4NCYA

In situ trypsin crystallized on a mitegen micromesh with imidazole ligand
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Hitting the target: fragment screening with acoustic in situ co-crystallization of proteins plus fragment libraries on pin-mounted data-collection micromeshes.
pubmed doi rcsb
molecule tags Hydrolase
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2013-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ncyA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ncyA02
2VNTA 4NCYA 4FXGH 1E34B 1O2ZA 2BD8A 5DP6A 2ILNA 2ZHWH 4NA8A 1C5SA 2B5TB 3RXGA 1TRNA 3PLBA 2FEQH 3FAOA 1N6XA 2OQUA 1S0RA 3M61U 1KTTB 1IQLA 1O3JA 1ELAA 1TRMA 2Y5HA 1FMGA 2ZFPH 4ZXXH 3BEUA 3V3MA 1A3EH 1IQIA 1HJAC 2AS9A 1O3OA 1GBAA 3A87A 8GCHF 3SQEE 1KIGH 1OSSA 2G4UA 1J16A 4KGAA 1V2TT 2VIDA 2PKAB 2VJ1A 4O3TA 3TNSA 1BRAA 1UTLM 1V2QT 4BAMB 3ATIA 1LHDH 4LXBH 1TBZH 1K1NA 4GSOA 1C9PA 1Y59T 3GY4A 1MTUA 2Z7FE 4MNYA 2J34A 3M7QA 2GV6A 1ARCA 2Z94A 3IITA 2Z9JA 1ABJH 1QBVH 4VGCC 3TITA 1XXFA 1SGTA 2B8OH 5C1XA 3EE0B 2ZGJA 3O8RA 4ZUHA 4DY7B 4SGBE 2C3SA 1CT2E 2FYRA 1QL9A 4BTTB 3TLOA 4XOJA 1P8VC 4ZHMU 3ZZBA 3A8DA 2R2MB 3QWCH 5CHAB 5DKMA 1ZHMA 1T8MA 1O0DH 3URDA 1MUEB 5JBCS 5A0AE 1FLEE 2H9TH 1F5LA 8LPRA 2XC4A 1TOMH 2ZF0H 3SJ9A 4UFFH 1GMDG 2ODPA 1C2FA 2A7JA 1PPFE 4B1TA 3LIWA 1O5DH 2G5NA 1O3MA 4X8VH 1B0EA 1LVYA 2Y5FA 4X1RU 2B9LA 3QGNB 1F7ZA 2RG3A 3T29A 5DJ7A 3O8CA 4JZEH 3M35A 2A2QH 2HOBA 1EASA 6CHAC 3E3TA 3RM0H 1GMCF 4CBNA 2WPHS 3M3VA 2QXHA 5DG6A 4U30A 1GBKA 2BXTH 3B9FH 4OS1A 1NY22 1CT4E 5IYTA 1XUFA 3A8BA 1AHTH 3E16B 5E2OA 3U8RH 4AOQA 1UTPA 1IQGA 2Q6DA 9LPRA 4INKA 4MQAA 1GI9B 2FLBH 1F5KU 5G4BA 1MH0A 4X6PA 2HNTC 2TPIZ 2ZO3H 3LH3A 1F5RA 1GHYH 5T6DA 2HPPH 3RM2H 1BIOA 3A86A 1CVWH 3SI3H 2PHBA 4SGAE 1B7XB 5EPNA 3MU4A 1OP2A 2K1QA 5FPSA 4R0IA 5JBBS 4ZMAH 3TPIZ 2BD7A 1QJ6B 1BCUH 1ELGA 1V2MT 5BRRE 2SGAA 3PMAB 3CS0A 2GT7A 3UIRA 2Y7ZA 1MBQA 1ZLRA 3UOUA 3A89A 1BMNH 5HM9A 1AO5A 4ZKNU 4FUEA 3TJNA 2JETC 1KXBA 1VGCB 4ABJA 3ELAH 3LGWA 1YCPM 2CF9H 3A7VA 2FS8A 2TBSA 2CF8H 4ISNA 3RXRA 3VXEH 1QJ1B 3BIVH 2AIPA 3EA9A 1XUIA 3D23A 1VCPA 2OP9A 1GHWH 1UVSH 1LVOA 2ZDLA 3NK8A 1QBOA 3GY3A 1SHHB 2OLGA 3U69H 1NU9A 1EZXC 3SU0A 3UNSA 2V35A 2CMYA 4H6TA 5HGGA 1GBTA 1SGDE 1SMFE 3E6PH 7GCHG 2ANKH 2GMTB 2ULLA 2UUKB 5FBIA 2AMPA 4I8KA 1ZPBA 4MPVA 1TLDA 2F9NA 2NU0E 1YLDA 2W5EA 2O8WA 1GI1A 2G00A 1SLWB 4O97A 1PYTC 3BG4B 4ISIH 3ZV9A 4WY3A 5LH8A 1P05A 3W94A 1OYTH 1OWDA 1GDUA 1JRTA 3HKJB 2VH6A 2H5DA 1A5HA 1UTJA 2EI8A 3SI4H 2BLWA 2ANWA 2R0LA 3OX7U 3TGIE 1AE8H 2QIQA 3LC3A 3ZYEA 2H9EH 2KAIB 5A0BA 4A6LA 1VJ9U 2ZZUH 1PPZA 3HATH 3EA7A 1TRYA 1O2NA 4Y8ZA 4H4FA 2WUCA 2NU2E 1QA0A 1UTMA 3MTYA 1WYKA 4E7RG 1S81A 3GY8A 3D62A 1O3IA 1SGIB 1V6DA 3MU0A 4FVBA 4Y0YE 2HALA 5C67A 2FZZA 1LKBA 2H2ZA 1D4PB 3A85A 1BDAA 1KTSB 1C5LH 1Z1JA 3TH3H 2AMDA 3MMGA 1P2JA 1FNIA 2Y82A 2OQ5A 1GHBF 3GCNA 1C5TA 3NZIA 1GBMA 1ZSJA 1OP8A 1FPCH 1C5QA 3URCA 1EZUC 1V2NT 3PWBA 1O2VA 1L2EA 1O2PA 1HJ8A 1PQ5A 2GDDA 2CHAB 2OC7A 4NIYA 1TAWA 5L6NH 1MU6B 2A4QA 1GVKB 2GP9B 2XC0A 1AIXH 4ZAEA 2ZHQH 1KXAA 2EEKA 1L1GA 3IWMA 1QY6A 3LGVA 1GJ8B 2ZU5A 1O2IA 2PTCE 1BTHH 1MBMA 3UNRA 3M5LA 2BDYA 2O8LA 3MNBA 3UR9A 1C5RA 3A8CA 4M7GA 1ZTLA 3FZZA 4LZ1H 5A2MH 1H9LB 1SBWA 3MYWA 1FN8A 1CA0C 2A2XH 1JIRA 3ATWA 5ESBA 1P2MA 1GDNA 1NTPA 1YPJH 1JBUH 1EB2A 1C1VH 3M3TA 2BQWB 3PWCA 5EG4A 3SV7A 3ZYDA 2Z6BD 1C2KA 2PLXA 2AERH 2QGRA 1FDPA 1EZQA 1KXDA 1PPCE 5E0GA 4AGJA 1DLKB 1OPHB 1WV7H 2FP7B 3RXSA 5PTPA 2A5IA 1A0JA 2GD4B 2W3IA 3OY5U 5ABWA 3SN8A 1LTOA 2UWPA 2FOEA 3EQ0H 4UD9H 1SGNE 1KY9A 4X1NU 2BY9X 1Z8RA 4YESB 1ELVA 4Y6DA 1ZPCA 1QR3E 2ALVA 1EP5A 2R3YA 1SFIA 2ZGXH 3PMHB 1TPSA 4KP0A 4DOQA 3SNDA 3B8JA 5F8TA 1PJPA 1O2OA 1E38B 3MU8A 1SGFG 2PR3A 2Z3DA 4B71A 1DPOA 3Q3YA 3AAUA 4DGJA 1JIMA 1PPBH 1EPTC 1Z7KA 7GCHF 4E05H 4AFQA 4J1YA 4IMZA 4X2YA 3RU4T 4ZXYH 4K1EA 2PSXA 5FCRA 5TCAA 2VVCA 4TWYA 1P9UA 1DWEH 2ANYA 3EAJA 3IG6B 2CN0H 5EPYA 1O5FH 5SGAE 1LPKB 2W3KA 3JZ2B 1G2LA 5AFZH 2TGPZ 4BANB 3QLPH 1F0SA 2BY8X 1HAPH 2ZFQH 4CH8B 1HAVB 1Z8IB 3GYMA 4Q2KA 4O03A 4JYTA 1CGJE 1O3DA 2JKHA 1O5GH 2TGTA 2SNVA 1DFPA 4ZKOU 1GBBA 1BITA 1O2YA 1NM6A 3FFGA 2ZKSA 4K3JA 2ZGHA 1UTKA 3OTJE 1J14A 2XWBI 1UK2A 3SJIA 4MVNA 2RA0A 1MD7A 1THRH 2FOAA 1DSTA 3TJOA 4X8TH 1INCA 4X6MA 3EDXB 1SQTA 1MTSA 5K7RA 1P09A 4Y8YA 1GHVH 4NZQA 4Y7BA 1MTVA 1TNIA 5GDSH 3RXIA 5CHAC 3P8FA 4A1VA 5GJ4B 1Y3XA 1P57B 1DSUA 2FDAA 1WTHD 4ABAA 1QRZA 3ENSB 1WAYB 4OGYA 1V3XA 1F0TA 1O38A 6LPRA 7KMEH 4BAHB 1A1RA 1ELBA 8ESTE 5ESTE 2NWNA 1O2WA 3EA8A 1QURH 1YPEH 1N1LA 4TPIZ 1ZJDA 1AFQC 1FUJA 3HK3B 3RU4E 2D1JA 2JH6D 3QDZB 1O31A 1A3BH 1L4DA 1LHEH 3MI4A 3GCOA 1PQ7A 4AB8A 2Z9KA 4A5TS 4THNH 3VB3A 1AY6H 1EOLA 2BDCA 1OWKA 1W11U 1A0HB 3SU4A 3FP7E 3UWIA 1GCDA 3TK9A 1PYTD 1P02A 1FIWA 2VGCB 1LPZB 4YZUA 3PTNA 1HXEH 3STIA 3GYLB 1GJAB 1LHFH 3F6UH 3RXUA 3RXEA 1M9UA 2BOHB 1AUJA 4I8HA 1UCYE 1EB1H 1EQ9A 1QQ4A 4HI3A 3WY8A 1GJCB 4UE7H 5CE1A 4DIIH 3RP2A 1LDTT 4AFUA 2H6MA 2AGEX 4ASHA 1RRKA 1YLCA 2QF3A 1C5YB 4D9QA 1ANEA 3SU6A 4B75A 1V2RT 3BTWE 3H5CB 2FMJA 2W7SA 2WYGA 1C2MA 2BZAA 1RXPA 4K8BA 1KXEA 2XNIA 1EXFA 1YPLH 3E1XB 1TNJA 3UWJH 3CS7A 3T28A 1AGJA 1GVZA 2ZFSA 1K1IA 2D2DA 4FU9A 1H9HE 3S7HB 1FONA 2BQ7B 4E7NA 2OTVA 1J15A 2ZFTA 4X8UH 2WUBA 1GWAA 1GMCG 3EGKH 4X6NA 3O8DA 2H5CA 1C5MD 1QRXA 5JBAS 3DHKH 1TQ0B 1O3PB 4D8NA 1CHGA 1G3CA 1KSNA 3BG4C 1C1RA 1ELEE 1K1MA 5FPYA 1O36A 1BTPA 3A81A 2IN2A 1Q31A 2ZTYA 4FUGA 3MH6A 2BDIA 1YPHE 1WOFA 1O2UA 1GJ9B 3BEIB 3SW2B 4X2XA 4O9VA 3BTGE 4UDWH 4FUIA 3ZVFA 3SHCH 1ZHRA 4XSKU 2GV7A 1Y3VA 2Z9LA 4AFZA 2BOKA 4MNWA 1CGIE 3HGPA 3AASA 1C2HA 1XVOA 1MTNB 3F68H 1O2KA 4JK5A 4NGAH 2SGPE 4MNXA 4K5ZA 2ZDMA 1U6QA 3RXDA 3S9BA 3P8NA 1XUHA 3PLPA 2UUYA 2VWOA 2GZ7A 4K1SA 1K2I1 4CRGA 4DW2U 5GXPA 1EX3A 4FUHA 1O5BB 4DG4A 4F4OC 3TVJB 3V7TA 3SV8A 3S9AA 4JZ1A 1NFWA 3PROA 5F6MA 2ZDNA 4BXWA 1BMLA 4K8YA 1TA6A 1T7CA 2C8XB 2EI6A 1TOCB 4XBCA 1DT2A 1SOZA 2A7HA 5TCCA 3PYHA 2FOGA 2CHAC 1THPB 3V13A 3SO3A 3BEFB 3SU2A 2ZIQH 3Q00A 4A7IB 3A7XA 4X1SU 1C2IA 1C5WB 1C2JA 2ZHDA 4NZLA 2UUJB 1BTZA 4X2VA 4Z6AH 4DJZB 3SU3A 3RDZA 1DDJA 1NZQH 4I31A 3RXPA 2WYJA 3ZZ9A 3MO6A 4KTUA 3CENA 3M5NA 3ZVBA 1TGSZ 3HGNA 1ZR0A 3NWUA 3SORA 3BN9A 1GCTB 2P3TB 3H7OA 5EODA 1EATA 2GKVE 1MAYA 1UJ1A 1NO9H 2XWAA 3MNSA 3RXFA 3ZZ8A 4WH6A 1CU1A 1TX6A 2ZDKA 1GI5A 1E35B 2XYAA 1HAHH 2ZU3A 1XUJA 2XBVA 2BMGB 1H1BA 1QGFA 1NFUA 4ZKSU 2SNWA 3RXAA 1P2NA 3SJ8A 5HM2A 3SU1A 1LPGB 2Q6FA 4WH8A 5JPMH 1A4WH 1P03A 1GBHA 1BTWA 2ZNKH 1NT1A 1O32A 4BTUB 4B76A 1C1TA 1GHBG 1TMTH 3DFLA 1MKXH 3E91A 1BRCE 1GBFA 1C1PA 1C4V2 2QCYA 2A4GA 1BZXE 4MLFB 1L1JA 7ESTE 3SUEA 4FVDA 3VXFH 2VIPA 1XX9A 3RU4D 5JYIA 1GBIA 3BTDE 2BHGA 3A80A 2ZGCA 4JZDH 1TGCA 1ZJKA 3KL6A 4LOYH 6ESTA 3ZVEA 4ABFA 3UPEA 2AGIX 3MU5A 1Y5BT 2Q6GA 1D3PB 1T8OA 4OGXA 4NIVA 2P95A 2AYWA 1P12E 1IHSH 1DX5M 2OBQA 1F92A 1QL8A 4AX9H 3RXQA 1B0FA 1RS0A 4Q7ZA 3MWIU 5H4IB 1O2RA 3ZV8A 5DO4H 2F9OA 4TWWA 1GI6A 1ACBE 5C5OA 1J17T 3KIDU 3BTME 3TK5A 4ZHAA 1O3CA 1HBTH 1P9SA 2JH5D 2LPRA 2J2UA 1O37A 3M5OA 2A45B 2H9HA 1VITF 1WBGB 5C1UA 1GHAG 4ZROA 1GG6B 2P16A 4AYVB 3E0PB 1C4U2 3A84A 2F9PA 1QRWA 1SG8B 4TYDA 2GX4A 1TNLA 4FUCA 1HAGE 3A7YA 1Y5AT 4ZKRU 3MOCA 3SGQE 1CHOF 1SGRE 5A8YA 3L33A 4JZIA 1VJAU 1XUKA 5EXMA 2STBE 4D76A 4MPWA 1FPHH 5TJXA 1W7XH 1BJVA 1G9IE 2AH4X 2VVUA 2PGBB 1WQSA 2XBYA 3OY6U 1IQFA 1VR1H 1T32A 3SUGA 1LVMA 1HJ9A 4MNVA 1GJ4H 3RC5A 1FY3A 4AGKA 1GGDC 1D3DB 1AZZA 1Z6EA 1W14U 1UCYH 3SNCA 3RMLH 3K2UA 1FAXA 4KTSA 1JWTA 1TB6H 2BD4A 1LVBA 3AVZA 1ESTA 1BBRE 2R2WU 1HPGA 1QQUA 1G36A 1QTFA 1SSXA 4DURA 4HFPB 4NWKA 3U98H 2V0BA 3Q77A 2SGFE 3QN7A 3W95A 1NFYA 4LK4A 2Q1JA 4TPYA 3D65E 1CE5A 4LZ4B 3MH4A 4YO9A 5L30H 1YM0A 4I7YH 4X1QU 4UFEH 1BTUA 1TGNA 1TX8A 3SV6A 4BOHA 1K28D 1NC6A 2VGCC 1GI2A 5I46H 1G3DA 1O3AA 3SBKA 1IQNA 1K1PA 2PWXA 5T6GA 3GCTG 3FZDA 1FV9A 1NROH 1WQVH 3DT0H 1C5NH 1LO6A 1YPGH 5F03A 1A46H 1WCZA 1N6YA 5J4SA 2GCTB 4YTAA 1K21H 4CH2B 5EQSA 2ZCLP 1MD8A 3LGYA 9ESTA 1C2LA 5HYOA 5DK1A 1W7GH 2A4RA 3G01A 1TE0A 3KQCA 1RD3B 1W3CA 1ELCA 2FESH 3LKWA 1ZRBA 2G5VA 3SV9A 3A7WA 5LGOA 1HJAB 4GUXA 3SUDA 1HGTH 4IBLH 2BXUH 4Y71A 4CRAA 1SGEE 1CA8B 5A8ZA 4I8LA 1GBCA 1QFKH 4RKOB 1O3LA 4DCDA 1MU8B 1GI8B 5GCHF 4YM9A 1ID5H 3ZVCA 1GBEA 1YBWA 4JYVH 5DGJA 2ZDVH 1K1LA 3K65B 2FOBA 2HLCA 3AAVA 2FXRA 1ZOMA 2Y5GA 2PUQH 4Q7YA 3K9XB 2W7UA 2FOMB 1EZSC 1S82A 3F9FA 2G55A 1E0FD 2BVRH 1UVOA 3BIUH 1GHAF 2B0FA 4IGDA 4AZ2B 2HRVA 2FX4A 5ETXA 2WPIS 3T62A 1CGHA 1UTQA 4AN7A 1HYLA 2ZU4A 4I8JA 5DP4A 1SQAA 3P70B 1EAIA 2I6SA 1HDTH 4ZH8A 1L0ZA 2HVXA 4CRCA 2P93A 3E90B 1NN6A 2UWLA 1V2WT 1AVWA 2P94A 2F9VA 2O8TA 1A5IA 1LHGH 1S6FA 1SOTA 2BX4A 3FP6E 5E8EH 1UMAH 1FZZA 5L2ZH 1AI8H 4K1TA 3LGUA 4YOIA 3F9GA 1MKWH 3A88A 4D7FA 4ABEA 1MTNC 1NRSH 3VPKA 1O3BA 2BZ6H 4Q80A 2OD3B 2ZU1A 2BTCE 1O5AB 2VWNA 2QXJA 4JCNA 2GDEH 2BLOA 4CREA 1AZ8A 3GY7A 1S0QA 2CJIA 3LGIA 4HZHA 3GDVA 6CHAB 2VH0A 3K6YA 3RLYH 1BJUA 3DD2H 4ABDA 2FOFA 3MHWU 1AKSA 3VB6A 1OXGA 1AFEH 2OCVB 1C2DA 1HAIH 1YF4A 3KEEA 1WUNH 3ATKA 2QA9E 1NRQH 1DVAH 1MQ5A 1SR5C 2SGQE 1EJMA 5EW1H 1KXCA 3Q3KA 3TH4H 2ZC9H 1A0LA 1XMNB 3LDXH 4F49A 2RCEA 2IOTA 2PUXB 2EA3A 2Y6TA 3BTQE 3ATMA 4ISLA 4B74A 3R3GB 5HXFA 2QXIA 4INLA 1HNEE 1HAZB 4CR5A 4IS5A 1O3KA 4CRDA 2ZHFH 3B23B 1A5GH 1GCTC 3GCTF 2PSYA 1CT0E 4GHTA 3NPSA 4Z0KA 3LPRA 2G81E 4AORA 2P3FH 2SGDE 1TWXB 1TFXA 1ZTJA 5DPAA 1UTNA 1AQ7A 1ETRH 3U1JB 1P10A 4B2BA 1C1UH 1NRRH 3M7UA 3D49H 1EAUA 2ZPRA 5K0HA 1DY9A 4AYYB 1C5PA 5EW2H 5AF9H 1MZAA 2J9NA 3HKIB 2C8YB 3DFJA 2AEIH 4MPXA 1AKSB 5L2YH 5FX6A 1ZMLA 1DE7H 1DANH 1N8OB 1OWHA 5EU8A 3AW0A 2ODQA 1HIAA 1MZDA 1L1NA 1Y3WA 2QC2A 1PQAA 3QX5H 1DXWA 3LJJA 2ZCHP 2BY7X 1SGYE 3KF2A 2VU8E 1SLVB 1GJ7B 1QNJA 5FPTA 3HK6B 1G3BA 1MTWA 3H7TA 1SGCA 2HNTF 2PGQB 4X0WU 3RXJA 4ZHLU 2V3OH 2BVXH 3SU5A 3UTUH 3UY9A 1ANCA 2RDLA 1VCQA 5JBTA 1GI4A 1RJXB 1HLTH 4FU7A 1TPOA 2O8UA 3NUMA 4NA9H 4O3UA 1ZGIA 3FVFB 3KHVA 2UUFB 3LC5A 3MO3A 3M5MA 2Y81A 2ZHEH 3E8LA 3E0NB 2J4IA 2QYIA 1Z8GA 4X1PU 3QTOH 4WXIA 3GDUA 4JK6A 1AD8H 4Y10E 2A1DB 2WINI 1TX7A 1C1SA 1A7SA 3SGBE 1LHCH 1BBRH 2NU4E 2LNCA 4IC5A 4AFSA 1Y8TA 1P04A 1GG6C 1HRTH 3BTTE 2ODYB 3GDSA 4K60A 4ABGA 1YCPH 1WSSH 1GJ5H 3LOXA 4BAQB 2XCNA 1LQDB 1K1JA 1KLTA 3TIUA 1NESE 1SQOA 1EKBB 3NCLA 2ZTZA 5EXNA 1VGCC 1MKXK 1ELTA 3RXVA 3T26A 1TYNA 4DVAU 2FTLE 4WMEA 5C5NA 2VIVA 5JDUB 1T8NA 1EAWA 1YC0A 3SQHE 1YPHC 3M3SA 5I25A 1PPEE 5T6FA 3RC6A 3U8OH 2A31A 1W12U 1SVPA 1UHBA 2Z3CA 1OS8A 1WTGH 3U9AH 1OKXA 2GMTC 1EPTA 1HFDA 3GOVB 5EGMA 1ESAA 4GCHG 3ZZCA 1IQEA 4RSPA 1TGBA 2BD9A 2TRMA 1JXPA 2WPKS 1FQ3A 3MNXA 2HGTH 2EC9H 4H6SB 4A92A 2OC0A 4WMDA 1O5CB 1VCWA 1YYY1 4JMYA 1O2QA 3BTEE 4XDEA 3RMMH 2P8OB 2VINA 1DWDH 4CHAB 1O3NA 4QT8C 1VITG 3C1KA 2DE9A 3LJOA 2GCHG 2Z9IA 3SHAH 4A1XA 2PKAA 1OX1A 1OWJA 5C1YA 1AN1E 1GDQA 3F1SB 4FU8A 3VGCB 1FAKH 1G32B 2J94A 1SB1H 1DITH 1KLJH 3SUFA 1K22H 3LGTA 1CHOG 1THSH 1TNGA 3SZNA 2C4FH 1C1OA 4WMFA 1O2JA 1T8LA 2FI5E 1W2KH 3UR6A 3PV4A 1CO7E 1SC8U 3TH2H 1P01A 3GY6A 1GHZA 2BD3A 2ZI2H 2STAE 2GCTC 1P06A 2VIQA 2ANMH 1GVLA 4GLYA 1UCYK 1X7AC 3R0FA 1O33A 4XBDA 1GL1A 1LCYA 3QUMP 1ZYOA 5GPIB 3KCGH 2OC1A 2IPHA 5FX5A 2BYAX 3T27A 3A82A 3DUXH 3PB1E 1SGQE 3TGKE 3RLWH 1XKAC 3Q3XA 4WF8A 5DP9A 4I32A 1ANBA 2ALPA 1BA8B 2ZQ1A 1C1NA 1ARBA 2D8WA 1DY8A 3ODFA 3ESTA 4GVUA 1PFXC 1EOJA 1C9TA 2FLRH 1W10U 1QB9A 1DICA 1L4ZA 1O3EA 4AG2A 1ELFA 3QO6A 1C5XB 2XW9A 1BT7A 3MNCA 4NSVA 1IOEA 3SNEA 1FY8E 1AWFH 5FAHA 1S6HA 1OP0A 1TQ7B 2GGVB 3GISB 1V2VT 1C5ZB 1JRSA 1QIXB 1Q3XA 2HWLB 3QK1A 2O9QA 4XE4A 3A8AA 2BX3A 1HAXB 2ASUB 4HGCA 1OWIA 3RXKA 1GBDA 1UTOA 3TJUA 1UK4A 2ZTXA 3I78A 1V2ST 4Y76A 1QA7A 1DM4B 1ESBA 3A83A 1AB9B 3GCHB 3T2NA 2BD2A 3LT3A 2QV1A 1GMHF 2J92A 1RIWB 1P0SH 5E2PA 3VB7A 4ABBA 1CQQA 1C2EA 3ZVDA 3SNBA 3KQDA 1C1QA 2C93B 1AFQB 1T4UH 4KELA 1BOQA 1O35A 4U2WA 4GCHF 1D3QB 3RUOA 2QXGA 5CMXH 3L6PA 1O2MA 1TALA 3N7OA 5AVDA 5GCHG 2B7DH 2TGAA 1F2SE 1DWCH 1HXFH 5EXLA 1XXDA 4ABHA 1ZTKA 2AIQA 2GZ9A 1O30A 3STJA 1O34A 1UVPA 2C8ZB 4A1TA 5DP5A 1K1OA 2EI7A 2VWLA 4UONA 4B2CA 1TNKA 2BY6X 5AHGH 1GI0A 1EJAA 4IMQA 2OC8A 1EUFA 3RMNH 1O3FA 2GCHF 3LU9B 2ESTE 3RXHA 3RC4A 4J2YB 1BMMH 1FJSA 1BTXA 1SPJA 1ZRKA 1F0UA 1TA2A 3QTVH 4OS4A 1D3TB 4NIWA 2F83A 2OUAA 1CBWB 1VITH 4E06H 1HCGA 1LQEA 4IN2A 1YP9A 2CGAA 1BB0B 5EOKA 3ODDA 5JB8S 1P2IA 1XKBC 1C1WH 2AMQA 2ZFFH 8KME2 5A09A 1MKWK 1JMOH 2QN5T 4IW4E 2I6QA 2XXLA 2PKSB 1XUGA 2KAIA 4BAOB 2HNTE 5GIBA 1MCTA 2BY5X 1AWHB 1G37A 2FI4E 3BTKE 1BMAA 1EP6A 2GT8A 3DA9B 5C20A 1P2OA 2FWWA 2WPJS 1N8OC 2G4TA 1SGPE 1PQ8A 2AFQB 1GJ6A 2CXVA 1RGQA 3PO1B 1BHXB 1HAOH 2JH0D 1O2GH 3U1IB 2XBWA 1NRPH 1OYQA 1SFQB 2YNBA 4CR9A 3O8BA 2ZU2A 1RTKA 4FUBA 2Z9GA 2F91A 4MPUA 5DP7A 4RKJB 2W26A 3L3TA 2BLQA 5E0HA 1TBRH 2BB4A 1KXFA 1V2KT 3ZZ5A 3I77A 2Y80A 1UK3A 1ETTH 2H1UA 4UEHH 2ZG0H 2WV4A 4CRFA 1FN6A 3PM3A 3TK6A 1V2PT 3EYDA 1NRNH 3P17H 1AVGH 3OYPA 3PTBA 3T25A 2GVFA 1TMUH 2R3UA 3VEQB 1BUIA 3BG8A 5FBEA 1TNHA 2XRCA 3UUZA 3FANA 3ZZ4A 1D6RA 1S84A 4NFFA 2G51A 4X8SH 3VB4A 1UVTH 4CBOA 4OS7A 1ETSH 2R0KA 2A5KA 2XC5A 2VIWA 1QL7A 3KQBA 3S9CA 5BPEA 3UQVA 1ELDE 4NFEA 1E36B 1P2KA 1GMDF 3GY2A 2FX6A 4D7GA 1SHYA 1G3EA 1ANDA 4YLUA 4YLQH 1BHXF 3U8TH 3QZRA 4OS5A 4R8TB 2P59A 4NA7A 1T31A 1KLIH 1OOKB 2BD5A 2FPZA 3ZZ3A 1QB6A 1O2SA 4FUJA 4NIXA 1SLXB 3AW1A 2ZDAH 1XVMA 1ZZZA 1HB0B 4YOGA 1MAXA 3PMJA 3OSYA 1J9CH 2FOHA 1BQYA 1QCPA 3TJVA 4DIHH 3VFEA 1ORFA 4ABIA 4K2YA 1IQKA 2M5TA 3MFJA 1O39A 3UQOA 2D26C 4BAKB 1GJDB 2PV9B 1W13U 2C90B 3KGPA 4VGCB 4KTCA 1HUTH 1GI3A 1IAUA 1QB1A 3MU1A 1QHRB 1O2LA 3JZ1B 4I8GA 2OINA 2QAAA 1W0ZU 2A7CA 5E0JA 4AG1A 3ATLA 1B5GH 4NSYA 1F0RA 1BBRK 1KYNA 4IN1A 4YT6H 5DP3A 1NS3A 2ZPQA 1YGCH 1W8BH 1C5UA 3SNAA 3SJKA 5B6OA 1HAVA 3Q76A 2P8OC 4CHAC 5JB9S 1Z8JB 5FXLA 1YCPK 1TONA 3OU0A 1ZMJA 3BV9B 2FI3E 2IJOB 1XM1A 1ZMNA 2BLVA 3UNQA 2Z3EA 3NXPA 3RXCA 4WXVA 3VGCC 1H8DH 5A8XA 3MH5A 2A0QB 5C3NA 2FYQA 4X2WA 5F8ZA 4NG9H 1SI5H 1DUEA 1V2LT 1SLUB 3ZZ7A 3A7ZA 1BRUP 1TIOA 4MDSA 4YOJA 2ZECA 3UREA 2UWOA 4Y7AA 5LPEA 1S5SA 4X6OA 1V2JT 3KN2A 4GPGA 3A7TA 2SFAA 3P92A 3SGAE 4UFGH 5J4QA 7LPRA 1MMJN 3TGJE 1FY5A 3K6ZA 1HV7A 1GL0E 2V6NA 1ZGVA 3KQEA 3ZZAA 1ZSLA 3M37A 4OS6A 1KDQA 2OXSA 4Y8XA 1AU8A 4MTBA 1J8AA 3F9HA 1QJ7B 1MCVA 1TBQH 4ESTE 4ISHH 1EAXA 1SGFA 3SJOA 2ZCKP 1TPPA 1YPKH 3M7TA 3NKKA 4K69A 1TPAE 1O2XA 4D9RA 1Y3UA 1PPGE 2F3CE 2ZQ2A 4AB9A 2Y7XA 3I29A 4Y0ZE 1P11E 4INHA 4WWYA 1C4Y2 1A61H 3KNXA 2XTTB 2ZEBA 1IQHA 3S7KB 1FI8A 3CP7A 1Z1IA 2ZFRH 4JYUH 2PTNA 1TABE 3BTHE 4U32A 1O2TA 1PPHE 5DP8A 3M36A 3C27B 5F8XA 1DWBH 2JETB 3P8OA 1C5VA 2SGEE 2ZP0H 2WPLS 2VVVA 4BTIB 3ZZDA 1Y3YA 3RXLA 1JOUB 4Q7XA 2GTBA 3T5FH 2R9PA 2G8TA 1UO6A 4RN6A 3RXOA 1SL3A 6GCHG 4NWLA 2GZ8A 1G30B 3TNTA 4Y11E 4WJG2 1KDQB 1GGDB 3SOSA 3PLKA 4JZFH 1QBNA 4B2AA 2ZA5A 3P8GA 1WU1A 1AB9C 1ZSKA 3GCHC 2A4OA 1P3EA 1YKTA 3MH7A 3RXBA 1RIWC 1RTFB 4PROA 2AGGX 2G52A 2QF0A 3P95A 4ISOA 1H8IH 1NPMA 1O2HA 3RXTA 2XBXA 1HAYB 5A0CA 8GCHG 1LMWB 2PW8H 2VB0A 5EQQA 2P3UB 5FCKA 1DS2E 4FUFA 1H9IE 3MO9A 2WPMS 1AVXA 3GICB 4YT7H 1T4VH 2DUCA 4HTCH 2BQ6B 1RTLA 2BDAA 1DUAA 5LPRA 3V0XA 3S0NA 2NU1E 2ZWLH 2FM2A 5LPFA 2C8WB 1S83A 3S69A 2V3HH 1ZPZA 1OWEA 2HPQH 1IQMA 2J38A 3QZQA 4GAWA 3TU7H 1HIAB 2YOLA 1DLEA 2QY0B 4TY7A 2ZPSA 4I33A 4MG3A 1CSOE 1NU7B 3QGJA 3ZVAA 5HMAA 2F9BH 2FO9A 1MQ6A 1CBWC 3BSQA 1GBLA 4U01A 1RFNA 2BDHA 1P2QA 2NU3E 2OBOA 3V12A 1C5OH 2DE8A 2FOCA 2YNAA 3LH1A 2F9UA 2A5AA 1FXYA 1IHTH 2XCFA 4XFQA 1Q2WA 1ZHPA 2RA3A 1IQJA 1GBJA 3F9EA 1EJNA 1GMHG 2PKSC 2O8MA 3ZVGA 1H4WA 1Z6JH 2TIOA 3VB5A 4Y79A 1BRBE 2FTMA 1A2CH 1K9OE 3SV2H 1ABIH 1O3HA 4OS2A 1TGTA 1Y5UT 4UFDH 1C1MA 1CA0B 3BTFE 2VWMA 1FY4A 1O3GA 5AFYH 1V2UT 1VZQH 3ITIA 4BNRA 2J95A 3PO1C 4H42U 2FIRH 2FODA 2BM2A 4FUDA 1FIZA 1P3CA 2CV3A 2PFEA 4XBBA 2THFB 3RMOH 1LKAA 1FY1A 1UVUH 5IDKA 1V2OT 4GHQA 2TGDA 4B73A 3UOPA 3GY5A 4IC6A 1DXPA 5EQRA 4BXSA 3HPTB 4TY6A 5C2ZA 3FP8E 3BF6H 5T3HA 1AE5A 3ZZ6A 2FS9A 1NFXA 1S85A 3UFAA 3RXMA 5FHTA 2BDBA 1O5EH 2A32A 3P6ZB 4DT7B 3PMBB 1GHXH 1GI7B 5GWZA 1GPZA 4CRBA 1C2GA 2ZGBH 4KKDA 1AMHA 3LONA 1E37B 1D9IA 2WV5A 1DOJA 4WVPE 1TMBH 1BTYA 1Z71A 1UHBB 1AUTC 1D6WA 6GCHF 2BVSH 1YPMH 2VIOA 1EPTB 1GJBB 1G2MA 1W0YH 2BDGA
chains in the Genus database with same CATH superfamily
2VNTA 4NCYA 4FXGH 1E34B 1O2ZA 2J5UA 2BD8A 5DP6A 2ILNA 2ZHWH 4NA8A 1C5SA 2B5TB 3RXGA 1TRNA 3PLBA 2FEQH 3FAOA 1N6XA 2F43B 2OQUA 1S0RA 3M61U 1KTTB 1IQLA 3DSOA 1O3JA 1ELAA 1TRMA 2Y5HA 1FMGA 2ZFPH 4ZXXH 3BEUA 3V3MA 1A3EH 1IQIA 1HJAC 2AS9A 1O3OA 1GBAA 3A87A 8GCHF 3SQEE 1KIGH 1OSSA 2G4UA 1J16A 4KGAA 1V2TT 2VIDA 2PKAB 2VJ1A 4O3TA 3TNSA 1BRAA 1UTLM 1V2QT 4BAMB 3ATIA 4XRNA 1LHDH 4LXBH 1TBZH 1K1NA 4GSOA 1C9PA 1Y59T 3GY4A 1MTUA 2Z7FE 4MNYA 2J34A 3M7QA 2GV6A 1ARCA 2Z94A 3IITA 2Z9JA 1ABJH 1QBVH 4VGCC 3TITA 1XXFA 1SGTA 2B8OH 5C1XA 3EE0B 2ZGJA 3O8RA 4ZUHA 4DY7B 4SGBE 2C3SA 1CT2E 2FYRA 1QL9A 4BTTB 3TLOA 4XOJA 1P8VC 4ZHMU 2F4LA 3ZZBA 1QZ8A 3A8DA 2R2MB 3QWCH 5CHAB 5DKMA 5KECA 1ZHMA 1T8MA 1O0DH 3URDA 1MUEB 5JBCS 5A0AE 1FLEE 2AHME 2H9TH 1F5LA 8LPRA 2XC4A 1TOMH 2ZF0H 3SJ9A 4UFFH 1GMDG 2ODPA 2QF5A 1C2FA 2A7JA 1PPFE 4AC9A 4B1TA 3LIWA 1O5DH 2G5NA 1O3MA 4X8VH 4ACBA 1B0EA 1LVYA 1K0HA 2Y5FA 4X1RU 2B9LA 3QGNB 1F7ZA 2RG3A 3T29A 5DJ7A 5GNDA 4JZEH 3O8CA 3UAIC 3M35A 2A2QH 2HOBA 1EASA 6CHAC 3E3TA 3RM0H 1GMCF 4CBNA 2WPHS 3M3VA 2QXHA 5DG6A 4U30A 1GBKA 2BXTH 3B9FH 4OS1A 2RDEA 1NY22 2XOKD 1CT4E 5IYTA 1XUFA 1COWD 3A8BA 1AHTH 3E16B 5E2OA 3U8RH 4AOQA 1UTPA 1IQGA 2Q6DA 9LPRA 4INKA 4MQAA 1GI9B 2FLBH 1F5KU 5G4BA 1MH0A 4X6PA 2HNTC 2TPIZ 2ZO3H 3LH3A 1F5RA 1GHYH 5T6DA 2HPPH 3RM2H 1BIOA 3A86A 1CVWH 3SI3H 2PHBA 4SGAE 1B7XB 5EPNA 3MU4A 1OP2A 2K1QA 5FPSA 4R0IA 5JBBS 4ZMAH 5C17A 3TPIZ 2BD7A 5C94A 1QJ6B 1BCUH 1ELGA 1V2MT 5BRRE 2SGAA 3PMAB 3CS0A 2GT7A 3UIRA 2Y7ZA 1MBQA 1ZLRA 3UOUA 3A89A 1BMNH 5HM9A 1AO5A 5EJZA 4ZKNU 4FUEA 3TJNA 2JETC 1KXBA 1VGCB 4ABJA 3ELAH 3LGWA 1YCPM 2CF9H 3A7VA 2FS8A 2TBSA 2CF8H 4ISNA 3RXRA 3GS9A 3VXEH 1QJ1B 3BIVH 2AIPA 3EA9A 3PRDA 3F2GA 1XUIA 3D23A 1VCPA 2OP9A 1GHWH 1UVSH 1LVOA 2ZDLA 3NK8A 1QBOA 3GY3A 1SHHB 2OLGA 3U69H 1NU9A 1EZXC 3SU0A 3UNSA 2V35A 2CMYA 4H6TA 5HGGA 1GBTA 1SGDE 1SMFE 3E6PH 1S6LA 7GCHG 2ANKH 2GMTB 2ULLA 2UUKB 5FBIA 2AMPA 2EY4C 4I8KA 1ZPBA 4MPVA 1TLDA 2F9NA 2NU0E 1YLDA 2W5EA 2O8WA 1GI1A 2G00A 1SLWB 4O97A 1PYTC 3BG4B 4ISIH 3ZV9A 4WY3A 5LH8A 1P05A 3W94A 2YMSB 2WHXA 1OYTH 1OWDA 2K8IA 1GDUA 1JRTA 3HKJB 2VH6A 2H5DA 1A5HA 1UTJA 2EI8A 3SI4H 2BLWA 2ANWA 2R0LA 3OX7U 3TGIE 1AE8H 1SQRA 2QIQA 3LC3A 3ZYEA 2H9EH 2KAIB 5A0BA 4A6LA 1VJ9U 2ZZUH 1PPZA 3HATH 3EA7A 1TRYA 1O2NA 4Y8ZA 4H4FA 2WUCA 2NU2E 1QA0A 1UTMA 3MTYA 1WYKA 4E7RG 1S81A 3GY8A 3D62A 1O3IA 1SGIB 1V6DA 3MU0A 4FVBA 4Y0YE 2HALA 5C67A 2FZZA 1LKBA 2H2ZA 1D4PB 3A85A 1BDAA 1KTSB 1C5LH 1Z1JA 3TH3H 2AMDA 3MMGA 1P2JA 1FNIA 2Y82A 2OQ5A 1GHBF 3GCNA 1C5TA 3NZIA 2RFKC 1GBMA 1ZSJA 1OP8A 1FPCH 1C5QA 3URCA 1EZUC 1V2NT 3PWBA 1O2VA 1L2EA 1O2PA 1HJ8A 1PQ5A 2GDDA 2CHAB 2OC7A 4NIYA 1TAWA 5L6NH 1MU6B 2A4QA 1GVKB 2GP9B 2XC0A 1AIXH 4ZAEA 2ZHQH 1KXAA 2EEKA 1L1GA 3IWMA 2VBCA 1QY6A 3LGVA 1GJ8B 2ZU5A 1O2IA 2PTCE 1BTHH 1MBMA 3UNRA 3M5LA 2BDYA 2O8LA 3MNBA 3UR9A 1C5RA 3A8CA 4M7GA 1ZTLA 3FZZA 4LZ1H 5A2MH 1H9LB 1SBWA 3MYWA 1FN8A 1CA0C 2A2XH 1JIRA 4XD7D 3ATWA 5ESBA 1P2MA 1GDNA 1NTPA 1YPJH 1JBUH 1EB2A 1C1VH 3M3TA 2BQWB 3PWCA 5EG4A 3SV7A 3ZYDA 2Z6BD 1C2KA 2PLXA 2AERH 2QGRA 1FDPA 1EZQA 2LELA 1KXDA 1PPCE 5E0GA 3OAAD 4AGJA 1DLKB 1OPHB 1WV7H 2FP7B 3RXSA 5PTPA 2A5IA 1A0JA 2GD4B 2W3IA 3OY5U 5ABWA 3SN8A 1LTOA 2UWPA 2FOEA 3EQ0H 4UD9H 1SGNE 1KY9A 4X1NU 2BY9X 5C0UA 1Z8RA 4YESB 1ELVA 4Y6DA 1ZPCA 1QR3E 2ALVA 1EP5A 2R3YA 1SFIA 2ZGXH 3PMHB 1TPSA 4KP0A 4DOQA 3SNDA 3B8JA 5F8TA 1PJPA 1O2OA 1E38B 3MU8A 1SGFG 2PR3A 2Z3DA 4B71A 1DPOA 3Q3YA 3AAUA 4DGJA 3OFND 1JIMA 1PPBH 1EPTC 1Z7KA 7GCHF 4E05H 4AFQA 4J1YA 4IMZA 4X2YA 3RU4T 4ZXYH 4K1EA 2PSXA 5FCRA 5TCAA 2VVCA 4TWYA 1P9UA 1DWEH 2ANYA 3EAJA 1NBME 2CN0H 3IG6B 5EPYA 3U28C 1O5FH 5SGAE 1LPKB 2W3KA 3JZ2B 1G2LA 1EFRD 5AFZH 2TGPZ 4BANB 3QLPH 1F0SA 2BY8X 1HAPH 2ZFQH 4CH8B 1HAVB 1Z8IB 3GYMA 4Q2KA 4O03A 4JYTA 4ASUD 1CGJE 1O3DA 2JKHA 1O5GH 2TGTA 2SNVA 1DFPA 4ZKOU 1GBBA 1BITA 1O2YA 1NM6A 2XNDD 3FFGA 2ZKSA 4K3JA 1FX0B 2ZGHA 1UTKA 3OTJE 1J14A 2XWBI 1H8ED 1UK2A 3SJIA 4MVNA 5EIYA 2RA0A 1MD7A 1THRH 2FOAA 1DSTA 3TJOA 4X8TH 1INCA 4X6MA 1H8HD 1SQTA 3EDXB 1MTSA 5K7RA 1P09A 4Y8YA 1GHVH 4NZQA 4Y7BA 1MTVA 1TNIA 5GDSH 3RXIA 2J98B 5CHAC 3P8FA 4A1VA 5GJ4B 1Y3XA 1P57B 1DSUA 2FDAA 1WTHD 4ABAA 2W6ID 1QRZA 3ENSB 1WAYB 4OGYA 1V3XA 1F0TA 1O38A 6LPRA 7KMEH 4BAHB 1A1RA 1ELBA 8ESTE 5ESTE 2NWNA 1O2WA 3EA8A 1QURH 1YPEH 1N1LA 4TPIZ 1ZJDA 1AFQC 1FUJA 3HK3B 3RU4E 2D1JA 2JH6D 3QDZB 3F0OA 1O31A 1A3BH 1L4DA 1LHEH 1YWUA 3MI4A 3GCOA 1PQ7A 4AB8A 2Z9KA 4A5TS 4THNH 3VB3A 1AY6H 1EOLA 2BDCA 1OWKA 1W11U 1A0HB 3SU4A 3FP7E 3UWIA 1GCDA 3TK9A 1PYTD 1P02A 1FIWA 2VGCB 1LPZB 4YZUA 3OEHD 3PTNA 1HXEH 3STIA 2JJ2D 3GYLB 1GJAB 1LHFH 3F6UH 3RXUA 3RXEA 1M9UA 2BOHB 1AUJA 4I8HA 1UCYE 1EB1H 1EQ9A 1QQ4A 4HI3A 3WY8A 1GJCB 4UE7H 5CE1A 4DIIH 4M9FA 3RP2A 1LDTT 4AFUA 2H6MA 2AGEX 4ASHA 1RRKA 1YLCA 2QF3A 1C5YB 4D9QA 3W1EA 1ANEA 3SU6A 4B75A 1V2RT 3BTWE 3H5CB 2FMJA 2W7SA 2WYGA 1C2MA 2BZAA 1RXPA 4K8BA 1KXEA 2XNIA 2KCPA 1EXFA 1YPLH 3E1XB 1TNJA 3UWJH 3CS7A 3T28A 1AGJA 1GVZA 2ZFSA 1K1IA 2D2DA 4FU9A 1H9HE 3S7HB 1FONA 2BQ7B 4E7NA 2OTVA 1J15A 2ZFTA 4X8UH 2WUBA 1GWAA 1GMCG 3EGKH 4X6NA 3O8DA 2H5CA 1C5MD 1QRXA 5JBAS 3DHKH 3UB0A 1TQ0B 1O3PB 4D8NA 1CHGA 1G3CA 2EQNA 1KSNA 3BG4C 1C1RA 1ELEE 1K1MA 5FPYA 1O36A 1BTPA 3A81A 2IN2A 2YMSC 1Q31A 2ZTYA 4FUGA 3MH6A 2BDIA 1YPHE 1WOFA 1O2UA 3PV2A 1GJ9B 3BEIB 3SW2B 4X2XA 4O9VA 3BTGE 4UDWH 4FUIA 3ZVFA 3SHCH 1ZHRA 4XSKU 2GV7A 1Y3VA 2Z9LA 4AFZA 2V3MA 2BOKA 4MNWA 2OK5A 1CGIE 3HGPA 3AASA 1C2HA 1XVOA 1MTNB 3F68H 3PV5A 4RT1A 1O2KA 4JK5A 4NGAH 2SGPE 4MNXA 4K5ZA 2ZDMA 1U6QA 3RXDA 3S9BA 3P8NA 1XUHA 3PLPA 2UUYA 2VWOA 2GZ7A 4K1SA 1K2I1 4CRGA 4DW2U 5GXPA 1EX3A 4FUHA 1O5BB 4DG4A 4F4OC 3TVJB 3V7TA 3SV8A 1NBMD 3S9AA 4JZ1A 1NFWA 3PROA 5F6MA 2ZDNA 4BXWA 1BMLA 4K8YA 1TA6A 1T7CA 2C8XB 2EI6A 1MABB 1TOCB 4XBCA 3DSGA 1DT2A 1SOZA 2A7HA 5TCCA 3PYHA 2FOGA 2CHAC 1THPB 3V13A 3SO3A 3BEFB 3SU2A 2ZIQH 3Q00A 4A7IB 3A7XA 4X1SU 1C2IA 1C5WB 1C2JA 2ZHDA 4NZLA 2UUJB 1BTZA 4X2VA 4Z6AH 4DJZB 3SU3A 3RDZA 1DDJA 1NZQH 4I31A 3RXPA 2WYJA 3ZZ9A 3MO6A 4KTUA 3CENA 3M5NA 3ZVBA 1TGSZ 3HGNA 1ZR0A 3NWUA 3SORA 3BN9A 1GCTB 2P3TB 3KYFA 3H7OA 5EODA 1EATA 2GKVE 1MAYA 1UJ1A 1NO9H 2XWAA 3MNSA 3RXFA 3ZZ8A 4WH6A 1CU1A 1TX6A 2ZDKA 1GI5A 1E35B 2XYAA 1HAHH 2ZU3A 1XUJA 2XBVA 2BMGB 1H1BA 1QGFA 1NFUA 4ZKSU 2SNWA 3RXAA 1P2NA 3SJ8A 5HM2A 3SU1A 1LPGB 2Q6FA 4WH8A 5JPMH 1A4WH 1P03A 1GBHA 1BTWA 2ZNKH 1NT1A 1O32A 4BTUB 4B76A 1C1TA 5F53A 1GHBG 1TMTH 3DFLA 1MKXH 3EE7A 3E91A 1BRCE 1GBFA 1C1PA 1C4V2 2QCYA 2A4GA 1BZXE 4MLFB 1L1JA 7ESTE 3SUEA 4FVDA 3VXFH 2VIPA 1XX9A 3RU4D 5JYIA 1GBIA 3BTDE 2BHGA 3A80A 2ZGCA 4JZDH 1TGCA 1ZJKA 3KL6A 4LOYH 6ESTA 3ZVEA 4ABFA 4TSFD 3UPEA 2AGIX 3MU5A 1Y5BT 3F2HA 2Q6GA 2PP6A 1D3PB 1T8OA 4OGXA 1W0KD 4NIVA 2P95A 2AYWA 1P12E 1IHSH 1DX5M 2OBQA 1F92A 1QL8A 4AX9H 3RXQA 1B0FA 1RS0A 4Q7ZA 3MWIU 5H4IB 1O2RA 3ZV8A 5DO4H 2F9OA 4TWWA 1GI6A 1ACBE 5C5OA 1J17T 3KIDU 3BTME 3TK5A 4ZHAA 1O3CA 1HBTH 1P9SA 2JH5D 2LPRA 2J2UA 1O37A 3M5OA 2A45B 2H9HA 1VITF 2WPDD 1WBGB 5C1UA 1GHAG 4ZROA 1GG6B 2P16A 4AYVB 3E0PB 1C4U2 3A84A 2F9PA 1QRWA 1SG8B 4TYDA 2GX4A 1TNLA 4FUCA 1HAGE 3A7YA 1Y5AT 4ZKRU 3MOCA 2IPQX 3SGQE 2KCAA 1CHOF 1SGRE 5A8YA 3L33A 4JZIA 1VJAU 1XUKA 5EXMA 2STBE 4D76A 4MPWA 1FPHH 5TJXA 1W7XH 1BJVA 1G9IE 2AH4X 2VVUA 2PGBB 1WQSA 2XBYA 3OY6U 1IQFA 1VR1H 2HVYB 1T32A 3FO8D 3SUGA 1LVMA 1HJ9A 4MNVA 1GJ4H 3F3BA 3RC5A 1FY3A 4AGKA 1GGDC 1D3DB 1AZZA 1Z6EA 1W14U 1UCYH 4B6EA 3SNCA 3RMLH 3K2UA 1FAXA 4KTSA 1JWTA 1TB6H 2BD4A 1LVBA 3AVZA 1ESTA 1BBRE 2R2WU 1HPGA 1QQUA 1G36A 1QTFA 1SSXA 4DURA 4HFPB 1SKYE 4NWKA 3U98H 2V0BA 3Q77A 2SGFE 3QN7A 3W95A 1NFYA 4LK4A 2Q1JA 4TPYA 3D65E 1E1QD 1CE5A 4LZ4B 3MH4A 4YO9A 2M2AA 5L30H 1YM0A 4I7YH 4X1QU 2J97A 4UFEH 1BTUA 3OE7D 1KMHB 1TGNA 1TX8A 3SV6A 4BOHA 1K28D 1NC6A 2VGCC 1GI2A 5I46H 1G3DA 1O3AA 2YMSD 3SBKA 1IQNA 1K1PA 2PWXA 5T6GA 3GCTG 3FZDA 1FV9A 1NROH 1WQVH 3DT0H 1C5NH 1LO6A 1YPGH 3MQKC 5F03A 1A46H 1WCZA 3DCLA 1N6YA 5J4SA 2GCTB 4YTAA 1K21H 4CH2B 5EQSA 2ZCLP 1MD8A 2JIZD 3LGYA 9ESTA 3KQ5A 1C2LA 5HYOA 5DK1A 1W7GH 2A4RA 3G01A 1TE0A 3KQCA 1RD3B 1W3CA 1ELCA 2FESH 3LKWA 1ZRBA 2G5VA 3SV9A 3A7WA 5LGOA 3DSPA 1HJAB 4GUXA 3SUDA 1HGTH 4IBLH 2BXUH 4Y71A 4CRAA 1SGEE 1CA8B 5A8ZA 4I8LA 1GBCA 1QFKH 4RKOB 1O3LA 4DCDA 1MU8B 1GI8B 5GCHF 4YM9A 1ID5H 3ZVCA 1GBEA 1YBWA 4JYVH 5DGJA 2ZDVH 1K1LA 3K65B 2FOBA 5HIZA 2HLCA 3AAVA 2FXRA 1ZOMA 2Y5GA 2PUQH 4Q7YA 2KX4A 3K9XB 2W7UA 2FOMB 1EZSC 1S82A 3F9FA 2G55A 1E0FD 2BVRH 1UVOA 3BIUH 1GHAF 1OHHD 2B0FA 4IGDA 4AZ2B 2HRVA 2FX4A 5ETXA 1UW7A 2WPIS 3T62A 1CGHA 1UTQA 2IJD1 4AN7A 1HYLA 2ZU4A 4I8JA 5DP4A 1SQAA 3P70B 1EAIA 2I6SA 1HDTH 2JDID 4ZH8A 1L0ZA 2HVXA 4CRCA 2P93A 3E90B 1NN6A 2UWLA 4HG6A 1V2WT 1AVWA 2P94A 2F9VA 2O8TA 1A5IA 1LHGH 1S6FA 1SOTA 2BX4A 3FP6E 5E8EH 1UMAH 1FZZA 2LP6A 2V7QD 5L2ZH 1AI8H 4K1TA 3LGUA 3FN8A 4YOIA 3F9GA 1MKWH 3A88A 4D7FA 4ABEA 1MTNC 1NRSH 3VPKA 1O3BA 2BZ6H 4Q80A 2OD3B 2ZU1A 2BTCE 1O5AB 2VWNA 2QXJA 4JCNA 2GDEH 2BLOA 4CREA 1AZ8A 3GY7A 1S0QA 2CJIA 3LGIA 3F0PA 4HZHA 3GDVA 6CHAB 2VH0A 3K6YA 3RLYH 1BJUA 3DD2H 4ABDA 2FOFA 3MHWU 1AKSA 3VB6A 3N7DA 1OXGA 1AFEH 2OCVB 1C2DA 1HAIH 1YF4A 2KR7A 3KEEA 1WUNH 3ATKA 2QA9E 1NRQH 1DVAH 1MQ5A 1SR5C 2SGQE 1EJMA 5EW1H 1KXCA 3Q3KA 3TH4H 2ZC9H 1A0LA 1XMNB 3LDXH 4F49A 2RCEA 2IOTA 2PUXB 2EA3A 2Y6TA 3BTQE 3ATMA 4ISLA 4B74A 3R3GB 3SYJA 5HXFA 2QXIA 4INLA 1HNEE 1HAZB 5DN6D 4CR5A 4IS5A 1O3KA 4CRDA 2ZHFH 3B23B 1A5GH 1GCTC 3GCTF 2PSYA 1CT0E 4GHTA 3NPSA 4Z0KA 3LPRA 2G81E 4AORA 2P3FH 2SGDE 1TWXB 1TFXA 1ZTJA 5DPAA 5EJLA 1UTNA 1AQ7A 4FETA 1ETRH 3U1JB 1P10A 4B2BA 1C1UH 1NRRH 3M7UA 3D49H 1EAUA 2ZPRA 2WSSD 5K0HA 1DY9A 4AYYB 1C5PA 5EW2H 5AF9H 1MZAA 2J9NA 3HKIB 2C8YB 3DFJA 2AEIH 4MPXA 1AKSB 5L2YH 5FX6A 4Q4LA 1ZMLA 1DE7H 1DANH 1N8OB 1OWHA 5EU8A 3AW0A 2ODQA 1HIAA 1MZDA 1L1NA 1Y3WA 2QC2A 1PQAA 3QX5H 1DXWA 3LJJA 2ZCHP 2BY7X 1SGYE 3KF2A 2VU8E 1SLVB 4Z1MD 1GJ7B 1QNJA 5FPTA 3HK6B 1G3BA 1MTWA 3H7TA 1SGCA 2HNTF 2PGQB 1BMFD 4X0WU 3RXJA 4ZHLU 2V3OH 2BVXH 3SU5A 3UTUH 3UY9A 1ANCA 2RDLA 1VCQA 5JBTA 1GI4A 1RJXB 1HLTH 4FU7A 1TPOA 2O8UA 3NUMA 4NA9H 4O3UA 1ZGIA 3FVFB 1YLNA 3KHVA 2UUFB 3LC5A 3MO3A 3M5MA 2Y81A 2ZHEH 3E8LA 3E0NB 2J4IA 2QYIA 1Z8GA 4P00A 4X1PU 3QTOH 4WXIA 5HIYA 3GDUA 4JK6A 1AD8H 4Y10E 2A1DB 2WINI 1TX7A 1C1SA 1A7SA 3SGBE 1LHCH 1BBRH 2NU4E 2LNCA 4IC5A 4AFSA 1Y8TA 1P04A 1GG6C 1HRTH 3BTTE 2ODYB 3GDSA 4K60A 4ABGA 1YCPH 1WSSH 3N7EA 1GJ5H 3LOXA 4BAQB 2XCNA 1LQDB 1K1JA 1KLTA 3TIUA 1NESE 1SQOA 1EKBB 3NCLA 5KEDA 2ZTZA 5EXNA 1VGCC 1MKXK 1ELTA 3RXVA 3T26A 1TYNA 4DVAU 2FTLE 4WMEA 5C5NA 2VIVA 5JDUB 1T8NA 2K0QA 4ZCNA 3FKSD 1EAWA 1YC0A 3SQHE 1YPHC 1WDIA 2L6OA 3M3SA 5I25A 1PPEE 5T1VA 5T6FA 3RC6A 3U8OH 2A31A 1W12U 1SVPA 1UHBA 2Z3CA 1OS8A 1WTGH 3U9AH 1OKXA 2GMTC 1EPTA 1HFDA 3GOVB 5EGMA 1ESAA 4GCHG 3ZZCA 1IQEA 4RSPA 1TGBA 2BD9A 5IK2D 2TRMA 1JXPA 2WPKS 1FQ3A 3MNXA 2HGTH 2EC9H 2JJ1D 4H6SB 4A92A 2OC0A 4WMDA 1O5CB 1VCWA 1YYY1 4JMYA 1O2QA 3BTEE 4XDEA 3RMMH 2P8OB 2VINA 1DWDH 4CHAB 1O3NA 4QT8C 1VITG 3C1KA 2DE9A 3LJOA 2GCHG 2Z9IA 3SHAH 4A1XA 2PKAA 1OX1A 1OWJA 5C1YA 1AN1E 1GDQA 3F1SB 4FU8A 5DSFA 3VGCB 1FAKH 1G32B 2J94A 1SB1H 1DITH 1KLJH 3SUFA 1K22H 3LGTA 1CHOG 1THSH 1TNGA 3SZNA 2C4FH 1C1OA 4WMFA 1O2JA 1T8LA 5C0TA 2FI5E 1W2KH 3UR6A 3PV4A 1CO7E 1SC8U 3TH2H 1P01A 3GY6A 1GHZA 4FOUC 2BD3A 2ZI2H 2STAE 2GCTC 1P06A 2VIQA 2ANMH 1GVLA 4GLYA 1UCYK 1X7AC 3R0FA 1O33A 4XBDA 1GL1A 1LCYA 1WXRA 3QUMP 1ZYOA 5GPIB 3KCGH 4TT3D 2OC1A 2IPHA 5FX5A 2BYAX 3T27A 3A82A 3DUXH 4RT0A 3PB1E 1SGQE 3TGKE 3RLWH 1XKAC 3SZEA 3Q3XA 4WF8A 5DP9A 4I32A 1ANBA 2ALPA 1BA8B 2ZQ1A 1C1NA 1ARBA 2D8WA 1DY8A 1YY3A 3ODFA 3ESTA 4GVUA 1PFXC 1EOJA 1C9TA 2FLRH 1W10U 1QB9A 1DICA 1L4ZA 2KZ4A 1O3EA 4AG2A 1ELFA 3QO6A 1C5XB 2XW9A 1BT7A 3MNCA 4NSVA 1IOEA 4B6FA 3SNEA 1FY8E 1AWFH 5FAHA 1S6HA 1OP0A 1TQ7B 2GGVB 3GISB 1V2VT 1C5ZB 1JRSA 1QIXB 1Q3XA 2HWLB 3QK1A 2O9QA 4XE4A 3A8AA 2BX3A 1HAXB 5FL7D 2ASUB 4HGCA 1OWIA 3RXKA 1GBDA 1UTOA 3TJUA 1UK4A 3ZIAD 2ZTXA 3I78A 1V2ST 4Y76A 1QA7A 1DM4B 1ESBA 3A83A 1AB9B 3GCHB 3T2NA 2BD2A 3LT3A 2KFWA 2QV1A 3CNRA 1GMHF 2J92A 1RIWB 1P0SH 5E2PA 4F55A 3VB7A 4ABBA 1CQQA 1C2EA 3ZVDA 3SNBA 3KQDA 1C1QA 2C93B 1AFQB 1T4UH 4KELA 3H09A 1BOQA 4ACAA 1O35A 3OEED 4U2WA 4GCHF 5CDFE 1D3QB 2KCYA 3RUOA 2QXGA 5CMXH 3L6PA 1O2MA 1TALA 3N7OA 5AVDA 5GCHG 2B7DH 2TGAA 1F2SE 1DWCH 1HXFH 5EXLA 1XXDA 4ABHA 1ZTKA 2AIQA 2GZ9A 1O30A 2GJGA 3STJA 1O34A 1UVPA 2C8ZB 4A1TA 5DP5A 1K1OA 2EI7A 2VWLA 4UONA 4B2CA 1TNKA 2BY6X 5AHGH 1GI0A 1EJAA 4IMQA 2OC8A 1EUFA 3RMNH 1O3FA 2GCHF 3LU9B 2ESTE 3RXHA 3RC4A 4J2YB 1BMMH 1FJSA 1BTXA 1SPJA 1ZRKA 1F0UA 1TA2A 3QTVH 4OS4A 3N99A 1D3TB 4NIWA 2F83A 2OUAA 1CBWB 1VITH 4E06H 1HCGA 1LQEA 4IN2A 1YP9A 2CGAA 1BB0B 5EOKA 3ODDA 5JB8S 1P2IA 1XKBC 1C1WH 2AMQA 2ZFFH 8KME2 2QF4A 5A09A 1MKWK 1JMOH 2QN5T 4IW4E 2I6QA 2XXLA 2PKSB 1XUGA 2KAIA 4BAOB 2HNTE 5GIBA 1MCTA 2BY5X 2WV9A 1AWHB 1G37A 2FI4E 3BTKE 1BMAA 1EP6A 2GT8A 3DA9B 5C20A 4DT4A 1P2OA 2FWWA 2WPJS 1N8OC 2G4TA 1SGPE 1PQ8A 2AFQB 1GJ6A 2CXVA 4P02A 1RGQA 3PO1B 1BHXB 1HAOH 2JH0D 1O2GH 3U1IB 2XBWA 1NRPH 1OYQA 1SFQB 2YNBA 4CR9A 3O8BA 2ZU2A 1RTKA 4FUBA 2Z9GA 2F91A 4MPUA 5DP7A 4RKJB 2W26A 3VG8A 3L3TA 2BLQA 3WWBA 5E0HA 1TBRH 2BB4A 2KCOA 1KXFA 1V2KT 3ZZ5A 3I77A 2Y80A 1UK3A 1ETTH 2H1UA 4UEHH 2ZG0H 2WV4A 4CRFA 1FN6A 3PM3A 3AK5A 3TK6A 1V2PT 3EYDA 1NRNH 3P17H 1AVGH 3OYPA 3PTBA 3T25A 2GVFA 1TMUH 2HLDD 2R3UA 3VEQB 1BUIA 3BG8A 5FBEA 1TNHA 2XRCA 3UUZA 3FANA 3ZZ4A 1D6RA 1S84A 4NFFA 2G51A 4X8SH 3VB4A 1UVTH 4CBOA 4OS7A 1ETSH 2R0KA 2A5KA 2XC5A 2VIWA 1QL7A 3KQBA 3S9CA 5BPEA 3UQVA 1ELDE 4NFEA 1E36B 1P2KA 3NRLA 1GMDF 3GY2A 5EJ1A 2FX6A 4D7GA 1SHYA 1G3EA 1ANDA 4YLUA 4YLQH 4F48B 1BHXF 3U8TH 3QZRA 4OS5A 4R8TB 2P59A 4NA7A 1T31A 1KLIH 1OOKB 2BD5A 2FPZA 3ZZ3A 1QB6A 1O2SA 4FUJA 4NIXA 1SLXB 3AW1A 2ZDAH 1XVMA 1ZZZA 1HB0B 4YOGA 1MAXA 3PMJA 3OSYA 1J9CH 2FOHA 1BQYA 1QCPA 3TJVA 4DIHH 3VFEA 1ORFA 4I86A 4ABIA 4K2YA 1IQKA 2M5TA 3MFJA 1O39A 3UQOA 2D26C 4BAKB 1GJDB 2PV9B 1W13U 2C90B 3KGPA 4VGCB 1E1RD 4KTCA 1HUTH 1GI3A 1IAUA 1QB1A 3WW7A 3MU1A 1QHRB 1O2LA 3JZ1B 4I8GA 2OINA 2QAAA 1W0ZU 2A7CA 5E0JA 4AG1A 3ATLA 1B5GH 4NSYA 1F0RA 4OM9A 1BBRK 1KYNA 4IN1A 4YT6H 5DP3A 1NS3A 2ZPQA 1YGCH 1W8BH 1C5UA 3SNAA 3SJKA 5B6OA 1HAVA 3Q76A 2P8OC 4CHAC 5JB9S 1Z8JB 5FXLA 1YCPK 2L74A 1TONA 3OU0A 1ZMJA 3BV9B 2FI3E 2IJOB 1XM1A 1ZMNA 2BLVA 3UNQA 2Z3EA 3NXPA 3RXCA 4WXVA 3VGCC 1H8DH 5A8XA 5KGOA 3MH5A 2A0QB 5C3NA 2FYQA 4X2WA 5F8ZA 4NG9H 2W6JD 1SI5H 1DUEA 1V2LT 1SLUB 3ZZ7A 3A7ZA 1BRUP 1TIOA 4MDSA 4YOJA 2ZECA 3UREA 2UWOA 4Y7AA 5LPEA 1S5SA 4X6OA 1V2JT 3KN2A 4GPGA 3A7TA 2SFAA 3P92A 3SGAE 4UFGH 5J4QA 7LPRA 1MMJN 3TGJE 1FY5A 3K6ZA 1HV7A 1GL0E 2V6NA 1ZGVA 3KQEA 3ZZAA 1ZSLA 3M37A 4OS6A 2J98A 1KDQA 2OXSA 4Y8XA 1AU8A 4MTBA 1J8AA 3F9HA 1QJ7B 1MCVA 5B6LA 1TBQH 4ESTE 4ISHH 1EAXA 1SGFA 3SJOA 2ZCKP 1TPPA 3KYGA 1YPKH 3M7TA 3NKKA 4K69A 1TPAE 1O2XA 4D9RA 1Y3UA 1PPGE 2F3CE 2ZQ2A 3F2FA 4AB9A 2Y7XA 3I29A 4Y0ZE 1P11E 4INHA 4WWYA 1C4Y2 1A61H 3KNXA 2XTTB 2ZEBA 1IQHA 3S7KB 1FI8A 3CP7A 1Z1IA 2ZFRH 4JYUH 2PTNA 1TABE 3PRBA 3BTHE 4U32A 1O2TA 1PPHE 5DP8A 3M36A 3C27B 5F8XA 1DWBH 2JETB 3P8OA 1C5VA 4Q63A 2SGEE 2ZP0H 2WPLS 2QE7D 2VVVA 4BTIB 3ZZDA 1Y3YA 3RXLA 1JOUB 4Q7XA 2GTBA 3T5FH 2R9PA 2G8TA 1UO6A 4RN6A 3RXOA 1SL3A 6GCHG 4NWLA 2GZ8A 1G30B 3TNTA 4Y11E 4WJG2 1KDQB 1GGDB 3SOSA 3PLKA 4JZFH 1QBNA 4B2AA 2ZA5A 3P8GA 1WU1A 1AB9C 1ZSKA 3GCHC 3WWFA 2A4OA 1P3EA 1VKYA 1YKTA 3MH7A 3RXBA 3FOAA 1RIWC 1RTFB 4PROA 2AGGX 2G52A 2QF0A 3P95A 4ISOA 1H8IH 1NPMA 1O2HA 3RXTA 2XBXA 1HAYB 5A0CA 8GCHG 1LMWB 2PW8H 2VB0A 5EQQA 2P3UB 5FCKA 1DS2E 4FUFA 1H9IE 3MO9A 2WPMS 1AVXA 3GICB 4YT7H 1T4VH 2DUCA 2CK3D 4HTCH 1W0JD 1RTLA 2BQ6B 2BDAA 1DUAA 5LPRA 3V0XA 3S0NA 2NU1E 2WZQA 3OTPA 4RI0A 2ZWLH 1E79D 2FM2A 5LPFA 2C8WB 1S83A 3S69A 2V3HH 1ZPZA 1OWEA 2HPQH 1IQMA 2J38A 3QZQA 4GAWA 3TU7H 1HIAB 2YOLA 1DLEA 2QY0B 4TY7A 2ZPSA 4I33A 4MG3A 1CSOE 1NU7B 3QGJA 3ZVAA 5HKKD 5HMAA 2F9BH 2FO9A 1MQ6A 1CBWC 3BSQA 1GBLA 4U01A 1RFNA 2BDHA 1P2QA 2NU3E 2OBOA 3V12A 1C5OH 2DE8A 2FOCA 2YNAA 3LH1A 2F9UA 2A5AA 1FXYA 1IHTH 2XCFA 2KM0A 4XFQA 1Q2WA 1ZHPA 2RA3A 1IQJA 1GBJA 3F9EA 1EJNA 1GMHG 2PKSC 2O8MA 3ZVGA 1H4WA 1Z6JH 2TIOA 3VB5A 4Y79A 1BRBE 2FTMA 1A2CH 1K9OE 3SV2H 1ABIH 1O3HA 4OS2A 1TGTA 1Y5UT 4UFDH 1C1MA 1CA0B 3BTFE 2VWMA 1FY4A 1O3GA 5AFYH 1V2UT 1VZQH 3ITIA 4BNRA 5CHBA 2J95A 3PO1C 4H42U 2FIRH 2FODA 2BM2A 4FUDA 1FIZA 1P3CA 2CV3A 2PFEA 4XBBA 2THFB 3RMOH 1LKAA 1FY1A 1UVUH 5IDKA 1V2OT 4GHQA 2TGDA 4B73A 3UOPA 3GY5A 4IC6A 1DXPA 5EQRA 4BXSA 3HPTB 4TY6A 4YXWD 5C2ZA 3FP8E 3BF6H 5T3HA 1AE5A 3ZZ6A 2FS9A 1NFXA 1S85A 3UFAA 3RXMA 5FHTA 2BDBA 1O5EH 2A32A 3P6ZB 4DT7B 3PMBB 1GHXH 1GI7B 5GWZA 1GPZA 4CRBA 1C2GA 2ZGBH 4KKDA 1AMHA 3LONA 1E37B 1D9IA 2WV5A 1DOJA 4WVPE 1TMBH 1BTYA 1Z71A 1UHBB 1AUTC 1D6WA 6GCHF 2BVSH 1YPMH 2VIOA 1EPTB 1GJBB 1G2MA 1W0YH 2BDGA
chains in the Genus database with same CATH topology
2VNTA 4NCYA 4FXGH 1E34B 1O2ZA 2BD8A 5DP6A 2ILNA 2ZHWH 4NA8A 1C5SA 2B5TB 3RXGA 1TRNA 3PLBA 2FEQH 3FAOA 1N6XA 2OQUA 1S0RA 3M61U 1KTTB 1IQLA 1O3JA 1ELAA 1TRMA 2Y5HA 1FMGA 2ZFPH 4ZXXH 3BEUA 3V3MA 1A3EH 1IQIA 1HJAC 2AS9A 1O3OA 1GBAA 3A87A 8GCHF 3SQEE 1KIGH 1OSSA 2G4UA 1J16A 4KGAA 1V2TT 2VIDA 2PKAB 2VJ1A 4O3TA 3TNSA 1BRAA 1UTLM 1V2QT 4BAMB 3ATIA 1LHDH 4LXBH 1TBZH 1K1NA 4GSOA 1C9PA 1Y59T 3GY4A 1MTUA 2Z7FE 4MNYA 2J34A 3M7QA 2GV6A 1ARCA 2Z94A 3IITA 2Z9JA 1ABJH 1QBVH 4VGCC 3TITA 1XXFA 1SGTA 2B8OH 5C1XA 3EE0B 2ZGJA 3O8RA 4ZUHA 4DY7B 4SGBE 2C3SA 1CT2E 2FYRA 1QL9A 4BTTB 3TLOA 4XOJA 1P8VC 4ZHMU 3ZZBA 3A8DA 2R2MB 3QWCH 5CHAB 5DKMA 1ZHMA 1T8MA 1O0DH 3URDA 1MUEB 5JBCS 5A0AE 1FLEE 2H9TH 1F5LA 8LPRA 2XC4A 1TOMH 2ZF0H 3SJ9A 4UFFH 1GMDG 2ODPA 1C2FA 2A7JA 1PPFE 4B1TA 3LIWA 1O5DH 2G5NA 1O3MA 4X8VH 1B0EA 1LVYA 2Y5FA 4X1RU 2B9LA 3QGNB 1F7ZA 2RG3A 3T29A 5DJ7A 3O8CA 4JZEH 3M35A 2A2QH 2HOBA 1EASA 6CHAC 3E3TA 3RM0H 1GMCF 4CBNA 2WPHS 3M3VA 2QXHA 5DG6A 4U30A 1GBKA 2BXTH 3B9FH 4OS1A 1NY22 1CT4E 5IYTA 1XUFA 3A8BA 1AHTH 3E16B 5E2OA 3U8RH 4AOQA 1UTPA 1IQGA 2Q6DA 9LPRA 4INKA 4MQAA 1GI9B 2FLBH 1F5KU 5G4BA 1MH0A 4X6PA 2HNTC 2TPIZ 2ZO3H 3LH3A 1F5RA 1GHYH 5T6DA 2HPPH 3RM2H 1BIOA 3A86A 1CVWH 3SI3H 2PHBA 4SGAE 1B7XB 5EPNA 3MU4A 1OP2A 2K1QA 5FPSA 4R0IA 5JBBS 4ZMAH 3TPIZ 2BD7A 1QJ6B 1BCUH 1ELGA 1V2MT 5BRRE 2SGAA 3PMAB 3CS0A 2GT7A 3UIRA 2Y7ZA 1MBQA 1ZLRA 3UOUA 3A89A 1BMNH 5HM9A 1AO5A 4ZKNU 4FUEA 3TJNA 2JETC 1KXBA 1VGCB 4ABJA 3ELAH 3LGWA 1YCPM 2CF9H 3A7VA 2FS8A 2TBSA 2CF8H 4ISNA 3RXRA 3VXEH 1QJ1B 3BIVH 2AIPA 3EA9A 1XUIA 3D23A 1VCPA 2OP9A 1GHWH 1UVSH 1LVOA 2ZDLA 3NK8A 1QBOA 3GY3A 1SHHB 2OLGA 3U69H 1NU9A 1EZXC 3SU0A 3UNSA 2V35A 2CMYA 4H6TA 5HGGA 1GBTA 1SGDE 1SMFE 3E6PH 7GCHG 2ANKH 2GMTB 2ULLA 2UUKB 5FBIA 2AMPA 4I8KA 1ZPBA 4MPVA 1TLDA 2F9NA 2NU0E 1YLDA 2W5EA 2O8WA 1GI1A 2G00A 1SLWB 4O97A 1PYTC 3BG4B 4ISIH 3ZV9A 4WY3A 5LH8A 1P05A 3W94A 1OYTH 1OWDA 1GDUA 1JRTA 3HKJB 2VH6A 2H5DA 1A5HA 1UTJA 2EI8A 3SI4H 2BLWA 2ANWA 2R0LA 3OX7U 3TGIE 1AE8H 2QIQA 3LC3A 3ZYEA 2H9EH 2KAIB 5A0BA 4A6LA 1VJ9U 2ZZUH 1PPZA 3HATH 3EA7A 1TRYA 1O2NA 4Y8ZA 4H4FA 2WUCA 2NU2E 1QA0A 1UTMA 3MTYA 1WYKA 4E7RG 1S81A 3GY8A 3D62A 1O3IA 1SGIB 1V6DA 3MU0A 4FVBA 4Y0YE 2HALA 5C67A 2FZZA 1LKBA 2H2ZA 1D4PB 3A85A 1BDAA 1KTSB 1C5LH 1Z1JA 3TH3H 2AMDA 3MMGA 1P2JA 1FNIA 2Y82A 2OQ5A 1GHBF 3GCNA 1C5TA 3NZIA 1GBMA 1ZSJA 1OP8A 1FPCH 1C5QA 3URCA 1EZUC 1V2NT 3PWBA 1O2VA 1L2EA 1O2PA 1HJ8A 1PQ5A 2GDDA 2CHAB 2OC7A 4NIYA 1TAWA 5L6NH 1MU6B 2A4QA 1GVKB 2GP9B 2XC0A 1AIXH 4ZAEA 2ZHQH 1KXAA 2EEKA 1L1GA 3IWMA 1QY6A 3LGVA 1GJ8B 2ZU5A 1O2IA 2PTCE 1BTHH 1MBMA 3UNRA 3M5LA 2BDYA 2O8LA 3MNBA 3UR9A 1C5RA 3A8CA 4M7GA 1ZTLA 3FZZA 4LZ1H 5A2MH 1H9LB 1SBWA 3MYWA 1FN8A 1CA0C 2A2XH 1JIRA 3ATWA 5ESBA 1P2MA 1GDNA 1NTPA 1YPJH 1JBUH 1EB2A 1C1VH 3M3TA 2BQWB 3PWCA 5EG4A 3SV7A 3ZYDA 2Z6BD 1C2KA 2PLXA 2AERH 2QGRA 1FDPA 1EZQA 1KXDA 1PPCE 5E0GA 4AGJA 1DLKB 1OPHB 1WV7H 2FP7B 3RXSA 5PTPA 2A5IA 1A0JA 2GD4B 2W3IA 3OY5U 5ABWA 3SN8A 1LTOA 2UWPA 2FOEA 3EQ0H 4UD9H 1SGNE 1KY9A 4X1NU 2BY9X 1Z8RA 4YESB 1ELVA 4Y6DA 1ZPCA 1QR3E 2ALVA 1EP5A 2R3YA 1SFIA 2ZGXH 3PMHB 1TPSA 4KP0A 4DOQA 3SNDA 3B8JA 5F8TA 1PJPA 1O2OA 1E38B 3MU8A 1SGFG 2PR3A 2Z3DA 4B71A 1DPOA 3Q3YA 3AAUA 4DGJA 1JIMA 1PPBH 1EPTC 1Z7KA 7GCHF 4E05H 4AFQA 4J1YA 4IMZA 4X2YA 3RU4T 4ZXYH 4K1EA 2PSXA 5FCRA 5TCAA 2VVCA 4TWYA 1P9UA 1DWEH 2ANYA 3EAJA 3IG6B 2CN0H 5EPYA 1O5FH 5SGAE 1LPKB 2W3KA 3JZ2B 1G2LA 5AFZH 2TGPZ 4BANB 3QLPH 1F0SA 2BY8X 1HAPH 2ZFQH 4CH8B 1HAVB 1Z8IB 3GYMA 4Q2KA 4O03A 4JYTA 1CGJE 1O3DA 2JKHA 1O5GH 2TGTA 2SNVA 1DFPA 4ZKOU 1GBBA 1BITA 1O2YA 1NM6A 3FFGA 2ZKSA 4K3JA 2ZGHA 1UTKA 3OTJE 1J14A 2XWBI 1UK2A 3SJIA 4MVNA 2RA0A 1MD7A 1THRH 2FOAA 1DSTA 3TJOA 4X8TH 1INCA 4X6MA 3EDXB 1SQTA 1MTSA 5K7RA 1P09A 4Y8YA 1GHVH 4NZQA 4Y7BA 1MTVA 1TNIA 5GDSH 3RXIA 5CHAC 3P8FA 4A1VA 5GJ4B 1Y3XA 1P57B 1DSUA 2FDAA 1WTHD 4ABAA 1QRZA 3ENSB 1WAYB 4OGYA 1V3XA 1F0TA 1O38A 6LPRA 7KMEH 4BAHB 1A1RA 1ELBA 8ESTE 5ESTE 2NWNA 1O2WA 3EA8A 1QURH 1YPEH 1N1LA 4TPIZ 1ZJDA 1AFQC 1FUJA 3HK3B 3RU4E 2D1JA 2JH6D 3QDZB 1O31A 1A3BH 1L4DA 1LHEH 3MI4A 3GCOA 1PQ7A 4AB8A 2Z9KA 4A5TS 4THNH 3VB3A 1AY6H 1EOLA 2BDCA 1OWKA 1W11U 1A0HB 3SU4A 3FP7E 3UWIA 1GCDA 3TK9A 1PYTD 1P02A 1FIWA 2VGCB 1LPZB 4YZUA 3PTNA 1HXEH 3STIA 3GYLB 1GJAB 1LHFH 3F6UH 3RXUA 3RXEA 1M9UA 2BOHB 1AUJA 4I8HA 1UCYE 1EB1H 1EQ9A 1QQ4A 4HI3A 3WY8A 1GJCB 4UE7H 5CE1A 4DIIH 3RP2A 1LDTT 4AFUA 2H6MA 2AGEX 4ASHA 1RRKA 1YLCA 2QF3A 1C5YB 4D9QA 1ANEA 3SU6A 4B75A 1V2RT 3BTWE 3H5CB 2FMJA 2W7SA 2WYGA 1C2MA 2BZAA 1RXPA 4K8BA 1KXEA 2XNIA 1EXFA 1YPLH 3E1XB 1TNJA 3UWJH 3CS7A 3T28A 1AGJA 1GVZA 2ZFSA 1K1IA 2D2DA 4FU9A 1H9HE 3S7HB 1FONA 2BQ7B 4E7NA 2OTVA 1J15A 2ZFTA 4X8UH 2WUBA 1GWAA 1GMCG 3EGKH 4X6NA 3O8DA 2H5CA 1C5MD 1QRXA 5JBAS 3DHKH 1TQ0B 1O3PB 4D8NA 1CHGA 1G3CA 1KSNA 3BG4C 1C1RA 1ELEE 1K1MA 5FPYA 1O36A 1BTPA 3A81A 2IN2A 1Q31A 2ZTYA 4FUGA 3MH6A 2BDIA 1YPHE 1WOFA 1O2UA 1GJ9B 3BEIB 3SW2B 4X2XA 4O9VA 3BTGE 4UDWH 4FUIA 3ZVFA 3SHCH 1ZHRA 4XSKU 2GV7A 1Y3VA 2Z9LA 4AFZA 2BOKA 4MNWA 1CGIE 3HGPA 3AASA 1C2HA 1XVOA 1MTNB 3F68H 1O2KA 4JK5A 4NGAH 2SGPE 4MNXA 4K5ZA 2ZDMA 1U6QA 3RXDA 3S9BA 3P8NA 1XUHA 3PLPA 2UUYA 2VWOA 2GZ7A 4K1SA 1K2I1 4CRGA 4DW2U 5GXPA 1EX3A 4FUHA 1O5BB 4DG4A 4F4OC 3TVJB 3V7TA 3SV8A 3S9AA 4JZ1A 1NFWA 3PROA 5F6MA 2ZDNA 4BXWA 1BMLA 4K8YA 1TA6A 1T7CA 2C8XB 2EI6A 1TOCB 4XBCA 1DT2A 1SOZA 2A7HA 5TCCA 3PYHA 2FOGA 2CHAC 1THPB 3V13A 3SO3A 3BEFB 3SU2A 2ZIQH 3Q00A 4A7IB 3A7XA 4X1SU 1C2IA 1C5WB 1C2JA 2ZHDA 4NZLA 2UUJB 1BTZA 4X2VA 4Z6AH 4DJZB 3SU3A 3RDZA 1DDJA 1NZQH 4I31A 3RXPA 2WYJA 3ZZ9A 3MO6A 4KTUA 3CENA 3M5NA 3ZVBA 1TGSZ 3HGNA 1ZR0A 3NWUA 3SORA 3BN9A 1GCTB 2P3TB 3H7OA 5EODA 1EATA 2GKVE 1MAYA 1UJ1A 1NO9H 2XWAA 3MNSA 3RXFA 3ZZ8A 4WH6A 1CU1A 1TX6A 2ZDKA 1GI5A 1E35B 2XYAA 1HAHH 2ZU3A 1XUJA 2XBVA 2BMGB 1H1BA 1QGFA 1NFUA 4ZKSU 2SNWA 3RXAA 1P2NA 3SJ8A 5HM2A 3SU1A 1LPGB 2Q6FA 4WH8A 5JPMH 1A4WH 1P03A 1GBHA 1BTWA 2ZNKH 1NT1A 1O32A 4BTUB 4B76A 1C1TA 1GHBG 1TMTH 3DFLA 1MKXH 3E91A 1BRCE 1GBFA 1C1PA 1C4V2 2QCYA 2A4GA 1BZXE 4MLFB 1L1JA 7ESTE 3SUEA 4FVDA 3VXFH 2VIPA 1XX9A 3RU4D 5JYIA 1GBIA 3BTDE 2BHGA 3A80A 2ZGCA 4JZDH 1TGCA 1ZJKA 3KL6A 4LOYH 6ESTA 3ZVEA 4ABFA 3UPEA 2AGIX 3MU5A 1Y5BT 2Q6GA 1D3PB 1T8OA 4OGXA 4NIVA 2P95A 2AYWA 1P12E 1IHSH 1DX5M 2OBQA 1F92A 1QL8A 4AX9H 3RXQA 1B0FA 1RS0A 4Q7ZA 3MWIU 5H4IB 1O2RA 3ZV8A 5DO4H 2F9OA 4TWWA 1GI6A 1ACBE 5C5OA 1J17T 3KIDU 3BTME 3TK5A 4ZHAA 1O3CA 1HBTH 1P9SA 2JH5D 2LPRA 2J2UA 1O37A 3M5OA 2A45B 2H9HA 1VITF 1WBGB 5C1UA 1GHAG 4ZROA 1GG6B 2P16A 4AYVB 3E0PB 1C4U2 3A84A 2F9PA 1QRWA 1SG8B 4TYDA 2GX4A 1TNLA 4FUCA 1HAGE 3A7YA 1Y5AT 4ZKRU 3MOCA 3SGQE 1CHOF 1SGRE 5A8YA 3L33A 4JZIA 1VJAU 1XUKA 5EXMA 2STBE 4D76A 4MPWA 1FPHH 5TJXA 1W7XH 1BJVA 1G9IE 2AH4X 2VVUA 2PGBB 1WQSA 2XBYA 3OY6U 1IQFA 1VR1H 1T32A 3SUGA 1LVMA 1HJ9A 4MNVA 1GJ4H 3RC5A 1FY3A 4AGKA 1GGDC 1D3DB 1AZZA 1Z6EA 1W14U 1UCYH 3SNCA 3RMLH 3K2UA 1FAXA 4KTSA 1JWTA 1TB6H 2BD4A 1LVBA 3AVZA 1ESTA 1BBRE 2R2WU 1HPGA 1QQUA 1G36A 1QTFA 1SSXA 4DURA 4HFPB 4NWKA 3U98H 2V0BA 3Q77A 2SGFE 3QN7A 3W95A 1NFYA 4LK4A 2Q1JA 4TPYA 3D65E 1CE5A 4LZ4B 3MH4A 4YO9A 5L30H 1YM0A 4I7YH 4X1QU 4UFEH 1BTUA 1TGNA 1TX8A 3SV6A 4BOHA 1K28D 1NC6A 2VGCC 1GI2A 5I46H 1G3DA 1O3AA 3SBKA 1IQNA 1K1PA 2PWXA 5T6GA 3GCTG 3FZDA 1FV9A 1NROH 1WQVH 3DT0H 1C5NH 1LO6A 1YPGH 5F03A 1A46H 1WCZA 1N6YA 5J4SA 2GCTB 4YTAA 1K21H 4CH2B 5EQSA 2ZCLP 1MD8A 3LGYA 9ESTA 1C2LA 5HYOA 5DK1A 1W7GH 2A4RA 3G01A 1TE0A 3KQCA 1RD3B 1W3CA 1ELCA 2FESH 3LKWA 1ZRBA 2G5VA 3SV9A 3A7WA 5LGOA 1HJAB 4GUXA 3SUDA 1HGTH 4IBLH 2BXUH 4Y71A 4CRAA 1SGEE 1CA8B 5A8ZA 4I8LA 1GBCA 1QFKH 4RKOB 1O3LA 4DCDA 1MU8B 1GI8B 5GCHF 4YM9A 1ID5H 3ZVCA 1GBEA 1YBWA 4JYVH 5DGJA 2ZDVH 1K1LA 3K65B 2FOBA 2HLCA 3AAVA 2FXRA 1ZOMA 2Y5GA 2PUQH 4Q7YA 3K9XB 2W7UA 2FOMB 1EZSC 1S82A 3F9FA 2G55A 1E0FD 2BVRH 1UVOA 3BIUH 1GHAF 2B0FA 4IGDA 4AZ2B 2HRVA 2FX4A 5ETXA 2WPIS 3T62A 1CGHA 1UTQA 4AN7A 1HYLA 2ZU4A 4I8JA 5DP4A 1SQAA 3P70B