SA 4WI8A 1PSKH 2NXZD 2AAVA 3O6FD 2WAHA 2Z4QB 3TJHD 3MZGB 2EO9A 3QDAA 4ZFFB 1FFNB 4YPGA 1PLGL 2Z31B 3D0VA 1KIUA 3VXPB 4WTZG 3VA6A 3PGFL 1FL3B 3EYQD 1A1OB 5FUCE 5LAXA 4OFIA 3P4MB 4KY1H 5HI5D 5BOZG 4JRYB 1PY4A 2HH0L 4QEGA 4EN3B 1NCAH 1RJZB 4DGYH 3QIBB 5AYQA 2VITA 5E99L 3MROB 4LAQL 2ZCLL 5MEQA 5JPMB 3MRDB 1JP5A 1H3TA 2I9TB 1BLNA 5ECJE 3FL7A 3RVWD 4M8VA 2FX8L 3S5LG 3UPAA 2AV1A 4AIXA 3BZFA 3I6KA 2VL5B 1Q0XH 4QRQB 4R0LC 2FL5A 3LQAC 5I18L 3QQNA 4MD5A 4XP9H 2LU4A 4WI4A 1RUQH 1KCRL 3T8XA 2VJXA 5INDA 2ZUSA 4WFEE 3BAEL 1HYRC 1KTRL 4CADA 5C0ND 5J9PB 4IMKC 3V9FA 1XFPA 4YO0A 3H9SA 1INQB 2DAVA 3ET9F 4MA8L 2Y36H 2PO6C 5HYQA 2NY3B 4DKFH 1CD0A 4Y16A 3V7AG 4Y4HC 5JW4M 3RTQD 2F74B 1J8HA 4B41A 1NMAL 3G5ZB 4XNYH 3BP5A 4HIHA 5CP7B 4MA3B 2VAAB 3F5WB 3ILPA 2W9EH 3IDGA 1LO0H 3B9KB 5EU7E 4NO2B 1NCCL 2WINA 4HIXL 1AQKL 1MCEA 1IT9L 2YPVL 3S97C 1SYSA 2BERA 2JB5H 2OJEB 4XZUB 1FNAA 4XCNB 4JQVA 2WUBH 4L29B 3UTQB 1U93A 2VL4A 5GXBB 5CJXC 2F8OA 2Z8WC 1HYSD 2A9ML 1A6UL 2NPLX 3BPOC 5L2JA 2MJWA 2DLTA 4O2EB 4OZGE 2DKUA 3O8XD 1CGSL 1L7TH 5E8OA 4JQIL 1JI2A 5JZ7C 1MWAA 1JF5A 2EDTA 2VDQH 4O4YL 1JNLH 1XAUA 1DEEA 4P46A 4OCWL 4CL7A 4OZIE 3S3JA 2VKXA 3QUYA 3LEXB 3V5DB 4I2XA 2XTJE 5EU4B 3GBML 5DT1H 3OWEA 4JJ5B 5KN5B 2WV3A 3FQRB 3TH4T 5KVDL 1EGJL 1AKJA 3QEQB 3C6SA 2X9YA 4XPBL 4Z8FL 3HE6C 3BRFA 3TFKD 3WJJC 4TUKL 3HUJB 3QIWD 3CZJA 1V3LA 2C7UA 2P8MA 3KPNB 5DDHA 4TPRH 5D2LB 1AJ7L 1ED3B 1RQ5A 3MLSH 2BNRD 2X10A 2BFVL 2ICWJ 4OLYH 3BPCA 4OCNC 5A16B 2R0ZH 5I16A 1CIDA 4XGZA 4HK0A 3PP3K 4OCSH 4B53A 3SN6N 1JYVA 5IB1B 4GKSB 5LG1A 1YEKH 2VLLB 4EUPB 4M7ZB 4IDLA 1PZUB 4UV4H 3HPJB 4LNRA 4NQXB 1SY6L 4LSVH 1KB9J 2FWOB 2YK1H 4X8JA 4EBQL 2XY1A 2FATL 5JA9A 1W8NA 3GK8H 4YDVA 5ESVB 4PGJA 2PTVA 1AH1A 1QHOA 5JLZA 3BRGC 4JPIA 1MQKL 1LK2B 4U1LB 1F90L 3O0RH 1BFOA 2L7UA 2KDGA 1ZVYA 3BKYL 3T65B 4MAUH 3IDJA 4YXKH 3QQ4B 3I3BA 1MVFA 4PJCF 1KYOK 2OSLB 3VXUB 1TNNA 1IC4L 2OP4H 3ARFC 3V52H 1WK0A 2JELL 5CBEB 4J3SA 2R4SL 4ZXBB 3BIBX 4F7EB 1C16B 4KDTA 4ERSH 3QZWB 1NBVH 3WHE0 1MREL 3RWHA 4Q0XL 4QHLB 3HI5H 1NCBH 1JTTA 2VDLH 4JFZH 3ORJA 3KPPB 4N8CL 1YY8A 2JCCE 4UT7L 5DR5L 5MEPB 4I0PA 1F3DH 2VXQL 1T3FA 2EDJA 3IFOB 1VGEH 1YYML 2OCFD 5E2WH 3FO9B 4HWBH 1R5WA 4JRWA 1XZ0B 4OT1H 4YFLF 5IMKB 5AAMA 3DXAA 4LU5L 2VLKB 4BZYA 4H8WH 4NSKB 1T66D 1WIPA 4KRNA 4U33A 5HYEA 2DL2A 4APQA 3D69B 3UC0H 1KBGH 3OL2A 4X7TB 3WSQH 2Q86B 3O6LH 4QWWC 4HEME 3CFIC 3J7HA 1AGDB 4KV5E 4NJAH 1ACZA 4W70A 1NFDB 1MJ8H 4DFIA 4HDIA 4U1IA 5GJSL 1IL1B 1I1YA 3BXNB 2F5BL 5EULV 3O9WA 4NQCD 4BSWA 3QUMA 3TN0D 3FT4A 2VDOH 5DUPL 4AG4H 4L8BB 1JMZA 4N68A 3DROA 4U0RC 4Z95L 1HINL 1G1YA 5EC2A 3KPSE 5GHWL 3F7VA 4Z7WA 3BEVB 2AK4E 4BYHA 1DSFH 3OSKA 2P42B 3QPXL 4Y2DA 2KZ1B 4Y88A 2BSED 1Q94A 1MCDA 3HG1E 2XWBA 2NCMA 4D2NA 4HFUL 4R4ND 3F12A 4FFVD 5DJXB 2ZOKB 5EIIA 1CTOA 1KNOB 4FQLH 1X3DA 3O6ML 2A77L 1OSZA 2DIAA 3HI1B 1IEHA 1I8IA 1ZT4B 2VSDA 3OKMB 4LSUL 5T1LA 4KHXL 5FYJE 1MIEL 3RL2B 3UBXB 4BSVB 4UDTA 2V2TB 3UYRL 3MLYH 3EFDL 1I9JH 4PD4K 4F15B 3MRPB 4WFED 3EGSB 3K46A 3W11C 2YD7A 1NCUA 3P9WB 3Q1SH 1KJ3H 1MI5A 2G75A 4Y2OA 5HI4D 2IH1A 3DRTA 5FCSH 5GGRA 3UTOA 4N9GA 3TPKA 3ZHDA 4ZTOH 3MNZB 5HGDB 1CF8H 1TQBB 2DTSA 2H8PA 1SJEB 2AXFB 3QDJB 2E7HA 1WICA 5FO9A 1BIHA 4PGDB 2EYTA 1QUNA 5GS0H 3DUSB 3M45A 1T0MB 1YMMD 4OCRL 1FNGA 3NCJL 1UT9A 5E8NB 3IGAA 4HQQL 5I30L 4GKNA 3PDOB 4MWFB 4G7VL 3HRPA 1WSST 4M62H 3UAJD 1FZJA 1NFKA 1XIWC 1NL0H 2NY0D 5CEZE 3SJVA 1UM4H 5GGSY 1RZJL 43CAB 5JHDD 1HN1A 5IIEA 3SGKC 1CYGA 2VDKL 4UZGA 4LSRL 4LPYA 2NY6B 3DHMA 3HLAA 1C7SA 1RZGA 2EYRB 4DZBB 3VGEA 3WXWH 1JN6B 3MV8B 4H1LH 2P48B 3MSPA 2A73A 3FRUB 5FYJH 3W0WE 3V4VH 3NGBB 4HZAA 2AERT 2EYSA 5CIPA 4MNHB 2XACC 1K5NB 4GSDL 1B3JA 4XWOD 5C0JB 1YNTB 4HS6A 1OSPH 1J0JA 4PJ7E 5KG9A 3O3AB 5FYLL 1FLTX 3U4BL 1T0NB 4PJ9C 3CSPA 1I9EA 3E6HB 4YWGL 1IAKB 3HAEA 1DJSA 5H94B 1NKOA 3MRJA 3DUUB 1ZGLM 3PHOB 1JV5A 1UM6L 4U1JB 4YR6A 4EN3D 3QA3A 1KEML 4DKDC 1BOGB 1QQDB 3OJ2C 4NFDA 3IB4A 3Q48A 4PIRF 4LCYB 1I7RB 1CT8A 3NA4A 3FONA 5EU3A 4Y1AD 4JAMA 1IMHC 5IQ7L 5D1XA 3TT1L 1AR2A 4KQ3H 3ZLQC 4N8VG 1T6VN 3QIUA 5HHVL 2BVYA 5TE7L 1AQDB 4HWZA 4J3UA 4LBEA 4CU7A 4OB5H 3DTXB 4OSUH 4Q2ZB 2VC2H 4CUCA 3R1GL 1G0YR 1S5HA 5SWSE 3WHE1 5CINH 1VADA 3QNZB 1LVEA 2VLJD 5F96L 3ILQC 4FXGA 4LPTA 2VWEE 5T1DH 4G5ZH 1NSNH 5CD5D 5KVFL 3G08B 4RWHA 1ACYL 5JOEA 5ESAA 2E9IA 3HNSL 2AW2A 5GSVB 3MR9A 1TXKA 1LP9E 1HHHA 1OTTD 3QBTB 5J11C 1NUGA 3ZDYF 4M43H 2ZUQC 2CSPA 1QO3A 1FV1B 3KXFA 2ESVD 4OGYL 2R2EB 2ZOLA 3FQWB 3LKPB 1JUFB 1PEZA 2VERN 5F9JA 4DFHA 5IVNA 4HUUB 4M61A 1E4XL 4JG1L 4MNGE 5JNYA 4DQOH 4FQJH 1ZHLA 3QG6B 4UAOB 2CLZB 3UDWC 4RQQA 3DX6B 2FSEB 3P4NA 4I1NB 5C0CA 4GMSH 4Z76B 3QI9D 4OV6F 1J7VR 2QSTA 4UOW1 1JWUB 2W60A 3OKLA 2CDFB 2NR6D 1UENA 3S35X 2HFGL 2I27N 3OAUL 3KPOA 4JFFE 4Z0XA 3DBXA 3DGCR 3E2HB 2HG5B 2KL6A 4Y19A 2EO1A 4YK4B 5D1QB 5E08H 3L3DA 1F97A 1KJVB 1RUML 1E28A 3VFSA 1QSFD 1IQDA 1JWMA 4G8IA 1FZOB 3BP6A 4GG6F 3BPNB 3T2NL 4OI9A 3P11H 2DWDB 2NY1C 5E8EB 3EDFA 1R5IB 5ESQB 5FM8A 5FGSA 4H20L 2EH8H 1DQDH 5GS0D 4DJMA 1OT2A 4J7RA 5BRZB 2I07A 4EIGB 1MJ7L 4NBYB 5I75C 4P4RB 2EEAA 3MOAH 3GBNH 4D9LL 2GTWA 3PHQA 1HXYB 1YEJH 3HG1D 1V7MH 5HYSA 5D5ME 4WWKA 1KXTB 1DQJB 4FG6C 1CLZL 5FV2A 3MLPA 4TSCL 4TUOA 3THML 3P73A 1FFOB 4HUWA 4LL9A 4YPGB 1EERB 4ONFL 3TVMA 3WIHH 4P23A 4U2ZA 1BOYA 5B3JE 5HDLA 3D0VB 1WISA 3VFWA 5EIVA 2FX7L 4M7KH 3MRLA 5FYJD 5LAXB 5HPMB 1CBVL 5GZOD 2XG5A 1HHGA 4K7PX 1CDHA 3TC9A 4ODUA 1RURL 2P5WD 5DFVC 2D7NA 2VITB 1N6UA 3PDDA 2UYLB 5MEQB 4KRPB 1GHFH 4F3FA 4JE4B 2AV1B 3BZFB 5C0DB 2KPNA 5IVXA 3LMJL 2FL5B 2NZIA 1OLLA 3QIBC 4MD5B 2EE6A 1AHWA 2XN9E 1PDKA 3T8XB 5INDB 2DBJA 3I9GL 4HT1L 3PWVB 2WBJA 4IRZL 4I18B 3L5IA 2BDNH 4CADB 1F4HA 2MQCA 4FMKA 4HCRA 1UWGL 1QRNA 1OCWL 3H9SB 3U6RA 3EYVA 3RWJA 5E4EC 2CO7B 4Y16B 2VLKD 3SO3B 1P4BH 2JJTC 3B9AA 4NT6B 3DETD 3DO7A 1BMGA 4U3CA 3BP5B 3PWPA 4HIHB 1PX3A 2QSVA 1HHIB 3LRHA 3IDGB 5CEZD 2EXYC 2R8SL 2PCPA 3KYAA 2WINB 3LS4H 4LLUA 2R29L 5IW1B 2XQBL 4U0QB 4N0CD 3F58L 3P77B 3INUH 4KKLC 3MJ6A 1ZHBA 5DLML 3B9KC 3LQMA 3WKNA 2V9TA 3RDTD 1OAKH 4OLVL 3W0WD 3MRMB 3DSFH 1PD6A 3TEUA 5LKNA 4ONGL 5DD3H 2FECI 5E8OB 4LPXA 3SQBA 3B2UD 5TQ0L 5JUEL 1X6LA 4JDZA 1MWAB 2VXUH 3OPZL 4OD2A 4P46B 5E8PA 3WNPA 2FJFA 1YEFL 3D2UD 3QUYB 5FOBA 2OXHA 4I2XB 5B3NA 4G43B 2P8PA 3OZ9L 5ID1A 2ICCA 4LNVA 4J4PC 2F9BT 4BH7A 4I3RH 5LGJB 3ZKND 3TBSA 3MYJA 2YPLA 1AKJB 5GS2H 3V5KA 1P7QA 2Z9TA 5B39B 4ZFZA 2XT1B 2HLFD 2VDRH 1CDCA 3QUZB 3WJLC 1JGUH 3WNOA 4Q9CA 2C7UB 2P8MB 4QXUL 3TV3H 3BWAB 2X9WA 2X44D 5HDQL 4FTVE 4PTTA 2D7MA 2G5BB 3B2VH 3O2WL 5I16B 5EORH 3CVIL 4I77L 3LH2L 1WFNA 4HK0B 4HPYH 1XF4A 5CJ8A 5D1ZB 5DRWA 2V17H 5DO2D 1Z9LA 1OAQL 3QDHA 1TJHL 2YD2A 3ZKMC 4N0YH 3GSXB 4JQXA 4IIQC 4PRHE 4WGVB 4MJ2A 2F58L 1SM3L 1KGCE 3NN8B 5C6WH 1IGFH 1G9EA 5L2KA 4IRSD 4LSPL 4X8JB 3D5OF 1F6AA 4OZIF 4RAHA 4LLYA 5DD1H 4MB3A 4BUGA 2EDYA 3O4LB 5JLZB 1ZLVK 4JPIB 4M7ZC 3MO1A 1YEHH 5JQ6L 2FB4L 1H3PH 2VQTA 5L9DH 1ADQL 1UEMA 1BFOB 2BSTA 1KN2H 2PXYD 4NCDA 3WNMA 4PRIE 1Y6MR 2VZSA 3CXDL 3LQAH 4NM8L 3RVUD 2CLRB 2PN5A 4AIZA 4Y4KB 1BWWA 1HILA 4PJEE 1AR1C 2HFTA 4N5ED 2Z92A 1MRCH 4L4JA 3WV0A 1KCKA 5D7IA 5DS8A 4AZ8A 4FQPA 4PJGF 5JR1H 3LPGA 2NY6D 3NPZB 2Q6WA 4HF5H 4H25A 5EU6A 3RWHB 3MV8D 2EZ0C 2DRUA 1LK3L 4JDTL 5IBUB 4ZXBC 2DLFL 3VG9C 2B0SL 3N85L 5I15L 4I0PB 4PD4J 1BQUA 1T3FB 4OGAC 1I7ZA 2Y4SA 3EAKA 4JB9H 4JO3L 3P9LA 3VFGH 1FIEA 3RQ3A 3NTCH 3WHXA 1GOFA 3SPVB 3DHJA 3DYPA 4APQB 5L88H 4JFEA 3T0EC 3ROLA 1FORH 3A6CH 4FFZH 5C0BE 4YHLL 1A02N 4QGTA 4CNIB 1B0WA 3RUGA 5I1GL 1N59A 5FA4A 4HDIB 4PLOB 1V7NL 1I1YB 4YBQC 3SDCD 5EBMA 3T0XA 3O9WB 3GO1H 4BSWB 4V2BA 5HYJD 1AGEB 5EC2B 3F7VB 2JCCF 3M8OH 2ZCKH 5KBNC 3MA9H 1J5OH 4Y2DB 2VDMH 4OUUB 2J6EH 1FNSH 1AI1L 1QBMH 2G60H 5DJAA 1QR1A 1I8MA 4L4VA 3CZFB 1BM3L 3RGVA 2XFXA 3RVXD 2W38A 4NM4H 1GYAA 4XP1H 1REIA 4JEGB 4RSVA 2MFNA 1J18A 5ISZB 1F8TL 3F12B 3L5WA 2SEBB 1RIUH 2P49B 2QKIA 1H0DB 3CSYA 5EIIB 1J10A 4P2RB 4G8FB 1G84A 1OSZB 5I74B 3LV3A 5I1DA 1W0VA 2P24A 4ZS6D 3TWCL 4QRPD 4ZOAA 1O7VA 4Z78A 4YBLB 4C56A 3P4LA 3TZVC 4LCIH 1RIHH 4KV5F 1JZ7A 2ZJSH 5JA8B 4W4OA 3LY6A 2F19H 5HHOA 1T83A 1MCCA 4UDTB 4RFNC 3E6FA 3MRFA 2FIKA 2IPTH 5D7JA 4OFYA 2AXHA 4WW2A 4P5KB 4PG9B 1MI5B 1L7IL 4X6CA 2GITA 3BH8A 1TNMA 4HXBL 4ONHA 5J89A 3AM8A 1BFVL 3DRTB 3VW3L 4N9GB 5K9OA 1AGCA 4F15C 4W6WB 5DRXA 1LO3L 1A5FL 1LEGA 4Z7VE 3GKWL 2H8PB 1A7QH 2CK0L 4OM1L 5IMMA 4LCWD 4JANA 1ZA6A 3KR3H 2EYTB 4XVUC 4WJ5A 3VD7A 1E0OB 3Q6GL 1A7NH 3SKUD 1IAIH 4ZAKC 3IGAB 1T1XA 1ZHNA 5JW3L 1TQBC 5HBBA 5ETUB 1FZJB 1G7JA 3VD5A 1YPZF 4JRXE 4WI6A 1R3HB 2XWJA 2F53A 2BHUA 5SWZA 1QBLL 1IGJB 4NN5B 4K3GA 1S9WA 5IIEB 5EBLB 4GQ9L 4MSWA 3NACH 4P3CL 3SY0A 2VDPL 5F7YC 4MXQD 5D9SA 1VEPA 3VFVA 3UTTA 4X4ME 2COQA 4HIEA 1ZA3A 4ZSOB 5DXWA 1YEDA 1A9EA 2J8UB 2X4TB 2HH0H 2DQGH 5AYUL 3FRPG 5E99H 5C07E 5I0ZA 4JFDE 4LAQH 5BS0E 3L95B 1LO2L 4RWYH 2BVOA 3RX5A 1N6QH 1BEYL 1J0ZA 4KJWC 3O45B 4AEHL 2FX8H 4K8RL 4NQDE 1P4IL 1YC8A 2OX5A 3VFNA 5KG9B 5I18H 1TVHA 3HAEB 1MJUL 3UEZA 1KCRH 4CU6A 4XVJL 4V1DD 4UMGA 5IB4B 4F58H 1H8SA 3DVFA 1IBGL 4Y4HD 4HD9A 3ZKXB 3QA3B 4ZOEA 3L5XL 3IYLW 1MCQA 4XWGL 1E4JA 3WFCL 3FO1A 4UV7L 3B6SA 2LVCA 1CT8B 5GJTL 2X09A 5EU3B 2WWKT 4JAMB 5TE4L 5MEOB 4PY7A 4HUXA 1NMAH 3EKCA 5C70A 3O2DH 2IGFL 2YEZB 5HGHA 4MAYA 1ORSA 4YFEA 2ARJQ 5CEXB 4HIXH 4HWZB 4LBEB 1AQKH 5CFHA 2HT2C 1IT9H 2IG2L 2YPVH 1L0XA 4KJYA 3UO1L 3AC0A 5BW7C 4TYUA 3MBEC 4MQ7B 5AUMA 3BDYH 5K59E 3BPLB 4PJXE 1VADB 5HGBA 5L8LB 2E27L 4LLWA 2D4DA 2EIZA 3TESA 2YC1A 5JZ7D 2A9MH 4FXGB 2BY3A 1A6UH 5KSVB 4NQTA 5D70H 1F6FB 5ESAB 3K2UH 4FQXA 1WITA 3OG4B 5EA0L 4O4YH 1R3JA 4Y7MA 4OCWH 2IANE 1BF2A 3GMQA 3KXFB 3SKNB 1MWAL 3VA2C 3HE6D 1KV3A 4O2FB 4M61B 4X7CC 5JNYB 3S36H 3ARUA 1ZAGA 4OIIL 4OD1L 5CILL 1EGJH 2GK2A 5EFIA 1KENL 1JPST 3W5NA 4Z8FH 3CFDA 3P4NB 5CKAA 4L8CB 4O02L 5C0CB 4MDIA 2V5RA 1KJ2H 3ZO0A 2W60B 2IADA 3OKLB 1FNFA 1G6RA 3TBYA 1L6ZA 3WBDA 4FNLH 1Q8MA 3GFUA 1A3QA 4PRDA 4TTGA 1BVKB 5HHPA 3TBWA 3N1PC