4NCGB

Discovery of doravirine, an orally bioavailable non-nucleoside reverse transcriptase inhibitor potent against a wide range of resistant mutant hiv viruses
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
425
structure length
402
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Discovery of MK-1439, an orally bioavailable non-nucleoside reverse transcriptase inhibitor potent against a wide range of resistant mutant HIV viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/inhhibitor, hydrolase/inhhibitor
total genus 108
structure length 402
sequence length 425
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4ncgB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ncgB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ncgB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ncgB04
5HROB 4O44B 4ZPBA 3RB3A 4RNHA 1T05A 1T03A 4NLTA 4QWAA 2UVWA 1EP4A 2YNGB 4B3OB 3OLBA 3MECA 4O4GA 1DLOB 1IKXA 1J5OA 3DM2B 1RTJA 5KFBA 4QW9A 3BR9A 3QGHA 4JV2A 4G1QB 4LQ3A 4LSNB 1BQMB 5KFYA 5HROA 2IMWP 2AGOA 1TP7A 4O44A 2QV6A 1C1CB 1NHUA 1IKYB 1JLAA 1S6PA 5J2PB 4PWDB 4YR2A 3BJYA 1N56A 1DLOA 3KK1B 4KO0A 3TAMB 3TVKA 5F8MA 1D0EA 3KLVA 1VRUB 1RT5B 4YQWA 4RW6B 4LSNA 4U6PA 3QZ8A 1BQMA 2YNIB 4Y3CA 4KAIA 4IRKA 2W9CB 3NBPB 2FLNA 2RF2B 4WFXA 5EWEA 3GYNA 5KG6A 1C1CA 4GC7A 3I0RA 5DG7A 1IKYA 4PWDA 5J2PA 3C6UB 3KK1A 1TL3A 3TAMA 3FQKA 3G6YA 5DLFA 4WZQA 5KG2A 3TQ1A 1VRUA 4MK8A 4RW6A 1RYSA 1N5YB 1HQEB 4RW9B 2YNIA 1W25A 2J6TA 1VRTB 2W9CA 5DG8A 4TLRA 3IGVA 3FSIA 2OPQB 4RNFA 3C6UA 3I5CA 1C0TB 5L1JA 1S6QB 1K1SA 3SI8A 3T19A 5DG9A 1LWEB 5F8IA 2ILYA 1IKWB 3OLAA 4KFBB 5HLFB 1OS5A 1N5YA 1HQEA 1SUQB 4RW9A 3RBDA 1VRTA 4QWEA 5KT5A 4Y2AA 3CDUA 4EYIB 3IS9B 1SV5B 1TL1B 4WYLA 2OPQA 4NRUA 3T5KA 1C0TA 4ZP7A 5L1LA 1S6QA 3QLHB 4QW8A 3PW4A 4PQUB 1I6JA 2ZE2B 1LWEA 3DLEB 2BR0A 3LP0B 3CO9A 4K50A 1IKWA 2OPRA 4KFBA 5CYMB 5HLFA 2FJXA 1SUQA 5F8JA 1RT1B 4KKOB 1RTIA 3DLKB 4J9RA 1RTHB 2E9TA 1QAIA 2I1RA 4J9PA 1TL1A 3KLIB 1XR5A 5KG1A 2IM3A 2W8KA 2E9ZA 1C1BB 3QLHA 5KFSA 4PQUA 3T5LA 2AQ4A 2FLPA 2ZE2A 3DLEA 2XWYA 3LP0A 3NGDA 3MF5A 1U09A 5CYMA 4F4YA 1RAJA 5KT3A 4IR9A 4U7CA 4ECTA 4WZMA 4MFBB 1RT1A 4KE5A 2I5JB 4KKOA 4DL6A 3DLKA 1KLMB 1RTHA 2YKNB 4YMEA 1DTQB 4KV8B 4XO0A 3LAMA 5DGBA 4EBEA 5I3UB 3KLIA 1QE1B 3LALA 3GV8B 3KJVB 1C1BA 2VG6B 3MEDA 5CYQB 1RYRA 1RT4B 3I5BA 5KFQA 2HWIA 1TKTB 2VG5A 3PR4A 3PHEA 2EC0A 3FQLA 4H54A 5EWGA 2ATLA 2RDJA 3NL0A 2HMIB 4RZRA 2YKNA 1DTQA 1N6QA 4Q45A 3BQ1A 3PW2A 5I3UA 2BQRA 3QGGA 3KJVA 3PW5A 2VG6A 5CYQA 1RT4A 3DOLB 5J1EA 1TKTA 1UWBB 4JV0A 5KFOA 3T5JA 3KLHB 4J9SA 2VA3A 4F50A 2HMIA 5KFHA 3LANA 3PVXA 1HYSB 2E9RX 1RDRA 1JXLA 4MIBA 3DOLA 1S1TB 4ECQA 5KFNA 3OHBA 3DYAB 2R8GA 1UWBA 2JEIA 3ICLA 4EO8A 3KLHA 4EBDA 3V6HA 2ZD1B 4F4WA 3LP1B 2DPJA 4WXOA 1D1UA 4NLUA 2OPSB 1HYSA 4ED7A 1JLCB 3H5UA 2C2RA 4WFZA 4NLOA 1REVA 4KHRA 4TYBA 5KG4A 3E01B 1S1TA 5J2NA 1R0AB 2QE5A 4QWCA 4RNOA 3ITHB 4O3SA 3KLEA 4DL7A 1RTJB 2ZD1A 2W8LA 3LP1A 3PW7A 1GX5A 2HNDB 2BRLA 3DRSB 4IG0B 2OPSA 2YKMB 5DQIA 4ZPDA 4RUCA 2HAIA 3E01A 3UDLA 2JEJA 1R0AA 5KFEA 2FVCA 4Q44A 4RW8B 1HPZA 1JLAB 1S6PB 1KHWA 3SFGA 3ITHA 4NCGB 3N6NA 3HVAA 1LWCA 3M8QB 4KO0B 5J2MB 4Q0BA 4JV1A 2JEGA 5KT2A 3EPGA 3PZPA 2HNDA 2WHOA 3DRSA 3KMSA 4MKAA 4IG0A 3Q8RB 2YKMA 4MK9A 3NMAA 4NRTA 1RA7A 3N6LA 3MFHA 3M9MB 4ZP9A 3I0RB 3RB4A 4RW8A 2B6AB 4O3NA 4RU9A 3D28A 4ZPCA 5F9LA 3C6TB 4NCGA 3BSAA 1TL3B 3M8QA 4YR3A 5J2MA 2OH2A 3KOAA 3RB6A 2VG7A 2B5JB 4EBCA 2AU0A 4ID5B 2D41A 3OSPA 5KG3A 3CDWA 1RA6A 3HKWA 1TKZB 2B6AA 4PUOB 1S1WB 4K4ZA 3C6TA 1S9EB 1SH2A 2WOMB 2AX0A 1TKXB 4ECWA 4QPXA 5EWFA 4DL2A 2B5JA 3RAQA 4ID5A 3KHLA 3BSNA 4IFVB 1TKZA 3H5SA 5KFWA 4PUOA 1S1WA 4ICLA 1S9EA 1XR7A 4HYKA 2WOMA 4XPEA 4IQXA 1TKXA 3QIPA 4H4OB 4R8UA 2OPRB 2FVSA 1RT3B 1GX6A 1RTIB 4IFVA 2IM1A 3KLGB 4HKQA 4MKBA 4ED1A 4DL3A 2HNZB 3CJ3A 1S9GB 4H4OA 1S1VB 3V81A 3KK2B 4KBIA 3OL9A 1Z4UA 4NLDA 1S4FA 3QYYA 4Q43A 5KT7A 1RT3A 1S97A 2IBKA 1WNEA 4YP3A 2C2DA 2BQ3A 3KLGA 5I42B 3QZ7A 4ECZA 4TQRA 5KFUA 5C5JA 3MEDB 3HHKA 2HNZA 2XGQA 1S0NA 5HBMB 2R8KA 1S9GA 5KFZA 3Q8PB 1S1VA 2VG5B 3KK2A 3V4IB 2IC3A 1RTDB 3T1AA 4ZP8A 3MFIA 4ED3A 3DDKA 4NZ0A 3KK3A 3FDSA 3H5YA 4WXWA 3MR5A 2W7OA 4G3IA 2W9BB 3QGIA 1LW0A 1N6QB 4IH6A 4J9OA 1IKVA 1RT2B 5I42A 3KNAA 4K4SA 2IJNA 4TY8A 2BANB 3DLGB 1T3NA 4O3QA 2FLLA 5J1EB 5HBMA 2JC0A 4ZVGA 4FBUA 4DG1B 3MEGA 3T5HA 3V4IA 4K4UA 5D3GB 1RTDA 3H98A 4IH7A 5KFAA 4Q8FA 2AGQA 4JUZA 3H4DA 2CKWA 4FS1A 4DL5A 4IFYA 5KG7A 4YR0A 1S9FA 1JKHB 3ISNC 3JYTB 4TN2A 2W9BA 3KLFA 2V4QA 1RT2A 2WB4A 3CJ0A 2UUWA 2BANA 1ZTWA 4ED8A 1FKOA 2J6SA 3DLGA 2FVPA 5F8HA 4M94A 3I0SB 5KFLA 4FS2A 2J6UA 4DG1A 3CDEA 5DQGA 5D3GA 2AGPA 4M95A 3V6DB 3UR0A 3D5MA 5KG5A 4IOBA 4ZVEA 4NLPA 4F4ZA 1JKHA 3JYTA 1IM4A 4K4XA 3KMQA 3GV5B 2CJQA 1LW2A 4IKAA 1REVB 1MU2B 2UUTA 4MIAA 3M9NB 3I0SA 3DRPA 2YNFB 5J2NB 4F4XA 2IM2A 5F8NA 2JLEA 3KLEB 3V6DA 4KHMA 4J9MA 3GIMA 1S0MA 4IH5A 4ZMMA 1S48A 5KT6A 2W9AA 3CJ2A 1RT7B 5HP1B 2YNHB 5F9NA 3BGRA 5DGAA 4K4TA 1MU2A 1HMVB 3SFUA 2B43A 2YNFA 1XR6A 4RNNA 2C22A 4QWDA 4K4VA 1HPZB 3GIJA 3EPIA 1LWCB 4Q0BB 1SH0A 2V9WA 1JLBB 3MR6A 3OL7A 1RT7A 5HP1A 2YNHA 3BREA 4DEZA 2FVRA 5F8GA 2WK4A 2XI3A 3RAXA 1HMVA 2IAJB 2XC9A 4FBTA 4URQU 3GIIA 2C2EA 2ALZA 2V4RA 5DQHA 3H4BA 4O4RA 5EUHA 2FJVA 2UVRA 2UVVA 4ECRA 1JLBA 4IG3B 3H40A 4TQSA 4K4WA 2VG7B 3HVTB 5F8LA 4URSA 1N48A 2GIRA 3MEEA 3MR3A 3IRXA 3G6XA 2IAJA 3IGNA 1S10A 4IDKB 4R5PA 3V6JA 3LAKA 3JSMA 4I2QB 5J2QA 4EO6A 2WCXA 4IG3A 2D7SA 4ECVA 5C42A 3PJXA 2UVUA 3HVTA 2ASJA 3KHGA 5KFTA 5L9XA 2O5DA 3N6MA 5KFJA 3IG1B 5KFDA 1YVFA 4NLQA 4IDKA 4KB7A 3M9OB 3GV7B 4DL4A 2ZKUA 3FRZA 3Q8SB 4I2QA 4ICLB 4LQ9A 2ASLA 2GIQA 1NHVA 3QIPB 4R8UB 4ZHRB 5JUMA 4GC6A 4RW4B 2R8IA 4RW7B 3FFIB 3CVKA 3H59A 1FKPB 3OL8A 4I2PB 3BSCA 2YNGA 4B3OA 4URGA 3IG1A 4ECYA 4NLGA 3HVWA 3CJ5A 4NLRA 3DM2A 2VA2A 1JLFB 2R2TA 3BSOA 2BRKA 4G1QA 2BE2B 2XI2A 3V81B 4ZHRA 1DTTB 3H5XA 3H2LA 4RW4A 2FJWA 1TVRB 3FFIA 4RW7A 4OL8A 5KFXA 5KFPA 1FKPA 3MR2A 4I2PA 2WRMA 4O3PA 5JXSA 4J9NA 1ZTTA 4ECUA 5L1IA 4EYHB 2AX1A 3I5AA 4NLWA 2XCPA 4NLYA 1JLFA 4ECSA 1RT5A 3UQSA 3OL6A 4WYWA 3GQCA 2BE2A 3V6KA 3ISND 3DOKB 1QAJA 1DTTA 3NBPA 2IC3B 1CSJA 4O3OA 2RF2A 1TVRA 2JEFA 2GC8A 3LP2B 3KK3B 5KFVA 1TV6B 4Q8EA 4KSEB 1LW0B 2RKIB 4I7FB 1IKVB 1K1QA 1RT6B 2V0NA 5FDLB 4TY8B 1S1XB 4WE1B 3NKYA 4XPCA 2IM0A 3GILA 1KHVA 3DOKA 1JX4A 2WONB 3MEGB 4J9KA 5T14A 4IR1A 3LP2A 3E51A 1TV6A 4IFYB 5K14B 4NLXA 1SH3A 3EZUA 3DI6B 2RKIA 4I7FA 3KLFB 2RDIA 3VQSA 3OHAA 1RT6A 4J9QA 1C0UB 5FDLA 1S1XA 4WE1A 1FKOB 5C24B 1S0OA 4Y34A 5KFRA 1HNVB 2WONA 4H4MB 2HNYB 1HNIB 3KHRA 5EDWA 3IS9A 2IA6A 1SV5A 5K14A 2BQUA 1MMLA 5KFFA 3RB0A 1HARA 2R2UA 3CJ4A 3DI6A 3CWJA 4QWBA 1EETB 1C0UA 1LW2B 5C24A 2F8EX 2R2SA 3DRPB 4RNMA 4ED0A 1HNVA 4H4MA 2HNYA 1HNIA 3NAHA 1JIHA 4X2BA 4MH8A 5DLGA 2R8JA 2FVQA 1TQLA 1LWFB 3KHHA 3G86A 2C28A 3M8PB 4Y2CA 4TY9A 3CIZA 1FK9B 4IRDA 3BGRB 1EETA 4ZVHA 3GIKA 3PW0A 1BQNB 2W7PA 2JC1A 4MFBA 4ZP6A 2I5JA 4RUAA 1C2PA 4ED2A 1KLMA 4J9LA 4KV8A 5KFMA 5C25B 1QE1A 3PR5B 3Q8QB 1S49A 4NYZA 1QUVA 3OSNA 1LWFA 2WTFA 3G6VA 2R8HA 4EEYA 3M8PA 1FK9A 1N4LA 3BQ0A 2ILZA 2AWZA 2ASDA 1HQUB 1T94A 1BQNA 4LSLB 2D3ZA 4NLSA 5L1KA 3BQ2A 1NNDA 1JLQB 1S1UB 5C25A 4R0EA 3DMJB 3QIDA 4ZVFA 5KFCA 3NAIA 3PJWA 5KFIA 5KT4A 5KFKA 4TXSA 4K4YA 1JLGB 1HQUA 4TYAA 3MEEB 4LSLA 3IRXB 4R5PB 3DRRB 1JLEB 2OPPB 3JSMB 1JLQA 3QO9B 5J2QB 1S1UA 4MK7A 3MTKA 3DMJA 5C42B 4IRCA 2XGPA 4O3RA 2XCAA 1T05B 1T03B 3DYAA 1JLGA 5KFGA 1EP4B 2R2RA 2D3UA 4ECXA 3RBEA 1ZETA 3MECB 2DPIA 4O4GB 4NLVA 2HWHA 1IKXB 3DRRA 1J5OB 1JLEA 2OPPA 4WFYA 4ED6A 3IN5A 3QO9A 4ZPAA 3UPFA 2IJFA 5KG0A 1JLCA
chains in the Genus database with same CATH superfamily
1HL6A 1DQ9A 5B0DA 3PM9A 1J5OA 3QGHA 3CCJS 1NH7A 3W63A 1S6PA 2VASA 3BB5A 1VQKS 3LGMA 3VGSA 4DSIA 4DLEA 1VQPS 3RRGA 4IRKA 1U1KA 3LW5C 3Q83A 1X9SA 4QIVA 2J0SD 2OTLS 5D0GA 2XBPA 5M2RA 4RW9B 3U1NA 1TK8A 4CLPA 2IIHA 3W61A 3T19A 1LWEB 1IKWB 5HLFB 4FZVA 1OPIA 4QWEA 3CDUA 2OSRA 3UD3P 1TL1B 4C3MA 4PXBA 1FE0A 1RB0A 3OFFA 3EYZA 1I6JA 1LKZA 1RTIA 2JX2A 4YFUA 3KLIB 3RRKA 5KG1A 3CEDA 1FERA 1RUSA 4LRDA 4WZMA 4OZ0A 3R2DJ 3LALA 1KFDA 2A1BA 2DGXA 3GMGA 4V1Ak 2YKNA 2PT0A 1KFSA 3KJVA 4RO0A 5KTQA 1MROA 1ZPVA 3G6ES 5D0EA 1NM2A 1U8SA 3V6HA 3LTOA 2RU9A 4F4WA 4F7VA 2W4PA 4K0KJ 1KD1T 2XTJP 1REVA 1YWXA 2E5LF 2V68A 3TWZA 3HJVA 3CC7S 3I82A 3BKTA 4ZPDA 4PG4A 3PYEA 1R0AA 2VICA 1YJ7A 2FVCA 3H8YA 5LMUJ 2RIJA 3N6NA 2QSWA 2A6MA 4MK9A 3M8ZA 2ZDPA 5H9EJ 3IWXA 1K44A 1PIEA 2ZH1A 5IXUA 2OH2A 4F36A 3C2PA 1JNZB 2PO4A 4EBCA 1JK9B 3C6TA 4ECWA 3A8EA 2Z8QA 4WBFA 4P10A 4R8UA 4Q2MA 3DLBA 1CULB 2YX7A 1TU0B 4DR1F 3KLGB 3CJ3A 1VQ8S 1IJFB 5B0BA 4OX9F 3V81A 1CS4B 4I1TA 2KFZA 3D0HE 4HVZA 2DVIA 1VBZA 2FDNA 2VKRA 4DN0A 4DR3J 5T41A 1N6QB 5ADZA 4TY8A 3UE2A 2LMIA 2AGQA 4DL5A 3AJ1A 3VV2B 5EGYA 1R0CB 5E3QA 3TZYA 4B3MJ 1G2EA 3C8YA 2IRUA 3EDRB 4QIEA 4AUKA 4K4XA 4IKAA 2GMHA 3M9NB 2BA9A 3AJ2A 2DGOA 2XULA 1OYDA 2ZJRQ 1YITS 2VODA 3SFUA 1RHJB 1FI4A 4RX6A 3NWGA 1UCNA 3VAMA 3D68A 4DHVA 2VV5A 3J7Z5 1WG5A 4OYZA 1IM6A 3RJMB 1HBUA 1EHWA 1PG5B 2PEBA 4IDKA 1QM9A 2FC8A 5C2GA 2COLA 2CAJA 3HVWA 3DLJA 2R2TA 1QVGR 4RW4A 3MR2A 4FF2A 1S7HA 2KDOA 2RD5C 2CZ9A 1JLFA 3Q2TC 2P5VA 3OL6A 4HH0A 2K1RB 1PJ5A 3MUMP 3NBPA 1DURA 2MGZB 5LSRA 3O44A 4AD6A 1LW0B 2V0NA 4OX6A 3DOKA 2VFVA 2EG1A 2MJUA 2DGSA 4DS4A 1UP1A 4B9SA 1HNVB 3NNCA 1IUJA 4G1PA 3FBBA 1VHFA 3JTOA 2R2UA 4OYMA 4YHHF 4CH1A 4DBQA 1AA1B 3DRPB 1Z1ZA 4L73A 3Q0AA 3GU0A 2OGUA 3PW0A 3GCWP 2WVBA 2QL7B 3UD5A 1T94A 1VIXA 3BZQA 1S1UB 5KT4A 4LJMA 2DIVA 4UY8T 3MCMA 1HNZF 1A7GE 1JLQA 3VZIA 4MK7A 2MQ8A 1T03B 3R7BB 5KFGA 3TUZC 3DRRA 4R0JA 3IN5A 2Q1LA 4KYZA 1L3VA 4M5GA 3MAHA 2B4OA 1U7LA 5B0CA 2XWXA 2P6TA 1SC1B 4C8OA 5KFYA 3FSXA 4C8LA 4X4NA 3W9IA 2UXDF 4GKKJ 1QSYA 3R27A 2DR9A 1FXLA 4LSNA 1BQMA 2W9CB 5KG6A 1VMBA 4NMXA 1OY9A 3I4HX 3TQ1A 1VRUA 4B3TF 2YNIA 4LFAJ 4TLRA 3D6FB 4GVBB 2RILA 4FN5A 4ZJOA 4X66F 1JJCB 3OLAA 2HHPA 3PO5A 5K9FA 3QLHB 3S6EA 2OPRA 2LLZA 4X64F 2I1RA 3BBFA 5CYMA 5KT3A 1RT1A 4KKOA 7AT1B 2CWKA 2EKNA 1UAWA 3W2VB 1HBMA 1TKTB 3PR4A 2EKYA 2AYBA 1VBXA 5I3UA 1XJWB 4OYAA 1URNA 4NXMJ 1VR6A 2DHSA 4P73A 3KLHA 3AD8C 2DGQA 3N4WA 3ADAC 2DNLA 1BLUA 4ZLJA 2HPUA 5ITHA 3GSDA 3JQKA 1BD6A 1XBWA 3TYTA 4ILLA 3JAMY 4NCGB 3VAGA 3EPGA 3NLCA 4CLUA 1X4CA 2UV8G 3RBZA 2H51B 1G3OA 1PC4A 1XEZA 5D4OA 3OSPA 1XN9A 2CJAA 2B6AA 1SH2A 4F67A 1TKXB 4U7UD 1D3WA 4IFVB 2DK2A 3BR8A 2B9WA 3HHLD 5AJ3F 4HKQA 2NXUA 4ZKAA 1S1VB 3KK2B 3OL9A 4A4JA 1SJRA 3R6LB 1KKHA 4DDFA 2CJ9A 3N5FA 5I42B 2G9OA 5KFUA 2ZFHA 1VIOA 5IWAF 2GJIA 2I0XA 2PA3A 2ADCA 1S6UA 4CM2A 1TFWA 4JUZA 4C4WA 1J27A 1IQTA 1RT2A 1N0VC 1WEXA 4LF4J 2BANA 5GADI 3DLGA 3AH6A 2FZCB 5D3GA 4CWBA 3V6DB 3D6TB 2LECA 2ROGA 5FLXY 3KLEB 3C16B 3DGPB 3TA0A 5KT6A 4MT1A 3NS6A 2EK1A 2B43A 2VQEJ 2A3JA 4CM0A 4JYAJ 1BUXA 1X4EA 2YNHA 3MEKA 4DEZA 1UL3A 5SZTA 2MZ1A 3OXFA 3GLJA 5BR8F 3W7BA 5DQHA 3H40A 2CQIA 4E2FB 2E1RA 4M5HA 4CLZA 4LMZA 1Y3JA 4A8SA 4ECVA 3GFHA 2HW3A 2XMJA 1EAYC 4DFMA 4DCJB 3GV7B 1VOMA 4CNZA 3OPKA 3B4MA 4ZLPA 3FFIB 4IO1A 4AFFA 2YTCA 3EZOA 3MM8B 2JFDA 2BACA 2AEJA 2HRTA 2VFRA 1SBRA 1ZTTA 3NEKA 3RUBL 2AX1A 4QU7A 1V3ZA 2IC3B 3UN3A 1HWJA 2GIFA 1MSWD 4MMOA 3CSKA 3MEGB 2DYAA 4IFYB 1J5EF 2RKIA 4I7FA 2KN4A 5A8KA 1SIWB 5HN0A 2ZZNA 2HFSA 5I3PA 3J81Y 2P8IA 5MAOA 1HNIA 3WQPA 5ETVA 3M30B 3QWUA 3BGOP 3BGRB 2ZBRA 1NK0A 3UI3A 2NXEA 2MLZA 4ZP6A 4X4UA 5A6PA 3JQJA 4I4BA 4K7QA 1QUVA 1Q86T 1X7VA 4LSLB 1U0SA 4KGZB 2IMOA 1UVJA 5JVGQ 5KFCA 2Y9HA 2QA4G 4LF5F 3HK2A 3QATA 2FGOA 2VPYB 3DMJA 4OYPA 2XCAA 3DYAA 1U1OA 3DDIA 3UO0A 3MM5B 4UQTA 2OPPA 1MMNA 5DM7Q 6FDRA 4RNHA 1EP4A 4O4GA 1NSAA 1IKXA 1RU2A 4WTYA 1OYEA 4KT0C 3OVAA 3K5NA 1IBKJ 1MNEA 1JLAA 4YR2A 3BJYA 3KK1B 1GMVA 1NZ8A 3HX9A 2RF2B 4DX5A 3I0RA 3C6UB 1FWPA 2GGPA 3HXMA 3W9HA 4Q7AA 1C0TB 1REGX 5F8IA 2WSEC 4BC9A 5KT5A 3UD4P 4WYLA 3T5KA 4A8XA 2UUAF 2DCLA 1SUQA 2LA4A 3ET6B 3PRBA 4ZPVR 4ZVOB 2Y0BB 4J9PA 4FKYA 3DHWC 3CMQA 3T5LA 1YJVA 4ECTA 4KV8B 3HPOA 2C3PA 4BHQA 3RRHA 3TP2A 1VGYA 2CQGA 3F56A 5EWGA 2RDJA 1KOHA 4RZRA 2CRLA 3O5TB 4QR0A 1R43A 3VAHA 4DX7A 4B9LA 4O0IA 4JI3J 2KH9A 3FK4A 1S1TB 5ETPA 4ECQA 5T7LA 3BDEA 2DT9A 3PHTA 4OHXA 2CQ1A 3CCQS 1FNXH 2ZD1A 4IG0B 1KP6A 1ULRA 1MN7A 4PCQA 5U47A 3PJ9A 2CYYA 1FWKA 4Q0BA 1UEVA 3KMSA 3DRSA 3NMAA 2ZUAA 1UWAA 3H20A 5GAGI 1JNRB 3D28A 4ZPCA 1SQEA 4YR3A 1UVIA 4K4ZA 3UCGA 2XMUA 2VFTA 4QPXA 5EWFA 1Y10A 4LFCJ 1VBKA 2N3LA 4PUOA 3J7YU 4HYKA 1X4BA 4DJBA 1B7FA 3AOBA 1CBKA 5HSPA 2B51A 3VAKA 2LFVA 4KBIA 2IPOB 4FYWB 2BM0A 2CQBA 2GJ2A 4RUHA 2YH0A 5HQLA 1U2CA 3QRPA 1LQ9A 1DY3A 4ZVGA 3TX8A 3V4IA 3KKFA 3D4JA 3PKYA 2J8AA 4ED4A 2WB4A 1QLNA 1XNRF 1FFGB 4LR7A 3TVYA 3T1YF 1NJXA 2GHWA 5GVQA 4U8VA 5J1PA 2YNFA 2B7CB 1SL0A 2JNJA 1SH0A 2BV3A 3JS9A 3ZO7A 2IHR1 4FBTA 2HS3A 2FJVA 4IG3B 5IS2A 1IBCB 1XMQF 4PG6A 4OX8A 3DOMB 2O66A 2OD4A 3HVTA 1CJUA 1R8CA 1NPKA 1FD8A 3IA0A 1VHIA 2ZNYA 5E3AA 2QFIA 1ROFA 1NHVA 2EVZA 4ZHRB 1SL2A 2HURA 2IBOA 2BRKA 2CQ0A 3CO0P 2CNLB 1Q5VA 3GJTB 3EGZA 3CF5Q 4OX7A 2KVIA 2M88A 3R5GA 2WVFA 4DV6F 1TVRA 4YB7A 1TL4A 2MQQA 2RQCA 1O51A 1TK0A 3A12A 2L48A 3GILA 2FHOB 7FD1A 2WONB 4F2SA 4CZCA 2M0GB 4IR1A 3LP2A 2Y1RI 3OHAA 4DCOB 4OLOA 3KHRA 5EDWA 1YBTA 3CWJA 4DX8H 3T41A 1FJGF 2B9EA 1JIHA 5E3CA 2XYPB 1P9YA 3TEGA 3FEZA 2UXCF 1XMOJ 2G2ZA 4DPUA 1IR0A 2VBWA 2AJFE 2MQNA 3PYGA 4LREA 4YEAA 1AYEA 4KR0B 4TXSA 4TYAA 2XSFA 3H2VE 4F3OA 3PO4A 1I94J 4F02A 2N4CA 2IJFA 1LWXA 1WC6A 5HQMA 3M2UB 1RAHB 1PJ7A 2B3TB 4CQ1A 1MWQA 1NLKL 2NYHA 5A8RB 4B9UA 5J2PB 2VU5A 2LXIA 1VCTA 2X3DA 4JI2F 2FLNA 3QJPA 3G96A 1MWYA 3CCWA 3G8TA 2YWHA 4NYOA 1ZM4A 1WORA 1ZZFA 4RW9A 2WW8A 3IS9B 2DNPA 1RTZA 2G0CA 1LWEA 1AFIA 1IKWA 5HLFA 4P74A 4AL6A 1TL1A 2V2ZA 4OHYA 4B02A 4OZ3A 2I8EA 1SKSA 1UJ6A 3DXSX 3KLIA 2B7BB 4DR6J 3LWMA 1L3UA 4CDIA 3N9UC 2XMVA 3GPAA 5J1EA 3H0PA 3W9JA 2HFUA 2LEBA 5ETRA 2AYEA 4HTJA 1M5SA 1RDRA 4IOAQ 2NR0A 2R3VA 3MM6B 2V34A 2U1AA 3ULHA 5A0YB 3JB9k 1AUSL 4F04B 2HS0A 3E01B 5J2NA 2A6OA 4A47A 3BGUA 4RNOA 3ITHB 3BGFA 3BO3A 1RWKB 4H4KA 1NPPA 1HPZA 1KHWA 1ZS6A 4K2XA 3M8QB 2WHOA 4HACB 1QSLA 3Q8RB 4NRTA 2HG4A 1TL3B 3J80Y 4HL9A 1CEZA 1HBOB 1YJUA 5CCMA 5IC6B 2ZM6F 2ROPA 2PMHA 4OYWA 4AT1B 3R9LA 2HK3A 2V50A 2L9NA 3K8VA 1S9GB 1EQMA 5H9FK 4NLDA 1CULA 2CIMA 3KLGA 2KG0A 3OVBA 3IBCB 2GQQA 1CS4A 4NZ0A 4OHVA 4FNHA 1K47A 5D0HA 1IKVA 2VFUA 4D3HA 3H98A 1G4CA 1XERA 2KFNA 3DHXA 4DV1F 5KG7A 4TN2A 3ISNC 2X1AA 3PFOA 1U1RA 4ZVTB 3HHEA 4WP8A 3G4SS 2PFDA 3SCJE 4B9VA 3CC4S 1TTHB 4DU8A 3HFKA 3CJ2A 4ZPTR 3FZ2A 4K4TA 1HMVB 3CUNA 1AROP 2YKPA 2CQHA 2DNMA 2XC9A 4DV0J 1TAQA 2XNRA 1ZBTA 2IJRA 1HD1A 1M5KC 2VJUA 3ILLA 1I5OB 3OTOJ 2ASJA 3O8WA 3R1HA 1R0BG 1OJ4A 4KB7A 4DL4A 3FRZA 2MZQA 3BPSP 5IQ6A 4LUBA 1Q82T 5CD4H 2XY7A 1N5VA 3EICA 2BE2B 2XI2A 2PEHA 5JXSA 1V3RA 1RHKB 4GKJJ 1UVNA 2J0WA 3IXQA 3H90A 3UDCA 4O3OA 1AT1B 4KSEB 2O67A 4BWJA 4U95A 1S1XB 4WE1B 4NZ6A 2IM0A 1F0XA 2MGZA 1KTVA 3HI9A 4ENOA 4WFBQ 3UWTA 3GE9A 3AQOA 4F2RA 3BPDA 2D9PA 2IA0A 4RNMA 4MKYA 1HNVA 3HSGA 1Z2LA 1PSDA 4PG7A 3DFEA 3HSJA 2NUUG 4ZVHA 3GIKA 4HLBA 3IWNC 4ITSA 1KLMA 1WTFA 3MDFA 6FD1A 3OSNA 3QNWB 1RWPB 1U1LA 4CH0S 3TJ8A 3G8QA 3OJSA 1YDLA 3QIDA 4ZCLA 2V8HA 3T9ZA 2RU3A 4OHZA 1S4EA 1S1UA 2RB7A 5C42B 3EDQB 2D3UA 1U6FA 1YIJS 2HWHA 3HHNB 3CULA 4LFBF 1JXEA 3JSBA 3ENQA 1PAEX 4O44B 1HNWJ 1T03A 2OEMA 1U45A 2VD3A 4DQPA 2VBYA 2QA1A 1TP7A 3F73A 2V63A 4PWDB 4OQJA 1SKRA 4KRWA 3QQCD 4ZLLA 1KVJA 3GYNA 1WG1A 4IQMA 4AXIA 1DRZA 1RYSA 2M70A 2DRDA 1M1GA 2W9CA 3VGVA 1S6QB 4LF7F 1Q81T 1OS5A 2RSQA 3EXCX 4EFAC 4Y2AA 3T1HJ 2KXNB 4CT9A 4GVBA 3VAFA 3W1YC 1H72C 2FJXA 5F8JA 2PC6A 1RTHB 3ZTPA 3GR0A 2W8KA 2E9ZA 3T6JA 2HGLA 3QLHA 2AQ4A 3AOCA 2GA7A 3H7HB 1IBMJ 3QT8A 4M5DB 1GK8A 3TO8A 5DGBA 2NXJA 2VG6B 5CYQB 3B54A 3CCTA 4MJKA 2ATLA 2DO4A 2HHHJ 3W2VA 4ZVSB 1TKTA 5KFOA 3QWPA 1D8YA 5K8NA 2RAQA 4PZVA 1B70B 4A8OA 1HYSB 3QJJA 4ER8A 9RUBA 3R3TA 5HO4A 1C4CA 3GG0A 2C2OB 1U1MA 4NLUA 3W62A 4NLOA 2HK2A 1V5VA 2ZOFA 4JP8A 2W8LA 1UEUA 1TMMA 3UFCX 4Q44A 4RW8B 1URRA 2XLIA 3I9V9 1G6BA 4Z2XA 4MKAA 3MFHA 1WHVA 1T3OA 1PJ6A 4NCGA 3L7UA 3MD3A 2OLWA 3NMRA 2M52A 3OR2A 3C66A 3AA8A 2JJ4D 3PRVA 4DV3J 2QLWA 2HVZA 2ZH2A 3CCZA 2HSEB 1FESA 5GAEI 4C0OC 3NGSA 2ZH6A 4DFJA 2HBYB 5CABA 2XMMA 3AAWB 4CLFA 3ZZ0A 4ICLA 2ACMA 1TKXA 4OI3A 3JSYA 2HQ3A 1LXNA 4IFVA 4FF1A 1FJ7A 4MKBA 1H0HB 1Y00A 3WIUA 5B0EA 4X62F 1NJIT 1L3SA 2KZMA 3KDOA 2XNQA 4USJC 3CJKB 4CLKA 3ENVA 1Q1KA 1S1VA 2VG5B 3KK2A 2MQPA 3VVTA 1VQSA 5I42A 2DNOA 2J9CA 2IVMA 1T3NA 4O3QA 1K73T 1KQKA 3P5TL 3M6UA 2LA6A 4AL5A 2C2NA 2J6UA 5AE1A 1F5AA 2HHSA 3S01A 4LF9J 4ZVEA 5KOWA 2ZZMA 2HGMA 3Q24A 3GSIA 3V6DA 3UNYA 2ZNZA 4IH5A 3PV8A 3H42A 5F0WA 3VWSA 3C16A 3OFEA 3DGPA 2V2KA 2PGCA 2X1FA 5AXLA 1WELA 2GZOA 1SI9A 4E8UA 2V4RA 3WIVA 2JFKA 1XNQJ 4HEA9 4K4WA 7FDRA 2V94A 1N48A 4PR6A 2LQ5A 1TL7B 1M5OC 5J2QA 2Z0GA 2YQ3A 2UU9F 3F41A 4YN3B 2GQ2A 3MURP 4NPOA 2QYCA 3BF4A 4ATNA 3IMQJ 3QIPB 2A10A 3FMWA 2AKWB 1H2UX 3A1YG 4RW7B 4QYZJ 1S77D 2YNGA 4B3OA 1VQ6S 2FJDB 1BMQB 1VISA 1DTTB 3FFIA 1WJ9A 3ILOA 1F9HA 4O3PA 3IBWA 3D2WA 1D9DA 3QFHA 3HVRA 2GW8A 2DGVA 2DD8S 4RPFA 1RCXB 1CSJA 2MB0B 4FPIA 4Q8EA 4P9SA 4CLLA 4NXNJ 4UF4A 2VONA 1KHVA 4NE9C 2QGFB 1L5UA 2CADA 1IVZA 3G2XA 1A9NB 4E98A 5C24B 1YG0A 4M8LA 1UPPA 3PNIA 3QSIA 3JTPA 1SV5A 2BJ1A 2YH1A 3NAHA 3EE3A 2KRBA 2XQCA 1FX4A 5DDRC 3NNHA 2MHNA 4KHPF 3M30A 3Q8QB 3I4PA 4I6YA 4F4AA 3U1MA 2YVSA 1Y7PA 3K89A 5F3TA 3VF0B 1SJQA 4LSLA 1IJEB 3GJRB 1RWXB 2CG4A 2R7VA 1KBRA 4O3RA 3MPYA 1G1XA 2DPIA 1RQ0A 3TRGA 1N5QA 1JLCA 5KG0A 5DDPC 2MKCA 2YXLA 4DF8A 3MM5A 5B0GA 2BOAA 5L8RC 4ZCIA 4P2XA 1WG4A 1H74A 3TAMB 1RT5B 3SCLE 2AD9A 4RW6B 1X5PA 3QZ8A 4WFXA 5DG7A 2DY9A 3KK1A 4F3MA 2RHQB 4MK8A 1HQEB 5DG8A 3IGVA 2M5YA 3OVSA 3C6UA 1SJ3P 3SI8A 1JJHA 1SB6A 4DL0C 5F41A 1F5BA 1M5HA 1C0TA 4DR2J 4M5LA 4YY3J 3SCKE 4X4VA 4MIWA 2EW9A 4LIWA 1YLXA 2G0JA 4OZJA 4YDDB 4C8MA 4UY85 1NZAA 5AXNA 2GX8A 2HKEA 3TANA 3H25A 3ET6A 1YRTA 1B99A 2VOOA 1MWZA 1KQFB 4H54A 2LXFA 3W3SA 4CT8A 3NG8A 2YKQA 4C6AA 4PAAA 5AXMA 3LH2S 4J9SA 1RCOB 4BS2A 3BKFA 4WPAA 3BN4A 1WC1A 2XMTA 4WIQA 2VBXA 2F3JA 4ES2A 2Z2YB 1S1TA 4FYDA 4P6QA 3O1LA 1HNXJ 4G6VB 2BRLA 3QRRA 4LF1A 2HAIA 2OKQA 1DQ8A 4OJGA 1H3DA 2HZVA 3BYRA 3HKZD 3SFGA 2CNNB 2KT3A 4HR2A 4IG0A 2CPIA 1B64A 2HQIA 1SC4B 1NDKA 3UVJB 2DNKA 4X4RA 3DXBA 2XZTB 3DLHA 4ZPWR 1TKZB 4X65J 4HT7A 1CJTB 3AHPA 4UZCA 2ASYA 3PX6A 1FRLA 4PWUA 2R7RA 4ELVA 1Y5IB 4ED1A 4DL3A 4EUVA 2YPZA 2JLFA 2LDIA 1N33F 4KY3A 2ZUGA 3UNGC 4PKDB 4X4PA 1XQIA 1YJWS 5IQQA 3KK3A 3BN7A 2HAFA 4E0DA 2EBEA 2D3O1 2QX0A 1Q8IA 5KFAA 1JKHB 3MPUB 3JYTB 2CJKA 2FVPA 5F8HA 3CDEA 5D4LA 1O6XA 2EFVA 3CJQA 5H9FJ 2M2BA 1XK8A 1WC5A 3KG1A 2EFOA 2KJVA 3I87A 2IM2A 2EFPA 1QAXA 2OD6A 2C2MB 1DFDA 2C22A 4LBPA 4L72B 1JLBB 2HLUA 3BREA 3W65A 2IAJB 2P6SA 1LFPA 1U8WA 4DS5A 3PIPQ 3LAKA 3IR6B 4IG3A 2DH7A 4LIRA 3KHGA 3A4TA 5BYRA 2ZKUA 5A76A 3DOMA 1NK5A 2CA9A 2JDJA 3KUHA 4HI2A 4JI7J 4ZHRA 1BC6A 4P7TA 4ECSA 2DRAA 4WYWA 4ZOSA 3W5XA 4FYXB 3FEYB 2V6AA 1RT6B 3CCVS 4DF4A 1VQYA 1VQNS 3OQ2A 5MLCV 4M5MA 3EZUA 3DI6B 3HDSA 5GAGU 1C0UB 1EJ7L 3I6PA 2ZH7A 1YHQS 3FEXB 2B9XA 2WONA 3KUEA 2BQUA 3L95X 5LXYA 3AY0A 2EI5A 4K0KF 4HHJA 4ED0A 1I3OB 5IT9U 3KYLA 5IZHA 3W5YA 3OTCA 3TZXA 2G2YA 3KWMA 1QE1A 4EEYA 1SQGA 2I9SA 1FWLA 5LMUF 3PX0A 2EC2A 3C15B 4OMFG 4C0BA 3CD7A 2OI2A 3R97A 5KFKA 5D77A 3MEEB 1JLEB 3NS7B 4J90A 3QO9B 2OO4A 3TA1A 4C8KA 2XGPA 1RBAA 2Z4PA 4J9UE 3TUPA 3PACA 3TOQA 1X5OA 3BM7A 4NLTA 4QWAA 2M7SA 1DLOB 2JZ5A 2CVEA 3KJNB 3NWRA 2ZKTA 3KDNA 1RKJA 3ETMA 3M2UA 2GFFA 3NY0A 4KO0A 4U8YA 4N76A 5A8RA 5J2PA 4DSLA 4WZQA 5KG2A 4DR3F 1W25A 4UTGA 5B0AA 4ZCKA 1T9VA 2OEJA 2OJ3A 3EUNA 3K7RA 2FHKA 4OYOA 4OIXA 2M8HA 4B3MF 3VR1A 2XB2D 4DUYJ 4DR5J 4Y0FA 1KONA 4J9RA 3SQGB 3BYPA 9ATCB 3P49B 2CNOB 2HYIB 3W8GA 3S1TA 4UUWA 2HBRB 4A8WA 4L76A 3LAMA 2MJNA 4FVMA 3MEDA 3HZGA 2MQOA 2HWIA 1VLYA 2LU2A 1VFJA 2HMIB 3NP5A 3VHQA 3ONQA 4L74A 2PN6A 3QMQA 4Y2IA 2H5EA 3QGPA 3MXHP 5JMNA 2DGWA 2IYIA 2V4JB 4EBDA 3QRQA 2C42A 4PG5A 4ED7A 2LQ9A 4TYBA 3MM6A 2RS8A 5A8WB 4PPDA 5A0YA 2B0GA 5IFMA 4RUCA 3UDLA 3E01A 4CLTA 1S6PB 3ITHA 5J2MB 4HDGA 2C3UA 3LWLA 3M8QA 4HACA 2AU0A 4JV5J 3GR1A 3ISZA 4DFKA 3D1QA 2LCWA 3TUJC 3CC2S 4JI0J 3IAM9 4WWSA 1HBOA 2DR5A 5HVFA 5C2CA 2RMLA 5ETNA 5D78A 4ZN3A 3FGVA 3CGIA 2FVSA 1RTIB 5B08A 1UVKA 2QA2A 1KQGB 4ES1A 2GHPA 1W26A 2HFOA 2ZVSA 2DB1A 4LF6F 4USWA 2XGQA 1S9GA 2ATCB 5HMWA 2JVOA 2VJVA 3RZAA 2W7OA 4K4SA 1Y11A 4FS1A 3FCVA 2QZ8A 1UETA 1HKAA 3EVWA 1ZAWA 4HT5A 3DRYA 4WU2A 3I0SB 2GO8A 4ZA1A 1HHSA 1WHXA 2BJ7A 1LW2A 1REVB 1MU2B 2UUTA 2VDIA 4LVNP 2F4FA 1V3SA 1WI6A 4CP5A 4WCEQ 3HT3A 3UN5A 1FRXA 4CLYA 4TU9A 1RT7B 3LF0A 4K4VA 3X1LB 2AYGA 4GKKF 2UXBJ 5F8GA 3D3BJ 1HMVA 4W98A 2B9YA 4ECRA 4CH7A 3UN2A 1YQHA 2JHEA 1UFWA 1RGVA 4BC7A 4LFAF 4EO6A 1N34J 3RYLA 3JQMA 5KFTA 5CD4A 3RW6A 4YOEA 2E1CA 4S0MA 1M5VC 4R8UB 1FKPB 4FF3A 3L3CA 1R7IA 1Q95G 2R7XA 4NLRA 2DCUB 5ETLA 2KVQE 4G1QA 3FMBA 3V81B 3X3UA 4Z7YA 1FRKA 3GTYX 2BE2A 1NRKA 2CVIA 3R6GB 2QA4S 4WFNQ 1K1QA 2HS4A 4TY8B 2MKKA 1KNZA 1NKCA 3THPA 2QTWA 4W92B 1S1XA 4WE1A 3E2EA 3FZBA 4NXMF 2HZAA 1VQ7S 2L08A 4DV5J 1H2TZ 4GMKA 2DXFA 4C9DA 1SPBP 4IRDA 4RWXA 4FDFA 3Q22A 4LRCA 2ZBIA 1HW8A 3TEHB 4NLSA 3NRBA 1O5JA 2PSZA 3IWLA 3R5AA 4JI5J 1N88A 3K57A 3AD7C 1HBUB 2KM8B 1VQLS 2G4BA 4N47A 1SJFA 4WKRA 2ZHOA 4ECXA 2YQ1A 3K8WA 1AUDA 2VOPA 4ZPBA 2V2VA 2UVWA 2JSXA 1RTJA 4YB5A 3MAQA 3KUGA 4PRFA 4O44A 1LEOA 2Q6BA 3BGLA 1C1CB 2DRBA 2UZAA 3D1OA 1ACMB 1VS3A 3SV4A 3NBPB 2MPUA 2GMJA 4DUZJ 2FB0A 2UP1A 4PWDA 2I6WA 2J7KA 3PRDA 5LM7E 3VQTA 4HHHA 2RQMA 4CO0A 2OFHX 1FEHA 3LGHA 1QVFR 3I5CA 5L1JA 4DR7J 4Y65A 1UPMB 3RBDA 5A2QU 2F8MA 2L9WA 2VB6A 4LF4F 1M90T 2J9DE 1S6QA 4QW8A 2HQDA 3DLEB 4ZVUB 4K50A 2DHHA 4ILRA 2Q66A 2MLXA 4P72A 2EXUA 2IM3A 4I64A 2PI5A 4A8YA 3PYDA 4KE5A 1RTHA 4XO0A 1JXVA 2VQEF 1GTEA 3P4UB 2BJ8A 4JYAF 4DPXA 4M5DA 2W2MP 1T9XA 2VG6A 5CYQA 4OFZA 1UFLA 2Q3PA 2RRBA 1ZYQA 3PVXA 3UDVA 2FHMA 3EX7B 2VHGA 2GS8A 2VH7A 3MGJA 1R8BA 1FXRA 1X4AA 1VQ9S 1HYSA 1NSQA 2RRNA 2QEXS 2NZ4A 3WDOA 4O0NA 3KNGA 3L09A 5LL6d 3P8BB 4CYUB 2AJ4A 2YWGA 1YBUA 1QJHA 2JEGA 4OYBA 5IOLA 1UEKA 5RUBA 4U7UK 3CD6S 4HDHA 4RW8A 5F9LA 3C19A 2HHTA 2VG7A 2H54B 4DMZA 2QLXA 1RA6A 5D4NA 1KC8T 3RAQA 3KHLA 5E41A 1H7XA 5I3QA 3QAUA 1IWGA 2G1DA 4FNIA 4XPEA 2NZCA 4H4OB 5GAHI 2OPRB 2DNHA 1RJJA 3MM7B 1T9WA 2CQPA 5F0UA 1LOUA 3BDPA 1TL5A 2QO3A 3D9BA 1HBMB 1YJRA 1RTDB 2W9BB 1B3TA 4ZVRB 3U7JA 3NOGA 3QBCA 3KNAA 1B0VA 3CJKA 4DSFA 3K5LA 2HVIA 2V2QA 3R2CJ 1FEEA 1WKKA 2V4QA 3OUYB 4P75A 4LSZB 1J2VA 1U02A 3TZWA 5DETA 4RLEA 2EFGA 3ENAA 3PX4A 3I56S 3S8SA 5KG5A 5H9EK 1IM4A 4CO4A 2CJQA 3RBXA 3G71S 1NPRA 1U26A 1DAXA 5AXKA 1SKWA 4IYQA 4V19X 4Y6IA 2ZC4A 1WWHA 4USKA 4QWDA 4NX9A 1RI7A 1IBKF 3Q8UA 2MKIA 2HFVA 1EIYB 2FVRA 2WK4A 1NJWA 3V2UC 3GIIA 1UKUA 1S5ZA 2F7VA 5F8LA 3MR7A 1VLOA 3IRXA 1YI2S 2HHUA 3V6JA 3JSMA 3ZZRA 2DXEA 2UVUA 3VAIA 3N6MA 1YVFA 2DNNA 3CJTA 1FF2A 1TL7A 4LQ9A 3H59A 1RBOB 3OL8A 2QN6B 1NKEA 3DM2A 2L9DA 2XS5A 2QL9B 4RW7A 2WVCA 2F4VJ 4NLYA 4DSJA 3WC2A 1DTTA 1VK8A 2IDLA 4UOGA 5HQ8A 2QFJA 4J9KA 1KQSR 3H2UB 1CQMA 3L7PA 3HJFA 2CZ4A 4JI3F 3AB2B 2QL5B 3K0JA 4W4MA 5HJYA 2BE7D 3AODA 3M2VA 1FCAA 1Y0HA 2LU1A 4XAKA 5C24A 4J91A 2F8EX 5GAEU 1X9WA 4P52A 1WSRA 3K2YA 1RWNB 1DJ0A 4Y28C 3M8PB 2V67A 1FK9B 1WI8A 2W7PA 2I5JA 4ED2A 3MAAB 4J9LA 2X3GA 1ZZNA 3DRXA 2WTFA 2R8HA 4OZNA 1WC4A 1HQUB 4N5SA 5LT5A 3EZ5A 5L1KA 3KJFB 1WEZA 3NAIA 3PJWA 1JLGB 2MY8A 3W66A 1MG7A 5DZ7A 1NMEB 3ZZYA 4KH1B 5EX3A 2NQPA 3TR5A 4B9NA 2FY1A 2B56A 4WP3A 4LFCF 3UPFA 4A48A 5HROB 2MZJA 4JI4J 3DLLQ 5CYJA 2DY1A 2IMWP 1UJ5A 3GG1A 3DGVA 3AXKA 1Q7YT 1D0EA 1X5SA 2CQDA 2BJEA 1X4DA 3AA9A 4AL7A 1F5CA 4ERDA 4QYRA 1W2BR 1K8AT 3TAMA 2L41A 2CQCA 4WIIA 1A0OB 4RW6A 1HBNB 2WZ1A 4USTA 1Q8KA 1FXDA 5A8KB 3RTVA 1N5SA 4ANDA 1HQEA 1U2RA 3EWGA 1T9YA 1WF1A 4DR4J 1O0PA 2BOPA 4JOUA 5G0RA 1HI0P 2RDDA 3DKDA 2HWTA 2E9TA 4F25A 1QAIA 3PDNA 2Q6CA 1PILA 3FVYA 1E6YA 1DTQB 2D9OA 3JTNA 4X62J 1EZZB 1RT4B 2OSQA 5IT0A 2R7WA 2NPFA 2IVYA 3QGGA 4C48A 2CDRB 1WDTA 4ZIVA 2MDAA 4NI2B 1RAFB 2UUBF 1BE4A 3DYAB 3LP1B 4WXOA 2KT5A 2NCKL 2OPSB 2MLYA 2ZJPQ 4WFZA 1N36F 2ZEJA 4KHRA 5KG4A 4QWCA 3IFEA 2HNDB 4ZJQA 2VC1A 3IBFB 1XWLA 5KFEA 1NK4A 2YWWA 1JLAB 1NAQA 2XSJB 1LWCA 2EPIA 1X8DA 1AB8A 3I0RB 4O3NA 4TU7A 2QMWA 3HHLA 3PEJA 3UVJA 2E1PA 4UOCA 4ZCMA 2WOMB 2AX0A 1WHWA 3CD5A 2CQ3A 5C7PA 1TKZA 5KFWA 5F3ZA 2WVEA 2N7CA 3I9ZA 4KPCA 1M5PC 4LRFA 1FKAF 1NB2A 1RT3B 4NCAA 4B3RJ 1KRPA 1T9UA 4YB6A 4TQRA 1XMOF 4OI0A 2R8KA 3Q8PB 1KEKA 4ED3A 3TJAA 4B3SJ 3DDKA 1PYTA 3POTA 2GAHC 2HGNA 3CMES 2HLTA 2MHEA 2JC0A 2Z2ZA 2RQ4A 1VRQC 5K20B 3KLFA 1VQOS 3ELHA 3CJ0A 1FKOA 2XEXA 3AQPA 1KOOA 2CPEA 1KDNA 1JKHA 3JYTA 1I94F 3KMQA 1EKSA 1CVJA 4P2MA 2RUSA 4ETZA 3HO1A 4OZLA 3MPDA 4QU6A 4J9MA 4OJ3A 1U47A 2W9AA 5DGAA 4DPOA 1RACB 2CWXA 4WU3A 3GIJA 4Q0BB 1U24A 3OL7A 1WF0A 1TMJA 2XI3A 4URQU 3MM9B 1HI1A 1JLBA 4C0HA 2O1PA 2KYXA 2VQFJ 2IAJA 1S10A 1VQ5S 4R5PA 2C3MA 2DR8A 1M1KT 2IY5B 1S72S 3MMCB 1VC0A 4IO9Q 3LGNA 1CJVB 2R8IA 3CVKA 2HHQA 3A13A 1UZDA 2VA2A 1H2VZ 1NJZA 4KTQA 4OL8A 5E0OA 1X0FA 2QLFB 1Z2ZA 5B0FA 1QD1A 1ZAXA 5E2QA 4DR6F 5GMKa 3HD2A 3FBEA 1OY6A 4TU8A 3P96A 1Q78A 3WZ0A 4XPCA 4NLXA 2HVHA 3RR8A 1RT6A 1X31C 1DBDA 1YTYA 5KFRA 4WTOB 1MMLA 2XMAA 3DI6A 1C0UA 3D0IE 5DLGA 2H4YB 2FVQA 1GMWD 2DHXA 2HBZB 1Q79A 4USUA 1LV5A 1BQNB 4WP9A 4M5NA 2W7AA 4MFBA 1OY8A 3ILIA 4L3NA 1Y5LB 3TJ9A 1S12A 1WKLA 3JSRA 2J8SA 3I32A 2GJFA 2ZDOA 3OD2A 1CJUB 4DV7J 2UUCJ 4Y2KA 2D69A 5DJBA 1X4HA 1JLEA 3FSYA 3HLUA 1VC6A 2QC3A 3QO9A 3OTDA 3RAMA 1OSDA 1TFYA 3IM8A 4QW9A 3BR9A 3OBIA 3IM9A 4CO1A 2QRRA 4RBVA 1NHUA 4XDCA 1DLOA 2A0FB 4G1IA 2MZTA 4KAIA 2A2CA 2MTLA 2C2ZB 4GC7A 3THTA 1FDDA 1I1GA 4JI8J 3GFZA 2BVZA 4QR1A 1K1SA 5L39A 2CDQA 4CO2A 1RWWB 2YX1A 4DQIA 1X4GA 3RGIA 1FE4A 3BH7B 1GMWA 1P1TA 4QBUA 3MMBB 2ZC3A 4UOFA 1ITPA 2ZZTA 1U09A 1E6VA 4U7CA 2QJ3A 1PCAA 4PABA 4EBEA 3SQGA 3HHLC 4WKYA 3CJRA 5KFQA 1TAUA 2EC0A 2FD2A 3FQLA 1N32J 2YKOA 4J7CA 1R27B 4CLWA 4DV0F 1RLCL 4DXLA 4DUTA 2HMIA 3NCQA 4USMA 1TUWA 3OXGA 3NGTA 2DPJA 1EB0A 5EHHA 2KHDA 2CJYB 2KKHA 2V4JA 2QLJB 2RS2A 2IDEA 2XLKA 4OJHA 5DS7A 2KT2A 1ZM3A 3G9CA 1FDNA 5ETQA 4RKUC 4IOCQ 5A8WA 4BLGA 2OAUA 4OHWA 1S79A 1RA7A 4GKJF 2F40A 1GXUA 1U0HB 3RB4A 4RU9A 5J2MA 3RB6A 2B5JB 2EFQA 4RJVA 1F3VA 5B7WA 1RBLA 3HKWA 4DN9A 4USHA 2BMBA 3CMAS 2DNGA 2DBBA 1Q16B 1XMBA 3H5SA 4RL1A 1GAOA 4TKTA 2F63A 4NOHA 1OMSA 1WEYA 1PC5A 1AXQA 4P7VA 5HMXA 1FJCA 1D8ZA 2FTRA 1S4FA 1RAAB 2A2DA 2KTQA 2CPDA 2IBKA 2HEKA 3QZ7A 5HBMB 3A3NB 3DN9A 2U2FA 4WXWA 4IH6A 4M63A 2W2OP 4JI6J 2FLLA 5J1EB 3TAQA 4Q8FA 2RUGA 1KR4A 4HH1A 3ZZOA 2XLJA 3R5JB 4A8QA 3MUVP 1YJ9S 2HIYA 1ZTWA 4ED8A 3CDBA 2K06A 1F9EB 3A3PB 4NLPA 1T7PA 4NCBA 3I0SA 5J2NB 3SEOA 3R7NB 2NXCA 4G65A 4U9RA 1HNWF 1FT8A 1CQNA 5F9NA 4EMDA 1KS2A 1MU2A 2XZWA 2BX6A 1IBLJ 2H65B 1HPZB 2Y1IA 2M4MA 2PE8A 1QAYA 5KAKA 1V5IB 1RT7A 1SCJB 3FBCA 3RAXA 2BJ9A 3VAJA 2HVEA 4M5IA 3MZIA 3M32B 5GMEA 2C3YA 2Y1LB 5SUHA 4MYUA 1H98A 1YRUA 3OT9A 5L9XA 4DX6A 5KFDA 3N0VA 2OUGA 3T1HF 2JRSA 5JUMA 2AV5A 4J5OA 1W2IA 1LK7A 3P3DA 1IQZA 1UMJA 4OZ2A 3VCDA 2AEMA 4OI6A 2FJWA 2CUYA 1FKPA 4KGMA 2KZZA 3K5OA 1IBMF 2F65A 4A46A 4A8FA 4F0HA 3KXDA 1IKVB 3GIRA 3NKYA 5AT1B 4EZ9A 2DITA 2HHHF 4Z7CA 4K8RA 5K14B 3R5DA 4DV2J 3OJUA 4PEOA 2HNYB 4F26A 2DO0A 2LVWA 4AQYJ 1ZA1B 2R2SA 2E29A 2AJ1A 3N28A 2IRXA 3KHHA 4X84A 1BWEA 1F1BB 1RHRB 1HI8A 2XZDB 1HR0J 1ZPWX 1N4LA 2QMUB 1U1PA 3TUIC 2W2QP 2POKA 2Z2MA 3R7SB 4FYVB 1DQAA 2V8PA 1YZ6A 1KSPA 4KJIA 4Q2LA 4DV3F 1GFWB 4IRCA 2NLWA 2PI4A 1T05B 3RBEA 3WC0A 2Y8YA 1VK3A 2MXYA 1DZ5A 2JVRA 2LP4A 1NCLA 3IP0A 3T6BA 4KC5A 2CJXB 5ETSA 3SXLA 2CZVC 2FQQB 2D1CA 3UCUP 3TVKA 3ZTQA 5LMNF 5IM0B 4FPRA 4Z37A 1C1CA 3CCES 2RJZA 3PEHA 3ILJA 2EWHA 4ZITA 5DG9A 2J7WA 2J76E 5HI7A 3HT0A 2ZBCA 4ZP7A 4F0MA 4PQUB 3CXCR 3LP0B 4LF9F 3SMZA 2M3DA 2WAQD 2DR7A 3DLKB 4XDDA 5DDQC 3DLEA 2NREA 3MF5A 4F4YA 1CJKB 1RAJA 1KLMB 4ID8A 3ZTOA 3LQVA 4WFAQ 4LF6J 1P27B 3MMAB 2Y1JA 3NL0A 2V5HG 1N6QA 1HWKA 3IC1A 4N8NA 3M6WA 1XNQF 1FRIA 4F50A 3MWBA 1JXLA 4MIBA 2JEIA 3MTJA 4LF8J 4PXCA 4QCLA 2XO6A 4DV4J 1RKIA 2B4PA 2D3OR 1VC5A 2BBEA 1U4BA 2WSFC 3D6MB 3E3XA 2RT3A 3N5BA 1Q5YA 3T3FA 2BKOA 4CYUA 2SXLA 2ZH5A 2BEFA 2CPYA 2DNQA 1FJEB 3W2WB 2GV1A 1NDLA 4NXNF 4JI1J 4NA2A 2DH9A 1BY9A 3N79A 1S9EB 3WHIA 1XIQA 3F0NA 4C97A 2JL9A 2Z2LA 1IN0A 2ADBA 1LNQA 1UTAA 3IR7B 4ETXA 1PGZA 3M8WA 1BXNA 2YX4A 2V69A 2HNZB 4H4OA 1ICEB 1FX2A 3MM7A 3J7A1 1RWUA 4YP3A 2CNKB 1RHQB 2K1RA 5KFZA 1FTRA 2HZCA 2PDAA 5CXTA 4ZP8A 2A18A 1YKWA 3T1AA 2AZ1A 2LKZA 1F6TA 3D1HA 5HMZA 3QGIA 1LW0A 4K5SA 1UZHA 2DIUA 2FJBB 2IJNA 4K4UA 4FBUA 3T5HA 1RTDA 2DEIA 1SKUB 4TLQA 3Q8VA 4C3LA 2W9BA 2RVJA 5KFLA 4FS2A 2DH8A 4M95A 3OUYA 1HLWA 2R4FA 3CNQP 3DRPA 1HA1A 4CI0B 4ED5A 3TA2A 2BE9B 5HP1B 4DFPA 3PXGa 2V9WA 1U6ZA 2ZH4A 3CCUS 4I56A 1ZM2A 2C2EA 3HSZA 3ZNUA 2UVVA 4QQBA 3OR2B 2OELA 3G6XA 3CIMA 2J0XA 3M05A 1NO8A 2D7SA 5KFJA 2RH3A 3D3CJ 3IG1B 3OFGA 1B0PA 1HFEL 2BJDA 2HHXA 5AE3A 2YWEA 3Q8SB 4DQQA 4ICLB 2ASLA 2GIQA 2E5LJ 2KXFA 4LBHA 4DR2F 4AE5A 3JAMU 4I2PB 2G13A 3BSCA 4NLGA 5G4DA 2GVZB 4YY3F 1IR2A 3GJSB 3BSOA 4UQGA 3H2LA 2E7WA 1FFSB 2FUG9 2QG9B 4MKVA 2EBGA 4EYHB 2Z58B 2H48B 3HULA 4GO7X 1JWWA 2JEFA 4ZN1A 1PBUA 4M5JA 3CB4A 3DU6A 5FDLB 2ZJQQ 3UR3C 2KM8C 3C14B 2YWFA 2WW4A 3E51A 5IC4B 4EI2A 4H4KC 2FZKB 2H1YA 3VQSA 1VJWA 1JQGA 2MSTA 3QFWA 3CJSA 1HIYA 3DU5A 1S57A 3EVOA 5ETMA 3CJ4A 3D6HB 4QWBA 4DR1J 2N3OA 4OX9J 2C28A 1HNXF 1GTHA 1X4FA 5GAHU 2RNEA 3ENWA 3M8PA 2H3EB 1FK9A 1R6VA 1NNDA 3MAAA 2OEKA 4RR5A 2XO7A 1NXIA 3IR5B 1HQUA 3U02A 3B82A 5J2QB 4BBYA 2HVDA 1Y9OA 4X65F 3S7RA 1JLGA 5FLXU 3MECB 1AZSB 3OTEA 2RRAA 2AJ0A 3MMJA 1FNMA 3EGWB 3GWCA 1VQMS 2YNGB 4B3OB 1YJNS 1WOOA 4JV2A 1WDDA 5HROA 3QSYB 3O2IA 1IKYB 4ZVPB 2G1HA 2CPJA 3VZHA 2VL1A 2KB2A 2VPWB 1AW0A 1WOSA 2Q79A 3G6YA 3FQKA 1N5YB 1H6KX 3L9ZA 3M6VA 2J6TA 4L75A 4XTTA 3FSIA 5LSLA 2MKHA 3F44A 2FYXA 1HBNA 4OLPA 1N0UA 1HW9A 1SV5B 3HZEA 4NRUA 1VYAA 2ZE2B 1LXJA 1U6BA 4WF9Q 1QSSA 2Y3YA 4B08A 2O01C 2FIUA 3J7AN 4IR9A 4C11B 4DPYA 1ZA2B 2CFXA 1A6LA 1RXOB 3MHYA 4LBIA 3PKMA 1DTQA 3PW2A 2BQRA 2FJEB 3PW5A 1RT4A 2GMLA 3J81U 3SDEB 3T5JA 4ANEA 1AFJA 3VALA 4XIUA 3OHBA 2R8GA 2P9EA 4NA1A 4YHHJ 3KG0A 3B78A 4NI2A 1D1UA 5LSOA 2JLGA 1JLCB 1X0PA 3TARA 1NDPA 2QE5A 4O3SA 3KLEA 2WSCC 3FKBA 3LP1A 1NK6A 2OPSA 3WBZA 1EQ0A 2DISA 4JI7F 3HFZB 5EX0A 4YB1P 5KT2A 1XTZA 2HNDA 1RWVB 2YWKA 2QLBB 3N6LA 5E7OB 2W01A 1NJYA 2XSJA 5ETTA 1Q53A 2GVDB 1LFWA 3AB4B 1HNZJ 1N8RT 4C98A 2R7TA 2NPIA 1GXLA 3SQOP 2AP6A 2WOMA 2QYGA 5E5NA 3R1LA 1S99A 4C8NA 2VFSA 1PYOB 2BKNA 3MM8A 2UXDJ 3W8PA 2APOA 2V8VA 1RT3A 2XS2A 1APSA 3HM9A 2IC3A 3PYFA 3MFIA 3H5YA 1RWMB 3SSQA 3ZZZA 4B3TJ 4DSEA 5L38A 1B0TA 2ABYA 3MEGA 4X66J 1S76D 3H4DA 1WD6A 1JJ4A 4IFYA 5DZ6A 1S9FA 1VJQA 2CQ2A 5DRKA 1SQFA 2JOQA 3D5MA 2JH3A 3Q86A 4X64J 4F4XA 1UW4A 3OR1B 4FXVA 4QJVA 2KRRA 2JLEA 1NB7A 3GFYA 1KN6A 3BGRA 4LF2A 4LVOP 1WUUA 4NEZA 4YUDA 4KGKA 2LEPA 2GO9A 4O4RA 4TNOA 4M5KA 5BYSA 4DZDA 3MR3A 3IGNA 5E3PA 3MM9A 4I68A 3LA0A 2HQFA 4KGVB 4NLQA 2NYIA 2FY8A 2MZSA 2J9DA 1ZOTA 1K0TA 1RISA 3MMCA 4URGA 4DUYF 4DR5F 1NUEA 3LUYA 2R42A 1R89A 1WC0A 4EK2A 1CJVA 2P9CA 2W25A 1EARA 2WRMA 2V9KA 3TX0A 5BXIA 2XCPA 4NLWA 4GO5X 1OQ6A 3GQCA 3ISND 4X4OA 2RF2A 3KK3B 1TV6B 2KFYA 2AEFA 1RAEB 3A8IA 3GJQB 4M1KA 4D3GA 1SH3A 4J9QA 1OWXA 1CC7A 4H4MB 2DGTA 2QIFA 1HARA 1EETB 5AJ3J 2CXEA 4FKXA 2C2KB 4MH8A 1OPZA 3G86A 3IRWP 1M0SA 2MKSA 3M2RB 3W5ZA 3L7OA 5IWAJ 4KV8A 3PR5B 3PTWA 2AWZA 1BQNA 4QYZK 1PKUA 4R0EA 2FZGB 1K0VA 3MCSA 1X60A 2KHCA 4JV5F 4U67Q 5LJ5Y 4PG8A 4BWMA 1T8EA 4AXJA 2KJWA 3M1VB 4NLVA 4JI0F 2UUBJ 3G82B 3PIOQ 1O8BA 2HHVA 5KFBA 4GVLA 1N36J 5KOXA 3P6YC 2GNKA 1S59A 2OFGX 5F8MA 4N8OA 4YQWA 3FCHA 5BR8J 5CA5A 5I4MA 2NXNA 4N56A 3AOAA 2Z30B 5DLFA 5J1NA 4X4TA 1Q0NA 1RAIB 5CAAA 1Q8BA 4DWIA 1HWIA 1V6HA 2GAGC 1VRTB 4QR2A 2OPQB 1KLNA 2XHCA 2ILYA 4KFBB 1RSCA 1U48A 2CPFA 3PW4A 3CO9A 2B8PA 3ZZTA 3AD9C 1WTBA 4P71A 1C1BB 2FLPA 2J0QD 2ZWPA 4W90B 3MMBA 4DL6A 5CHCB 3GV8B 1QE1B 1FVQA 2E44A 2EEYA 3PHEA 5K8PA 2UXBF 3SCIE 3MPVA 4C7QA 3DOLB 1J5EJ 1UWBB 3M8SA 1X9MA 1UA0A 3TW0A 4ZJLA 4C2MA 2E9RX 2X1GA 5ETOA 2P9GA 1Y4ZB 1N34F 3D67A 2C2RA 3LOUA 1MW7A 2UV8A 2AT1B 2CPHA 1FA0A 1GX5A 1H38A 2YKMB 1F2GA 4KO0B 2Y0SD 4LF5J 1SJ1A 4I6AA 4ID5B 8AT1B 1UW9A 1U0HA 2MKJA 4DQRA 1S1WB 2QSFA 1SXLA 1UJ4A 4USIA 2VZ9A 2B5JA 2HQCA 4OZ1A 3J7ZT 1XR7A 4CTAB 1T02A 4EU0A 4DV5F 2DHGA 2RE1A 2CG8A 4Q43A 4ZVQB 5IT9Y 1RAGB 3MEDB 2KXHA 4R25A 1KTQA 2BW2A 3MR5A 3K17A 1NK8A 2LQBA 3SZ2A 5HBMA 4DZ6A 4DG1B 4MYTA 1V9OA 4QPTA 4JI5F 3VTIA 4M94A 2UUAJ 3A8KA 4UUXA 3AFGA 1GXTA 2K7JA 4MIAA 5F8NA 5HK4A 2FC9A 2K7KA 3OV7A 4P2SA 2N82B 3NCRA 4F3QA 4OV6A 3MR6A 2PMWA 2AZ3A 2DKOB 1RABB 5CZXA 2CQ4A 4OI1A 1UVLA 4DUZF 4FVCA 1BQXA 2GIRA 2K3IA 3O3LA 3HSDA 3ZZUA 4F4KA 2YQ0A 5BYQA 4I2QB 1TZ0A 1UFKA 1PAUB 3M32A 4DR7F 2O5DA 5D4PA 2F9DA 2BKPA 4DOZA 4NL5A 3E8OA 1UVMA 4GC6A 3MCOA 1NKBA 1T11A 1T9TA 3CJ5A 4ES3A 3G87A 2AW0A 2GHVC 3R5CA 3H5XA 5KFXA 2H5JB 3TNVA 4J9NA 1LK5A 2HIQA 3HHDA 2LXUA 3J80U 4KGXB 3QJLA 3B6BA 2X7IA 4I67A 2R7OA 3EGNA 5BJRA 2YBVA 1TELA 1TUGB 2LQJA 2RDIA 4L3KA 5GMDA 1WHYA 4WJBA 1S0OA 1TR0A 3IS9A 2IA6A 5K14A 2B8QA 1LW2B 3CW2C 1TUVA 2HNYA 5HANA 4X2BA 1S6OA 1LWFB 4Y2CA 1WF2A 2F9JA 5DO2A 3BS9A 4C8YA 4PXDA 3DDNA 4AYBD 2KO1A 5C25B 2ZBQA 2J5AA 2ILZA 3K5PA 3M7VA 2OMOA 2VUGA 1SJ4P 5HMYA 2F8HA 4YDXA 1HHQA 3NGRA 1HWUA 2ZHAA 1XNRJ 3MTKA 3T1YJ 2AYMA 2E5IA 3US5A 3CTRA 2XHWA 2DHAA 1ZH5A 1J5OB 4L6V3 4KIAA 1EX8A 3T9NA 2CPZA 1T05A 1N5TA 3OLBA 5HVHA 3TI0A 3AXMA 4G1QB 4IUFA 2QV6A 3IAS9 3K59A 1HQ2A 1P6TA 3KLVA 8RUCA 4U6PA 4DPWA 1FRHA 5EWEA 1FRMA 4DPTA 1XMQJ 1TL3A 1NH8A 3EM1A 5E33A 5IM0A 4HTIA 1F3FA 3BEGB 3FBFA 3PG9A 4P2FA 3I96A 1YZ7A 2NS1B 5D15A 4N77A 5LXRA 4X4SA 4DSKA 3FJ2A 2FHJD 1RHUB 5FJ4A 1YSJA 1WOPA 1FDBA 4V19J 4PQUA 3LP0A 3NGDA 3ZTRA 3DLKA 2YKNB 4DV6J 3KJVB 4K2JA 1F9FA 2EFNA 5CH7B 3I5BA 2ZHBA 2WBMA 1CJKA 2VC0A 1MROB 2ROEA 2ZOMA 2MZRA 4Q45A 4KPYA 3O6QA 3MMAA 5KFHA 5FIIA 4RBTA 4NA3A 1YRXA 5HAOA 5KFNA 3ICLA 4EO8A 1R31A 3OTBA 2E7VA 1FJGJ 3CJ8A 2NSBA 1R0AB 1H73A 4UZBA 1RTJB 4TVAB 2UXCJ 4DCPB 1T0TV 3BO4A 4C8ZA 5DQIA 2HQGA 2O3DA 2XS7A 3HFVA 3M6XA 2JEJA 2BJ3A 2OP5A 5IV4A 2F4VF 1IWAA 1PBAA 3G8SA 2Y8WA 5M2PA 3K5MA 4LR8A 3P5BP 3C6TB 2W2PP 1G7CB 3BSAA 3W64A 2ZITA 2D41A 3CDWA 3BBCA 1L3KA 1HWLA 1DARA 2FHJA 2KI2A 3W2WA 3WX8A 5DDOC 1B4SA 3NCPA 3V4MA 1P8GA 3BSNA 1CLFA 2HRUA 1S9EA 3NNAA 1Q7LB 1SIZA 2R7UA 4OV1A 2IM1A 3EGVA 2AF6A 5JJBA 1D09B 1FO1A 4MTPA 3QYYA 5KT7A 1S97A 4JI2J 5C5JA 2HNZA 1S0NA 3QT7A 2WB1D 2E5JA 4G3IA 3FNNA 3HCXA 2F1FA 1YK9A 3ZFVA 3AJDA 1NDCA 4JB8B 2ZH3A 2UUWA 2J6SA 5DQGA 2AHOB 1XC9A 3UR0A 1SC3B 4F4ZA 2AIRB 2E1AA 3GYGA 3EMTA 1JX4A 3VGTA 4RBUA 1NBEB 4OI2A 2PIIA 3JXOA 4PYDA 5IT4A 2BABA 3W60A 1TK5A 3A8JA 3M8YA 3GIMA 1S0MA 4JI4F 5L46A 3KTQA 2PD1A 1X5TA 1XR6A 4RNNA 1TKDA 4I69A 3UW1A 3DNCA 4DI6A 5HP1A 3GZ7A 1RLDA 1U2FA 2LYVA 3GB0A 2ALZA 3H4BA 2H5IB 2W24A 2E1MC 4ZLNA 4TQSA 2VG7B 3BBBA 4UT4A 3UCZP 2VPZB 1RADB 4YS2A 4IDKB 4EWTA 5HVGA 8ATCB 1R8HA 4PYAA 5C42A 3GCXP 1QUPA 3R5BA 2YY3A 1NSKL 3FC9A 4DR4F 4RW4B 5A2QY 3IG1A 1JLFB 3IO1A 4PPZA 5IV3A 4JBCA 1ZM9A 4I2PA 2GVZA 5L1IA 3I31A 3UQSA 3DOKB 2GC8A 5LMNJ 3HD1A 4N7TA 2BDPA 5HL7Q 4QIGA 4GRSA 5T14A 2C3OA 5M2UA 3V5RA 2ZM6J 3OXLA 2X51A 1BHNA 5FDLA 3LPEA 3CCMS 2HHWA 3C14A 1FDAA 5KFFA 1KWMA 1EKRA 4K5RA 2F5GA 2PA8D 4CLSA 1OIAA 1TQLA 1FVSA 4TY9A 4DLGA 3M4XA 2ERRA 3FRYA 4K59A 2DEJA 1JJ2R 1YGYA 4NYZA 3EVMA 2XG8A 1SL1A 4B9MA 2GCFA 3C46A 1QY7A 2ASDA 3RR7A 2D3ZA 1RHMB 1JLQB 3ETOA 4ZVFA 4DV1J 3IRXB 1GH8A 3DRRB 3JSMB 4USVA 4QZVB 2BUNA 1ZETA 2P2CB 4ED6A 2B4VA 3RB3A 3Q89A 4OYXA 3MECA 1AZSA 3DM2B 4LSNB 1BQMB 3ZNJ1 4B3RF 3C3LA 4J9VA 1N56A 1R8PA 1SC6A 2BZ2A 1VRUB 2YNIB 3PCOB 4Y3CA 2VKZG 1HHTP 2WVDA 1IKYA 4CO3A 4B3SF 2R9LA 2J7UA 3PFEA 1OSCA 3NGKA 4OI4A 3D54A 2RHSB 3SBMA 5AE2A 3KG4A 2VF3A 3TZZA 3I55S 1FHTA 2OIHA 1N5YA 2KG1A 2DXDA 5D6GA 2IRYA 4EYIB 3MOJB 5L1LA 3M2VB 2W2NP 1GMUA 5CYMB 4KQZA 1RT1B 1L3TA 4KKOB 2HFNA 4UOHA 2ZE2A 2XWYA 2W4DA 1MLAA 3KFWX 4C3KA 2I5JB 3EXYA 5I3UB 2I2YA 2VG5A 2XYHB 3ZZPA 4C11A 3FCWA 3BQ1A 2XMWA 3KLHB 2VA3A 1NK7A 2VQFF 4FXWA 3CE8A 4NWBA 1Y5NB 2NUHA 4J37A 2ZOGA 4I0WA 3SDEA 2K8GA 2MQMA 1DHMA 5E3RA 2E7XA 3Q8YA 2VBZA 3U1LA 1JMTA 1FRJA 5GADU 1CC8A 3HVAA 2Q43A 3GONA 1CG2A 3M9MB 2B6AB 3SV3A 3KOAA 3CPWR 2KU7A 4PXEA 5KG3A 1R8AA 2KL8A 2ALYB 2CJBA 4RU2A 1RE1B 2GVDA 4DL2A 2XY6A 4FXDA 4LFBJ 1W7WA 1MN9A 2XM3A 2G2OA 5G0RB 3QIPA 3NGUA 1GX6A 2VIHA 2D74B 1Z4UA 1CPZA 2CPXA 1E6YB 1WNEA 2PMZD 4ECZA 2IYGA 3HHKA 3CCRS 1NEEA 3FDSA 2DGUA 1RT2B 2BANB 3DLGB 5D3GB 4IH7A 3NXZA 4QIFA 3CD0A 4LF7J 2CKWA 2AJ2A 3SIPB 6AT1B 4YR0A 3ZC4A 1H7WA 4ELTA 2HRYA 3MI7X 4A8MP 4LRBA 2R7QA 4DV7F 4CRJA 2UUCF 2DNYA 2ZH8A 1UA1A 5CQGA 2RQKA 2DTJA 2EG2A 1QTNB 2LQ8A 2J9EA 4ZMMA 2YNHB 4ZDNA 2YPYA 5JVHQ 1D9AA 1PYSB 3OR1A 3HP6A 3EPIA 1LWCB 4PWWA 3VVUA 1GQEA 1QTMA 3UDEA 2W1BA 1IXKA 3CCSS 1VDHA 5EUHA 2UVRA 5CZVA 3QAEA 1D9FA 3HHLB 4JI8F 4URSA 3BKUA 2DR6A 2VDHA 2LEAA 3D66A 1QDUB 2WCXA 3PJXA 1S0VA 1BGXT 4CIOA 3M9OB 1P1LA 2KYZA 2Z56B 2V8DA 5CCLA 4ECYA 4CCHA 1C4AA 2XYGB 3OFHA 1HD0A 1NK9A 4ZK7M 3SSSA 5KFPA 3N01A 3I5AA 2MKYA 1RT5A 1M1HA 4NZ7A 3KJQB 4NEYA 2M8DB 1GEHA 3POTB 2N7YA 2RKIB 4I7FB 1N32F 4OJ1A 3GP9A 3DC2A 1TV6A 5LJ3Y 1WACA 2ZVIA 3KLFB 1FKOB 2H4WB 1HNIB 1U49A 2WBRA 4H4MA 2R8JA 2HFZA 3D7SB 1WC3A 2QMXA 4NYPA 1EETA 1RWOB 1RP5A 4N41A 4RUAA 1C2PA 2MSSA 4Q5VA 2BM1A 5KFMA 5HJXA 2LDYA 5D8HB 3D0GE 2DJWA 2BXJA 2JWNA 3HMJG 1JB0C 3BQ0A 2YKAA 4X4QA 3M2RA 2C1EB 3DMJB 1RAOA 4PQAA 1R6YA 3LO3A 4R5PB 3J7YI 1F60B 2OPPB 5B09A 3BV8A 2OTJS 1VBYA 1EP4B 2R2RA 1KVKA 2FPHX 4O4GB 1Q4RA 2K2PA 1IKXB 3B8HA 4WFYA 1N52B 1I51B 3TVZA 4ZS6A 1U1NA 3M1VA 5ETKA 1RZMA 1NSPA 2W4CA 4FP9A 1RK8A 1YJTA 4EZ6A 3G82A 4LQ3A 1SVDA 2PFFB 4LR9A 1OQ3A 4KH0B 3HF5A 3R8YA 1NU4A 2GGPB 3QT6A 3LPYA 4WK1A 5K8MA 3FUYA 5THWA 1FTCA 3ZTSA 5H1SV 2ZH9A 4JI6F 2MQLA 2UU9J 4RNFA 4OZ5A 2FGCA 3WX4A 2DNZA 1CJTA 2VPXB 1SUQB 1VRTA 2OPQA 4XK8C 2BR0A 4ANCA 1IR1A 1VI7A 4KFBA 5A6WA 4ILMA 4DQSA 1XR5A 2ZBPA 5KFSA 3ZXWA 4RWWA 4MFBB 4YMEA 3AT1B 2FLOA 1IBLF 1C1BA 5K5MA 1RYRA 3BH6B 4F8RA 3MD1A 4OYIA 4UW2A 4ELUA 5T7LB 4JV0A 4NMLA 2V8GA 3MCNA 3RU0A 2MYFA 3LANA 1WKJA 3DCAA 3EJMA 3DOLA 1UWBA 1U25A 2ZD1B 3H5UA 4ALZA 1S7IA 3B4DA 5K8OA 2NSCA 4DL7A 3PW7A 3DRSB 4F0KA 4BDPA 1MMDA 5EN1A 4KHPJ 3BO2A 2ZWOA 2XY5A 2E5HA 4JV1A 1WSVA 3PZPA 2FJAB 2YKMA 2AMCB 4ZP9A 2H9ZA 4NASA 4U96A 4BCAA 3GYXB 1Q8LA 2E5GA 1F2HA 1Y3KA 2DNRA 4PUOB 2MMYA 3TQEA 4DV2F 4ID5A 2ACYA 2Z57B 1S1WA 1YBAA 4IQXA 3MOZA 2BW7A 2HBQB 4AQYF 3J81j 4EGLA 4I6WA 4CTAA 1E6VB 1YX2A 2C2DA 2BQ3A 1HR0F 3V4IB 1ELOA 4MAKA 4DU7A 3CT9A 2X1BA 1U1QA 4J9OA 4B9TA 4B17A 3P45B 4HHUA 3VGUA 2B4UA 4WK3A 2L3MA 2IVFB 4CO5A 4HI1A 2EK6A 4DG1A 3PY8A 2AGPA 5D0RA 4IOBA 3GV5B 1GT8A 2M9KA 3U27A 2XMKA 2YNFB 3SYZA 4KHMA 3QPIA 1S48A 2OHDA 5LOQA 1OO0B 2I38A 1RU1A 3C15A 5DM6Q 1NHKL 5L9NA 2GQCA 3TAPA 3Q2SC 2MEWA 3HVTB 1T95A 3MEEA 2G0IA 2R7SA 2OMLA 1N54B 2MY7A 4I2QA 1FD2A 4FF4A 3Q23A 3THVA 1B7YB 3NS5A 4LRAA 4Y2MA 3RW7A 1TVRB 2K3KA 4O23A 2AJQA 1FNOA 4ECUA 2QT7A 4FYYB 3V6KA 1QAJA 4QOTA 1KVIA 5KFVA 3LP2B 1VQ4S 5HATA 3L4BC 3CCLS 4RUBA 4Y00A 4CNYA 3MPWA 2IFXA 1FFWB 3SSRA 1BWVA 3OW2R 1ZAVA 4Y34A 3MUTP 2BYCA 3RB0A 4LF8F 1P9QC 3CIZA 4DV4F 2E66A 1N33J 4QIWD 2JC1A 3G6VA 2AGOA 1S49A 1LWFA 2N4DA 3K58A 3CDAA 3GFXA 5FD1A 3A3OB 3BQ2A 1R3NA 1GNKA 3M8RA 5C25A 3RG6A 5KFIA 4K4YA 4ZIWA 1K9MT 3OTOF 4JI1F 4LT6A 3QT5A 3NOCA 4A8KA 4ZPAA 1PO6A
chains in the Genus database with same CATH topology
5HROB 2MZJA 1HL6A 1DQ9A 3ENQA 4O44B 1O8BA 1T03A 3DLLQ 5B0DA 3PM9A 2HHVA 1J5OA 5KFBA 1U45A 2VD3A 3QGHA 5CYJA 3CCJS 5KOXA 4DQPA 2VBYA 1NH7A 2QA1A 2IMWP 1UJ5A 1TP7A 3F73A 3P6YC 3GG1A 4PWDB 1S6PA 2VASA 3BB5A 1VQKS 2GNKA 3LGMA 4OQJA 4DSIA 2OFGX 1Q7YT 5F8MA 1D0EA 4N8OA 1X5SA 1SKRA 4YQWA 4KRWA 4DLEA 2CQDA 3FCHA 1VQPS 3RRGA 4IRKA 5CA5A 1KVJA 3GYNA 1WG1A 1X4DA 2BJEA 3AA9A 1U1KA 4IQMA 3LW5C 5I4MA 4N56A 1F5CA 4AL7A 1X9SA 4ERDA 4QIVA 2J0SD 4QYRA 1W2BR 5DLFA 3TAMA 5J1NA 1K8AT 4X4TA 2L41A 4AXIA 2CQCA 1Q8BA 4WIIA 2OTLS 1DRZA 4DWIA 4RW6A 1RYSA 2M70A 1HWIA 2XBPA 4RW9B 1HBNB 1V6HA 5M2RA 3U1NA 1VRTB 2W9CA 1TK8A 1FXDA 4QR2A 2OPQB 1S6QB 1KLNA 3T19A 5A8KB 4LF7F 1LWEB 3RTVA 1Q81T 2ILYA 1IKWB 1N5SA 4KFBB 5HLFB 1OS5A 2RSQA 4FZVA 1HQEA 1U2RA 1U48A 3EXCX 2CPFA 1OPIA 4EFAC 4QWEA 4Y2AA 3CDUA 2KXNB 4CT9A 2OSRA 1WF1A 3UD3P 1TL1B 3VAFA 1O0PA 4C3MA 4PXBA 1FE0A 3OFFA 4JOUA 2BOPA 3EYZA 3PW4A 5G0RA 1HI0P 1I6JA 3CO9A 3ZZTA 2FJXA 1LKZA 5F8JA 2HWTA 2PC6A 2E9TA 1RTIA 1WTBA 2JX2A 1RTHB 4F25A 1QAIA 3PDNA 4YFUA 3KLIB 3RRKA 5KG1A 3GR0A 2W8KA 2E9ZA 1C1BB 3CEDA 2HGLA 3T6JA 3QLHA 1FERA 2FLPA 2AQ4A 2Q6CA 1PILA 2J0QD 3FVYA 2GA7A 1E6YA 4WZMA 4W90B 4M5DB 3MMBA 4DL6A 3TO8A 5DGBA 1DTQB 2D9OA 3JTNA 4OZ0A 5CHCB 3GV8B 3LALA 1QE1B 1KFDA 2VG6B 5CYQB 1RT4B 1FVQA 2E44A 2OSQA 2A1BA 5IT0A 3CCTA 3PHEA 2DGXA 4MJKA 2R7WA 5K8PA 2NPFA 2DO4A 2ATLA 3GMGA 2UXBF 2YKNA 2PT0A 1KFSA 2IVYA 3QGGA 3KJVA 3SCIE 3MPVA 3W2VA 4C7QA 3DOLB 5KTQA 1TKTA 1UWBB 5KFOA 3M8SA 1X9MA 3QWPA 2MDAA 1UA0A 3TW0A 1MROA 1D8YA 5K8NA 4C2MA 4A8OA 1HYSB 1ZPVA 3G6ES 2X1GA 2E9RX 3QJJA 2UUBF 2P9GA 1Y4ZB 3DYAB 1U8SA 1N34F 3R3TA 3V6HA 5HO4A 2RU9A 4F4WA 3LP1B 4WXOA 2W4PA 1C4CA 3GG0A 2KT5A 1U1MA 4NLUA 2OPSB 2ZJPQ 1KD1T 2C2RA 3LOUA 4WFZA 1N36F 4NLOA 1REVA 4KHRA 1MW7A 2UV8A 5KG4A 1YWXA 2E5LF 4QWCA 2CPHA 2ZOFA 2W8LA 1FA0A 3IFEA 1UEUA 3CC7S 1GX5A 2HNDB