4NCYA

In situ trypsin crystallized on a mitegen micromesh with imidazole ligand
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Hitting the target: fragment screening with acoustic in situ co-crystallization of proteins plus fragment libraries on pin-mounted data-collection micromeshes.
pubmed doi rcsb
molecule tags Hydrolase
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2013-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ncyA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ncyA02
1QRWA 2RA0A 2ZU5A 1L2EA 3ITIA 3U8OH 4Y7AA 1ZTKA 1J9CH 5SGAE 2ZGHA 4AG1A 4ZUHA 1OPHB 4A1XA 2G51A 3DUXH 3SUFA 4B2AA 1HJ8A 2FYQA 5C1XA 3SU0A 6ESTA 1O2OA 1EXFA 1QIXB 4NIWA 1Y3WA 3RM0H 1DUEA 4D8NA 2WPMS 4UE7H 1DITH 2OC7A 1TFXA 2ZHEH 3SV7A 4ZROA 1CQQA 3RUOA 1TBRH 9ESTA 1QR3E 3A81A 1AHTH 1TNGA 1ELDE 1UJ1A 1XKBC 4IC5A 1PJPA 1O2IA 1GVKB 3C27B 3EA9A 4I8HA 1KY9A 4YT7H 2A2QH 3EGKH 1AZZA 3U9AH 6LPRA 3ZZ7A 1XMNB 4B76A 4X0WU 5LPFA 1TQ7B 2XC4A 4NIXA 1V2RT 1F7ZA 2EA3A 4OGXA 2ZGBH 2C90B 1J8AA 1V2VT 1TNHA 2CF9H 2JH5D 4ZKRU 1YPHC 3B23B 5FX6A 3SO3A 1QA7A 1ANEA 3P8GA 2F9PA 4HFPB 2BY7X 2P3TB 4MNYA 4CRBA 3SV6A 3HKJB 4ZAEA 1GJ5H 1H8DH 1GHXH 1Q31A 1NFYA 4XOJA 3A84A 3BTME 5FCKA 3T25A 4F49A 5LPEA 4OS2A 5K7RA 1TONA 1GHBG 2GT8A 1DE7H 1CE5A 1Y5AT 1UTJA 1MQ6A 6GCHF 1W8BH 2GCTC 5DPAA 1DY9A 4AYYB 4ABBA 4K1TA 4K2YA 3TK5A 3UWIA 3A83A 1KXDA 3A8BA 3ZZBA 3VGCB 1TOMH 1NY22 1SGYE 5LH8A 2ZHDA 3VB5A 3TGJE 4I31A 2H9EH 2Y6TA 3BSQA 4MQAA 1P03A 4I8LA 1C2HA 2FPZA 2F83A 4OS7A 2SGDE 5JDUB 3Q3XA 1SFQB 3ZVAA 1BMNH 1O3DA 4MDSA 1C5LH 2BQ7B 1BJVA 2VINA 1RTLA 1TPAE 2VWMA 4AGJA 3NKKA 3BTGE 3GCTG 2CV3A 2Y5GA 2K1QA 1C5OH 1A61H 1EX3A 3LH3A 3U1JB 2F3CE 4ZXYH 1GBDA 2BD8A 3SV2H 1FQ3A 1GHAG 1C1UH 1JRSA 3SJIA 2GP9B 1YPLH 1O38A 1W7GH 1W10U 1Z7KA 2BLQA 4XBBA 4INKA 3A85A 5HMAA 1L4ZA 3MO9A 4CR5A 3A7VA 1SQAA 1ANBA 4WXVA 4Q2KA 1TX8A 5G4BA 3S7HB 1AO5A 3T62A 1HJ9A 2XRCA 3L6PA 3ZZ6A 1D3TB 1MBQA 1O3PB 1P57B 1MZAA 2ZGCA 1O3KA 1MUEB 2D1JA 1RTFB 1H9LB 1BHXF 1ELGA 3H7OA 3RC6A 4ZHMU 1C1NA 1YF4A 3OYPA 1TE0A 1TPSA 3QN7A 3FZDA 1CBWB 1A4WH 5ESTE 5F8ZA 1ZHMA 5JBAS 1BTPA 4LZ1H 2ANKH 4K69A 1DICA 1FPCH 3CS7A 5DP6A 2UWLA 3MNXA 2WPHS 3GY8A 4X8UH 1GGDC 1WBGB 4QT8C 5GIBA 2PSXA 1O32A 3SJKA 1DY8A 1LVYA 2QV1A 1HAYB 5JB8S 3V0XA 5FBIA 1UCYH 1K9OE 3R3GB 3RXVA 3RXGA 5PTPA 1OX1A 4A7IB 4CRFA 4Y71A 1V2UT 3PTNA 2XWAA 1ZSKA 3U69H 3VFEA 1W11U 3ZVDA 2ZFFH 1DANH 1AKSB 1XXFA 1AUJA 1Z71A 4ABHA 2QXHA 4Z6AH 3RXMA 2BY9X 5CHAC 2UWPA 1TMBH 4O97A 1O2XA 3TK9A 1O2TA 3RXAA 2ZG0H 3IWMA 2A5KA 1UVTH 1AUTC 4M7GA 1V3XA 1WUNH 1V2NT 2A4QA 3SJOA 3FP8E 1FZZA 1V2ST 2O8TA 4BAKB 5GCHG 4TYDA 3SJ9A 1HV7A 2VVCA 1ELBA 1F5LA 1ZJKA 2OINA 4R8TB 3P8FA 5JYIA 2BB4A 4B2CA 1UO6A 3RXKA 4UDWH 4CHAC 1UVSH 3EYDA 1GI2A 4K5ZA 4LK4A 3M36A 4ABIA 1GJ7B 3OTJE 1GPZA 4FXGH 2RCEA 3VPKA 1TRMA 4H42U 4AB9A 1LHDH 2SGPE 1UK2A 3BEIB 1QCPA 1HIAB 1S0RA 5I46H 4O3UA 3TNSA 4BTIB 3I78A 4ZH8A 3GY6A 1K1JA 1DFPA 9LPRA 3SU2A 5C5NA 1L1GA 1C1QA 1ZMNA 1MKXK 1T8NA 3SOSA 4AGKA 2GCTB 2CHAB 1UHBA 1ZJDA 3LPRA 1ARCA 1LQDB 2PWXA 1RTKA 1KXFA 2VJ1A 3TJVA 1ELCA 1MU8B 4K8BA 4GPGA 4RKOB 2AGEX 1P10A 1P3CA 3BTTE 5EU8A 4YOGA 2H5DA 2H1UA 4Y6DA 1DS2E 2P3UB 4B73A 2V35A 1O5AB 1LVOA 4YLUA 2Z3EA 1N6XA 1NU7B 2SFAA 1TGBA 2LNCA 1O2QA 5GXPA 1G32B 4FU9A 2VIDA 1LPGB 3MHWU 3UQOA 1BMMH 3T27A 3A89A 3BEFB 3A80A 4AORA 1OWDA 1IQFA 4IN1A 1QNJA 1SVPA 3Q77A 1FIWA 1AE5A 2FDAA 2WYGA 1E34B 4SGBE 2ZCKP 2ZFSA 3B9FH 3F6UH 1ANDA 4X8VH 1YLCA 1Z8JB 3S9AA 3M37A 1TBQH 8GCHG 2WUCA 5AVDA 1AFQC 4LXBH 2RDLA 1G2LA 1CHOF 4X1QU 1SFIA 3G01A 1TABE 1QJ1B 4NA7A 1UK4A 2FS9A 2G4TA 2XWBI 3VB4A 2Y7XA 3M3VA 4U32A 1GJ8B 2ZPRA 1ZMLA 1YM0A 3U1IB 1YC0A 2AYWA 2P3FH 5TCCA 5F8XA 2UUYA 4DIIH 1IHTH 3GISB 5E0GA 2A32A 1MD7A 1DUAA 1T4VH 4CRGA 1INCA 1LVMA 2KAIB 3RXIA 3SNCA 2AS9A 4MLFB 2GGVB 1GGDB 3AAVA 1EB2A 2Y5FA 3ZZ5A 3QUMP 4H6TA 4X6OA 3RU4D 4ISIH 4MNXA 1DWBH 1IQEA 1P05A 1HPGA 3ZZ9A 2F9OA 1T32A 1P02A 1LDTT 3MTYA 1CGHA 1LHEH 2BHGA 1G37A 2FOFA 3E90B 3T5FH 2B9LA 2VNTA 2XC0A 4WXIA 1J14A 1LO6A 3BTHE 1HAHH 2QYIA 1OP8A 3KQBA 3O8DA 1KXCA 1GJCB 1HFDA 3SU6A 3PTBA 2M5TA 1KXEA 3L3TA 4DURA 2F9VA 1FJSA 1IQIA 2DE8A 3ZV8A 4WH6A 1ETTH 4NWKA 3RMLH 3RXJA 3SV8A 1LTOA 5E8EH 5LGOA 1QQUA 2CGAA 1C2GA 5DP4A 1KTSB 1V2QT 3PWCA 4O03A 5AF9H 5EW2H 1AWHB 1F92A 3SQHE 3EA7A 4CHAB 1LKAA 2HPPH 1PYTD 4YO9A 2H5CA 2ZU3A 6CHAC 5EXNA 1EQ9A 1XVMA 1PFXC 4H4FA 5EW1H 2BYAX 3AVZA 3ATKA 2HOBA 1ABJH 4ASHA 1C4V2 4PROA 3GCOA 1NROH 3QTOH 1FLEE 4ZKSU 3E6PH 1C5UA 2AIQA 2XNIA 1VCPA 4HI3A 4DJZB 1CHGA 2H9HA 3LU9B 4U2WA 2VIWA 1GBEA 1K2I1 2ZNKH 3UQVA 3ATWA 1EAUA 1FI8A 3CP7A 5FPTA 1GHWH 3PROA 1P2NA 3SUGA 5E0JA 2ZO3H 1GBBA 1XM1A 5EGMA 4GVUA 1W3CA 3LKWA 1LHGH 2O8WA 4XBDA 3RXLA 2Z6BD 1Q3XA 1Z6EA 3SJ8A 5JB9S 1D3DB 3GCHC 3NXPA 4A1TA 1QL8A 3E0PB 1BTXA 3MWIU 1EPTB 3T26A 2FESH 3FFGA 1QBOA 1ZRKA 4IW4E 4WVPE 4XSKU 3B8JA 3SGBE 1SGDE 3ELAH 1NN6A 2FEQH 2HALA 1C2JA 1O3OA 1O2SA 2OD3B 4YESB 4IMQA 1EAIA 3E3TA 1GCDA 4GSOA 2BZ6H 4I32A 2ZECA 3FP6E 1FY4A 4X2XA 1HAXB 1O2RA 1T8LA 3M7QA 1V2JT 1LKBA 4CRCA 4X1RU 3D62A 1KIGH 1E35B 1UTMA 1Y5UT 1S6HA 1A5IA 1TPPA 4JMYA 2WV4A 5FX5A 3U8TH 1K1OA 1N8OC 4BTTB 3UY9A 3TVJB 2NWNA 2ZCHP 1O2JA 3OX7U 1OYQA 2QXIA 1D6WA 1AVGH 2XTTB 2PKSC 4B2BA 2D2DA 1O36A 1O5CB 3F1SB 1RIWB 4K1SA 3LGTA 1T8OA 1ARBA 1Z8IB 4IC6A 3S9CA 1O3MA 3SNBA 4WMFA 1S84A 1GBKA 1JRTA 1OSSA 4FVDA 3A8DA 5EXLA 2YNAA 3UNSA 3I29A 3MNCA 1B0FA 3MOCA 1O2WA 3SN8A 1MD8A 3TNTA 1TIOA 1HB0B 2BXTH 3RXBA 1JBUH 1O34A 2ZZUH 4X2VA 2FX4A 1XUJA 4UEHH 2IPHA 4Y8ZA 2BDBA 3OSYA 4XFQA 1BTWA 3Q3KA 1NM6A 3MU1A 1ZPBA 2FMJA 1TNJA 4O9VA 5FBEA 1YKTA 2SNVA 1TNLA 2ZPQA 1OYTH 1QBVH 1PQ8A 3SNEA 1DXWA 1UTLM 1DSUA 1VITF 2IOTA 2RA3A 1GL1A 3LT3A 1SQTA 4CR9A 2BOHB 1GDUA 4DW2U 4YLQH 2BXUH 2SGEE 4U01A 2TIOA 3RXTA 1TX6A 4Y11E 1NFUA 1ZSJA 3KQEA 2GVFA 5HYOA 2JKHA 2D8WA 1PPHE 2VWOA 1O3CA 3SNAA 4MNVA 4JZEH 3SU3A 3M5MA 2G81E 5DP5A 5T3HA 3VB6A 2FOMB 1HUTH 1ETSH 3SU5A 1ZLRA 1GVZA 3P70B 1QQ4A 6CHAB 2GZ8A 1VGCB 2A7CA 5ETXA 1KLIH 1O3GA 1UTPA 5ABWA 1BDAA 3MU5A 1EB1H 2B0FA 2PW8H 1HGTH 4YM9A 3S0NA 4NFFA 2H9TH 4DT7B 4FUFA 1MKXH 1C9PA 2SGFE 1TBZH 1ABIH 2R0KA 3S7KB 1AKSA 3RC4A 5F8TA 1QL9A 4NFEA 5L30H 2ZFRH 1O3EA 3F9HA 1O5DH 2FOHA 3DA9B 2QIQA 3PYHA 5A8ZA 1LHCH 3Q76A 1E38B 4THNH 1W13U 2R2WU 2Y80A 5FPSA 1P2KA 3RU4E 4CH8B 4R0IA 1O33A 4B74A 4ABEA 1M9UA 2A7HA 3UOUA 4BOHA 3RXEA 3SUDA 3PO1C 1O2NA 4TPIZ 3TPIZ 1BA8B 1A7SA 1G3CA 2UWOA 2QXGA 3GCHB 2BD9A 2ANWA 4NIYA 1DWCH 1GDQA 1TA2A 2BDYA 2JETC 3R0FA 3DFLA 1QJ6B 5DJ7A 3TH4H 4BAMB 4Y0YE 1TNKA 1UVPA 2ULLA 3TGIE 1UVUH 1GHBF 3AW1A 3Q3YA 1GJBB 3ATIA 4FUGA 2XXLA 3MH6A 1TRYA 4YZUA 4RN6A 1C5MD 1A3EH 2W7SA 2A1DB 1GL0E 4H6SB 3GY3A 1A0JA 3FZZA 1KSNA 4ISOA 3O8RA 1P06A 1UTKA 2A7JA 2AERH 1TGSZ 4DIHH 2P95A 2ANYA 2ANMH 2AFQB 2ALPA 1SGTA 2YOLA 4MPWA 1O2MA 2BVXH 4AZ2B 1YBWA 1N8OB 2ZCLP 1P01A 1DXPA 4FUJA 4NWLA 1O2VA 4JYVH 2BM2A 1HJAB 3ATMA 1GI4A 2QA9E 1JXPA 2VIPA 3UPEA 4I8KA 2AH4X 3LGUA 4ZHAA 5TCAA 3TU7H 5LPRA 3T28A 1CVWH 1V2MT 1Y8TA 2PR3A 1QY6A 1SHHB 1UTNA 5HXFA 3GCTF 1BBRE 2ODQA 5ESBA 3QO6A 3W94A 2VWNA 2BDAA 3BIVH 1VCQA 2GTBA 1BUIA 2J2UA 3MNSA 3VXFH 2OLGA 1MAYA 1ZR0A 1B7XB 2O8MA 1BOQA 4B71A 4BAOB 2C93B 2G52A 3K6YA 7ESTE 1IQHA 5BRRE 3UUZA 1VJAU 2A2XH 3P8NA 4O3TA 2H2ZA 1MTUA 2J95A 1Y5BT 3UOPA 4DGJA 2PGBB 1SB1H 1ZRBA 3STJA 4DCDA 1MTNC 4YT6H 2IJOB 1GJAB 1HRTH 4TWYA 1D6RA 1P2IA 2ZKSA 3MH7A 4D9RA 4WF8A 4IMZA 2GMTC 3ODFA 4TY7A 1XKAC 1TMUH 1TA6A 2OC0A 3ZVGA 1NT1A 1ZGVA 3TJUA 4F4OC 1C4U2 1MH0A 1C1SA 2FXRA 4GHQA 2BX3A 1JWTA 3A87A 4HGCA 2G55A 5FPYA 1ZMJA 2FOEA 3E91A 2P93A 1G9IE 2C8XB 3QGJA 1BZXE 2ZI2H 2FS8A 5AFZH 1F0RA 1DPOA 1AI8H 2SGQE 1JIRA 2FM2A 1BBRK 2W5EA 3BIUH 3M5LA 4D9QA 1IQMA 1THPB 2Z9KA 4NZLA 1B5GH 3E0NB 1YCPK 1MCVA 3ZZ3A 2YNBA 1LMWB 3GDVA 1NO9H 1BMLA 1EOLA 5EXMA 1ELAA 5DP3A 3RMOH 2J9NA 3A7ZA 7KMEH 1FPHH 1YLDA 4NZQA 1YYY1 2G8TA 2ZIQH 1NRNH 5AFYH 2P16A 4IS5A 3FANA 2GDEH 5C1YA 4TWWA 1WSSH 3UWJH 4X6PA 5C20A 5T6DA 3SZNA 3H5CB 2AEIH 1C2DA 3A7TA 1VITH 3VB3A 5CMXH 1FN6A 4WJG2 1K21H 1MAXA 3UIRA 4FUHA 2PTNA 2BQ6B 2FOCA 1PQ5A 3PO1B 4BNRA 2FOGA 2HNTF 2WINI 1GBLA 1A46H 3KQCA 4TY6A 4CRAA 2GKVE 2JETB 1GMDF 4WMEA 1V6DA 1O5EH 1T31A 4XE4A 5HM9A 4X1SU 1BRBE 3RLYH 3SHAH 4JK5A 1WV7H 1K1IA 2JH0D 5FAHA 2FLRH 1A0HB 4CBOA 2FZZA 1QB6A 4UONA 2VVUA 1L1JA 2ZC9H 7GCHF 1O2YA 5DK1A 2ZPSA 3F68H 1UTOA 3GY4A 1QTFA 1GCTC 1L4DA 2J94A 2WUBA 4ZHLU 1BB0B 1DVAH 1GWAA 1SGFG 2JH6D 5A0CA 2PLXA 5FHTA 2W3KA 4E06H 4X2WA 1XUHA 1AFEH 1VJ9U 2ZQ1A 2UUFB 3K9XB 1FY3A 4UFFH 3OY6U 3SQEE 2TGAA 2FTMA 1H1BA 2HRVA 2BD4A 4I8JA 1CT0E 1C1TA 5B6OA 3K65B 1DT2A 3RXRA 4FUDA 1ZSLA 3U8RH 3F9GA 2GZ9A 1F0SA 1NRSH 1Z6JH 4NGAH 2ZTZA 1IQNA 1G2MA 2BMGB 3IG6B 4E7NA 3PLPA 1EPTA 3FP7E 3LGIA 2CN0H 1C5QA 2FOBA 2PHBA 4OS1A 4JYTA 2Y5HA 4WWYA 2ZQ2A 3SGAE 4AFQA 1OP0A 4WH8A 1C5WB 1YPMH 2Z9LA 1T7CA 1EUFA 4UFEH 1QRXA 1O0DH 1MTSA 2VB0A 3EAJA 8GCHF 4JZDH 1P0SH 3P95A 1ZHPA 4FVBA 2AGIX 2Q6DA 1QRZA 2FX6A 1J17T 2TBSA 3RP2A 4KELA 3V13A 1MTNB 4YOJA 4GCHG 5IDKA 1SOTA 1S82A 3MI4A 5DP7A 4NSYA 1MTVA 3ZYDA 1XUGA 5A8YA 1TRNA 1Y3UA 3HGNA 4Q7YA 1MCTA 2AMQA 1BIOA 5GJ4B 2QF3A 1UMAH 1FN8A 2Q6GA 5FXLA 1Z8RA 1THRH 4Y8YA 4D7FA 1CGJE 1TLDA 2VWLA 1TNIA 3BTKE 1H4WA 1FIZA 3SU1A 3ZVFA 1V2LT 2DUCA 1O2GH 3LONA 5DO4H 1HAVA 2PUXB 1WOFA 1O2HA 5CHAB 3E8LA 1ACBE 1AD8H 2BD7A 1ZHRA 1C2IA 1F0TA 4Q80A 4BXSA 3MU4A 1D3PB 3ZV9A 4AFZA 1FDPA 3ATLA 2C4FH 1KDQB 1HAPH 2XCNA 1SLVB 4IN2A 3M3SA 1BCUH 1SGEE 2A5AA 2B5TB 1TAWA 3LC5A 1GI7B 3GCNA 1BTHH 3MU0A 5DP8A 4D76A 2NU1E 2GCHF 2FWWA 1TYNA 1ID5H 5F03A 2Q6FA 4Y10E 1N6YA 5EOKA 3M7UA 2Z7FE 2TGDA 4ABFA 5AHGH 3LIWA 2VH0A 3PLBA 4VGCC 3RXOA 2SNWA 3H7TA 3RXQA 1HAOH 1K1MA 3QWCH 4UFDH 3ZZ4A 2NU3E 4RKJB 3SU4A 4GLYA 3KCGH 3RXCA 2GV7A 3BN9A 1LCYA 2P8OC 2ZF0H 1LPKB 3LC3A 1O39A 3MU8A 2VVVA 2IN2A 3C1KA 2VIOA 2CJIA 4BTUB 3PV4A 2BD5A 4D7GA 1C5VA 1ORFA 1SL3A 1BRCE 2OQ5A 5IYTA 3KF2A 3SHCH 1BRUP 1GBHA 1CA0C 4AG2A 5DGJA 3PMAB 2ZGXH 1BTYA 1D3QB 1GCTB 3E1XB 3PMBB 2WYJA 4DG4A 8ESTE 2ZDLA 1S0QA 3MH4A 4UD9H 1SLXB 1EP5A 3RC5A 4K1EA 4ZKOU 2STBE 1SHYA 2WPKS 3PM3A 3O8BA 4UFGH 2FI4E 3A88A 3Q00A 3D23A 4ZXXH 1O3HA 2EC9H 4ISNA 2Z9IA 1C1PA 1GMHG 1SOZA 3S69A 3VGCC 3MNBA 2BY8X 1ZYOA 1AFQB 2ZDMA 2TGPZ 3BTEE 1YP9A 3ESTA 3SGQE 1TGTA 1NFWA 4DY7B 3VB7A 1AWFH 3UREA 1S85A 1DDJA 1SMFE 1QGFA 1XXDA 1AVWA 1X7AC 1H9IE 3T2NA 1P9UA 5A0BA 1DOJA 3OY5U 4KTSA 1UK3A 1B0EA 1GHYH 3SUEA 1QB1A 2OUAA 3T29A 3TGKE 3A7XA 2NU2E 1PPCE 1AN1E 4K3JA 1J15A 2HVXA 1C1RA 1VR1H 1T8MA 2V6NA 4DVAU 1GMCF 1HCGA 2BLOA 1RJXB 1T4UH 3I77A 2OBQA 4AX9H 1O2LA 4ESTE 2FOAA 1RS0A 1L1NA 1P2JA 2ILNA 3HK3B 4NA8A 1GJ4H 3SI4H 1WQVH 2J92A 4CREA 2AMPA 3GDSA 2HLCA 1AY6H 2VH6A 1PPBH 1YPEH 3TH3H 4Y7BA 3HK6B 1GBTA 2PKAB 1LVBA 3PMJA 2QN5T 3V12A 2EEKA 3CENA 1GJ6A 1QURH 2Z94A 5EG4A 1GBIA 3O8CA 2W7UA 3ZVEA 5J4SA 1O3BA 2J34A 8LPRA 2ZEBA 4X1NU 1Z8GA 1F0UA 2CF8H 2PSYA 1CBWC 2OP9A 4ZMAH 4I8GA 1P2MA 2R3YA 1BBRH 4BXWA 4AYVB 3P17H 1C1OA 2ZDKA 3LGYA 3PWBA 1FY8E 2R2MB 1WTHD 2FI5E 4J2YB 1YCPH 4GAWA 1C1MA 1XVOA 3LGVA 2XBYA 5C67A 3ZYEA 1MKWK 2Z9JA 1SBWA 1W7XH 1V2WT 1YGCH 2ZU2A 4ABGA 3EE0B 2BDGA 2OC1A 1G36A 1GI9B 1VZQH 1SC8U 1G3DA 1C1VH 2OXSA 1ESAA 3P8OA 5JBTA 2BOKA 1EJAA 4MPVA 1GBMA 1W12U 1IQKA 3GDUA 2ZU4A 2A4GA 2G5NA 3TK6A 1MBMA 5A09A 2I6QA 3RLWH 1ESBA 4X2YA 1AB9C 2I6SA 2Z3DA 5JPMH 2A45B 2EI8A 4AB8A 1G3EA 1S6FA 1ZTLA 4VGCB 3DHKH 3KNXA 4HZHA 4Y79A 1NRPH 1S5SA 1BQYA 4I33A 3EDXB 4KTCA 3NUMA 4ABAA 5C5OA 4A5TS 2P8OB 6GCHG 2UUJB 1Y3XA 4NG9H 1AU8A 1LHFH 1NTPA 1WCZA 1Y59T 3RDZA 2BLWA 1PPZA 4AOQA 3RXSA 1CA0B 4Z0KA 1NRQH 1KYNA 3UNQA 2HNTE 1P12E 1SLUB 2ZDAH 1PQ7A 2VIQA 3D65E 3IITA 3QZQA 4J1YA 4YTAA 2WPJS 2W26A 1O2UA 3TLOA 1D9IA 1SGRE 4OS6A 1W0YH 1HDTH 5K0HA 1HIAA 2GDDA 3GY5A 1C5YB 1QL7A 2CHAC 4KTUA 1GG6C 4Q7ZA 5C3NA 1NFXA 3MFJA 3CS0A 5HGGA 1O5BB 3PMHB 1DM4B 1DX5M 3L33A 4K8YA 4DOQA 4MPXA 4ISHH 1S81A 1NC6A 2A5IA 2FLBH 4X8SH 1CO7E 4RSPA 1J16A 1P09A 2ZWLH 2BD3A 1JIMA 1OOKB 3RXUA 5GDSH 1W0ZU 3UR6A 4TPYA 2C3SA 3HGPA 1BRAA 1SLWB 2ZGJA 2AIPA 5T6GA 4KKDA 1GI8B 8KME2 2C8ZB 1DWEH 3A82A 3BF6H 3RXFA 2QCYA 4AFSA 5EQQA 1C9TA 1YPGH 2PKSB 4LZ4B 1QJ7B 2ZDNA 1HBTH 3KEEA 1EJMA 3STIA 3RXHA 1MTWA 3BV9B 1O3JA 3RXDA 1DWDH 1QB9A 3GYLB 3A7YA 4ABJA 3KL6A 1V2KT 4B1TA 1P8VC 3PB1E 2GT7A 3QZRA 3VEQB 1P11E 5DG6A 2W3IA 1GHAF 3QX5H 1EZUC 4NA9H 1SGNE 3RXPA 1YPJH 1P2OA 2OBOA 1TPOA 2OQUA 1XUFA 1WAYB 3QLPH 1GBFA 1ELVA 2Y81A 1W14U 1ZTJA 4FUIA 1KLTA 1A1RA 1SR5C 1O31A 3TIUA 3VXEH 3JZ2B 2BD2A 3TITA 1H9HE 2STAE 4OS5A 1GI5A 1EZSC 2ZFPH 4ABDA 1EOJA 3V7TA 2ZP0H 2P94A 4YOIA 2BTCE 1SI5H 3P92A 4X6MA 1GJ9B 2O9QA 2C8YB 1HXEH 1FY5A 1VCWA 2O8UA 1SGQE 1ZPZA 1P2QA 3URDA 3HATH 4U30A 2KAIA 1GDNA 2HNTC 2A4RA 3W95A 2ZA5A 1GJDB 1D4PB 1WTGH 1EATA 3M3TA 2QGRA 2ESTE 5JBBS 1PPFE 2XBVA 4AN7A 2ZFQH 1EKBB 1GHVH 5A2MH 1C5RA 1BMAA 4LOYH 4KP0A 3UFAA 3LJOA 3UTUH 3DFJA 1O2PA 1AB9B 3RMMH 2QC2A 1OWIA 1WQSA 3NK8A 1JOUB 1QBNA 4JZ1A 2FYRA 1C5NH 1XUIA 2C8WB 4WY3A 3OU0A 1QHRB 4FU8A 1FV9A 1N1LA 3SBKA 2H6MA 4E7RG 1RD3B 3EQ0H 7LPRA 4ZKNU 4JZIA 1MU6B 1SGCA 2ZHFH 2PUQH 4Y8XA 4BAHB 4CRDA 1CA8B 2F9BH 2GZ7A 1O3LA 1NS3A 1PYTC 3BTQE 1U6QA 1SQOA 3KQDA 1IQJA 1CSOE 1EZQA 1WU1A 1HAGE 2EI6A 1KDQA 2TGTA 5J4QA 1KLJH 4MNWA 3PLKA 5GCHF 5EODA 2XCFA 5A0AE 4I7YH 1LQEA 1GHZA 1GMDG 3LDXH 4IBLH 2G00A 5EQSA 1Y3YA 1HAIH 1NZQH 1OWEA 1TMTH 3P6ZB 4ISLA 1ESTA 1G3BA 2GD4B 2LPRA 1BTZA 3A8CA 2DE9A 2BZAA 2EI7A 3V3MA 5EPNA 3LH1A 1LPZB 3QK1A 1OKXA 1OP2A 2V0BA 1O30A 4SGAE 1C4Y2 4BAQB 4GUXA 2A31A 3JZ1B 1BHXB 7GCHG 1SGFA 1GG6B 1ETRH 4AFUA 2BX4A 4MVNA 2V3OH 1O2KA 4BANB 1BT7A 1E0FD 1A2CH 1KXAA 5GWZA 2FP7B 3M5OA 3KIDU 1HLTH 1H8IH 1IQLA 2HWLB 5EQRA 5L2ZH 4A1VA 1O3NA 2VGCC 2BY6X 1NRRH 1TGCA 1FAXA 2PFEA 5T6FA 2QXJA 1K1NA 1O2ZA 2R3UA 1CHOG 4A92A 3MO6A 1A5GH 1EJNA 4MPUA 4K60A 1K1LA 2FTLE 2SGAA 2WPLS 1EPTC 1C5SA 2OCVB 3F9FA 2THFB 3AW0A 1GVLA 1V2OT 1RFNA 2Z3CA 2V3HH 3KHVA 1WYKA 2BDCA 2BVRH 2QAAA 3QTVH 3MH5A 1GI6A 1QFKH 3TH2H 3LGWA 2CXVA 4XDEA 1UCYE 1RGQA 1CGIE 2ODPA 1ELTA 2BVSH 4JCNA 2R0LA 3AAUA 1YPKH 1IHSH 5E2OA 3NCLA 3ZZDA 1PQAA 2ZTYA 2Y7ZA 2BDIA 2XC5A 3BG4C 4OS4A 1K28D 3EA8A 2FI3E 2B8OH 2UUKB 3MYWA 4WMDA 1Q2WA 1HXFH 1THSH 2ALVA 2Y82A 1HNEE 1FAKH 2BLVA 1K22H 2GV6A 1OWKA 1NPMA 1ELFA 1UVOA 4MG3A 1F5RA 2F91A 4OGYA 1V2TT 3A7WA 1RIWC 2GMTB 1CT2E 2ASUB 1AIXH 1RRKA 3GY7A 5FCRA 1HAZB 3GICB 4JZFH 5DP9A 3QDZB 3ZVBA 1MKWH 1F5KU 1FXYA 1SSXA 5C1UA 2WV5A 1KXBA 1PPGE 1ELEE 2AMDA 4GCHF 1O3IA 4KGAA 1O37A 1KTTB 1P3EA 5EPYA 4CH2B 1DLKB 4Q7XA 3A86A 1Y3VA 2RG3A 2G5VA 2ZHWH 1AQ7A 1NU9A 1TGNA 4CBNA 4INHA 2ZDVH 3GOVB 2QF0A 1IQGA 2XW9A 2PKAA 3KGPA 3F9EA 3M61U 2ZFTA 1Z1JA 2ZHQH 1DLEA 2ZTXA 2F9UA 2HGTH 3K6ZA 4GHTA 1UCYK 2XYAA 1QA0A 2GCHG 2FIRH 3A8AA 4FU7A 1C2LA 1E36B 1C5ZB 1CU1A 2OTVA 1AE8H 1CT4E 5JBCS 2BQWB 4IGDA 1FUJA 3N7OA 1O3AA 3WY8A 2A0QB 5BPEA 2D26C 5F6MA 1EAWA 5E0HA 1UHBB 2WPIS 2NU0E 3FVFB 1G30B 2G4UA 1EAXA 1O5FH 3LJJA 4Y0ZE 1GBJA 1XX9A 5TJXA 5A8XA 5E2PA 2BDHA 3ZVCA 1UTQA 1VGCC 3MO3A 3LOXA 2PTCE 1OXGA 3RU4T 1BITA 1GI3A 4FUEA 4X1PU 1TALA 1YCPM 3U98H 2VU8E 3HPTB 1TB6H 1A0LA 3NPSA 5C2ZA 1IAUA 1RXPA 4X8TH 1SGPE 5HM2A 1C5XB 1MQ5A 5DKMA 2OC8A 1SPJA 2GX4A 4FUCA 5GPIB 1A3BH 1L0ZA 1SGIB 4NIVA 3SNDA 2O8LA 4X6NA 1ZPCA 3ENSB 1TQ0B 3BTDE 3RM2H 3BTFE 1V2PT 1W2KH 3BTWE 3M35A 1O3FA 2HPQH 1A5HA 1C5PA 1K1PA 1TWXB 2VGCB 2XBWA 3ZZCA 1S83A 1PPEE 3QGNB 3BG8A 1ZZZA 2J4IA 4NCYA 3DT0H 1O35A 2FO9A 1OWJA 1EP6A 1GI1A 1C1WH 4INLA 2AGGX 3ZZAA 2B7DH 1C2FA 5L2YH 1EZXC 1ZOMA 4JK6A 2TPIZ 1C2KA 3M5NA 4B75A 3ODDA 5L6NH 3SI3H 1IOEA 1MZDA 1P9SA 1AMHA 4HTCH 2R9PA 2NU4E 1TX7A 3UNRA 3BEUA 4A6LA 1YPHE 1DSTA 2P59A 3K2UA 3UR9A 1JMOH 1C5TA 1MMJN 5CE1A 1GBAA 5H4IB 2F9NA 3D49H 1GMCG 1O5GH 1GMHF 1GI0A 4E05H 3S9BA 2A4OA 3E16B 3GY2A 1FONA 2PV9B 3NZIA 3ZZ8A 2ZU1A 1AGJA 2Q1JA 3SORA 2ODYB 3DD2H 3HKIB 2J38A 3BG4B 1C2EA 3AASA 1AZ8A 1Z1IA 3URCA 1F2SE 4XBCA 4MTBA 1HJAC 2BY5X 1E37B 1SG8B 3KN2A 4NSVA 1AVXA 1OWHA 1C2MA 2XBXA 1GBCA 3TJOA 2Z9GA 3NWUA 1ANCA 1FMGA 1XUKA 2FODA 3M7TA 1BTUA 3SV9A 4JYUH 4Y76A 1NESE 2TRMA 1BJUA 4FUBA 3MMGA 1ZGIA 3TJNA 1HYLA 1EASA 1VITG 3RMNH 3SW2B 1HAVB 1FY1A 1TOCB 2VIVA 3FAOA 1P04A 2CMYA 2QY0B 2PGQB 1OS8A 3GYMA 5I25A 1FNIA
chains in the Genus database with same CATH superfamily
1QRWA 2RA0A 2ZU5A 1L2EA 3ITIA 3U8OH 4Y7AA 1ZTKA 1J9CH 5SGAE 2ZGHA 4AG1A 4ZUHA 1OPHB 4A1XA 2G51A 3DUXH 3SUFA 4B2AA 1HJ8A 2FYQA 5C1XA 3SU0A 6ESTA 1O2OA 1EXFA 1QIXB 4NIWA 1Y3WA 3RM0H 1DUEA 4D8NA 2WPMS 4OM9A 4UE7H 1DITH 2OC7A 1TFXA 2ZHEH 3SV7A 4ZROA 1CQQA 3RUOA 1TBRH 9ESTA 1QR3E 3A81A 1AHTH 1TNGA 1ELDE 1UJ1A 1XKBC 4IC5A 1PJPA 1O2IA 1GVKB 3C27B 3EA9A 4I8HA 1KY9A 4YT7H 2A2QH 3EGKH 1AZZA 3U9AH 6LPRA 3ZZ7A 1XMNB 4B76A 4X0WU 5LPFA 1TQ7B 2XC4A 2CK3D 4NIXA 1V2RT 1F7ZA 2EA3A 4OGXA 1SQRA 2ZGBH 2C90B 1J8AA 1V2VT 1TNHA 2CF9H 2JH5D 4ZKRU 1YPHC 3B23B 5FX6A 3SO3A 1QA7A 1ANEA 4Q63A 3P8GA 2F9PA 4HFPB 2BY7X 2P3TB 4MNYA 4CRBA 3SV6A 3HKJB 4ZAEA 1GJ5H 1H8DH 1GHXH 1Q31A 1NFYA 4XOJA 3A84A 3BTME 5FCKA 3T25A 4F49A 5LPEA 4OS2A 5K7RA 1TONA 1GHBG 2GT8A 1DE7H 1CE5A 1Y5AT 4YXWD 1UTJA 3OAAD 1MQ6A 6GCHF 1W8BH 2GCTC 5DPAA 1DY9A 4AYYB 4ABBA 4K1TA 4K2YA 3TK5A 3UWIA 3A83A 1KXDA 3A8BA 3ZZBA 4ZCNA 3VGCB 1TOMH 1NY22 1SGYE 4B6EA 2ZHDA 3VB5A 5LH8A 3TGJE 4I31A 2H9EH 2Y6TA 3BSQA 4MQAA 1P03A 4I8LA 1C2HA 2FPZA 2F83A 4OS7A 3PRBA 2SGDE 5JDUB 1WXRA 3Q3XA 1SFQB 3ZVAA 1BMNH 1O3DA 4MDSA 1C5LH 4ACAA 2BQ7B 1BJVA 2VINA 1RTLA 1TPAE 2VWMA 4AGJA 3NKKA 3BTGE 3GCTG 2CV3A 2Y5GA 2K1QA 1C5OH 1A61H 1EX3A 3LH3A 3U1JB 3UAIC 2F3CE 4ZXYH 2XOKD 1GBDA 2BD8A 3SV2H 2WZQA 1FQ3A 1GHAG 1C1UH 1JRSA 3SJIA 2GP9B 1YPLH 1O38A 1W7GH 1W10U 1Z7KA 1YY3A 2BLQA 5EJLA 4XBBA 4INKA 3A85A 5HMAA 1L4ZA 3MO9A 4CR5A 3A7VA 1SQAA 1NBME 1ANBA 4WXVA 5HIZA 3WWBA 4Q2KA 1TX8A 5G4BA 3S7HB 1AO5A 3T62A 1HJ9A 2XRCA 3L6PA 3ZZ6A 1D3TB 1MBQA 1O3PB 1P57B 1MZAA 2ZGCA 5C94A 1O3KA 2IPQX 1MUEB 3FN8A 2D1JA 1RTFB 1H9LB 1BHXF 1ELGA 3H7OA 3RC6A 4ZHMU 1C1NA 1YF4A 3OYPA 1TE0A 1TPSA 3QN7A 4RI0A 3FZDA 1CBWB 1A4WH 5ESTE 5F8ZA 1ZHMA 5JBAS 1BTPA 4LZ1H 2ANKH 4K69A 1DICA 1FPCH 3CS7A 2QF4A 5DP6A 2UWLA 3MNXA 2WPHS 3GY8A 4X8UH 1GGDC 1WBGB 4QT8C 5GIBA 2PSXA 1O32A 3SJKA 1DY8A 1LVYA 2QV1A 1HAYB 2JIZD 5JB8S 3V0XA 5FBIA 1UCYH 1K9OE 3R3GB 3RXVA 3RXGA 5PTPA 1OX1A 4A7IB 4CRFA 4Y71A 1V2UT 1EFRD 3PTNA 2HLDD 2XWAA 1ZSKA 3U69H 3VFEA 1W11U 3ZVDA 2ZFFH 1DANH 1YWUA 1AKSB 1XXFA 1AUJA 1Z71A 4ABHA 2QXHA 4Z6AH 2J98A 3RXMA 4Z1MD 3ZIAD 2BY9X 5CHAC 2UWPA 1TMBH 4O97A 1O2XA 3TK9A 1O2TA 3RXAA 2ZG0H 3IWMA 2A5KA 1UVTH 1AUTC 4M7GA 1V3XA 1WUNH 1V2NT 2A4QA 3SJOA 3FP8E 1FZZA 1V2ST 2O8TA 4BAKB 5GCHG 4TYDA 3SJ9A 1HV7A 5DSFA 2VVCA 1ELBA 1F5LA 1ZJKA 2OINA 4R8TB 3P8FA 5JYIA 2BB4A 4B2CA 1UO6A 3RXKA 4UDWH 4CHAC 1UVSH 3EYDA 1GI2A 4K5ZA 4LK4A 3M36A 4ABIA 1GJ7B 3OTJE 3U28C 1GPZA 4FXGH 2RCEA 3VPKA 1TRMA 3KYGA 4H42U 4B6FA 3WW7A 4AB9A 1LHDH 2SGPE 1UK2A 3BEIB 1QCPA 1HIAB 1S0RA 5I46H 4O3UA 3TNSA 4BTIB 3I78A 4ZH8A 3GY6A 1K1JA 1DFPA 9LPRA 3SU2A 5C5NA 1L1GA 1C1QA 1ZMNA 1MKXK 1T8NA 3SOSA 4AGKA 2GCTB 2CHAB 1UHBA 1ZJDA 3LPRA 1ARCA 1LQDB 2PWXA 3DSOA 1RTKA 1KXFA 2VJ1A 2WV9A 1ELCA 1MU8B 3TJVA 4K8BA 4GPGA 4RKOB 2AGEX 1P10A 1P3CA 3BTTE 5EU8A 4YOGA 2H5DA 2H1UA 4Y6DA 1DS2E 2P3UB 4B73A 2V35A 1O5AB 1LVOA 4YLUA 2Z3EA 1N6XA 1NU7B 2SFAA 2K8IA 1TGBA 2LNCA 1O2QA 5GXPA 1G32B 4FU9A 2VIDA 1LPGB 3MHWU 3UQOA 1BMMH 3T27A 3A89A 3BEFB 3A80A 4AORA 1OWDA 1IQFA 4IN1A 1QNJA 1SVPA 3Q77A 1FIWA 1AE5A 2FDAA 2WYGA 1E34B 4SGBE 2ZCKP 2ZFSA 3B9FH 3F6UH 1ANDA 4X8VH 1YLCA 1Z8JB 3S9AA 3M37A 1TBQH 8GCHG 2F43B 2WUCA 5AVDA 1AFQC 4LXBH 2RDLA 4FETA 1G2LA 1CHOF 4X1QU 1SFIA 3G01A 1TABE 2EQNA 1QJ1B 4NA7A 3FKSD 1UK4A 2FS9A 2G4TA 1QZ8A 2XWBI 3VB4A 2Y7XA 3M3VA 4U32A 1GJ8B 2ZPRA 1ZMLA 1YLNA 1YM0A 3U1IB 1YC0A 2AYWA 2P3FH 3AK5A 5TCCA 5F8XA 2UUYA 2WHXA 4DIIH 1IHTH 3GISB 5E0GA 2A32A 1MD7A 1DUAA 1T4VH 4CRGA 1INCA 1LVMA 2KAIB 3RXIA 3SNCA 2AS9A 4MLFB 2GGVB 1GGDB 3AAVA 1EB2A 2Y5FA 3ZZ5A 3OE7D 3QUMP 4H6TA 4X6OA 3RU4D 4ISIH 4MNXA 1DWBH 1IQEA 1MABB 1P05A 1HPGA 3ZZ9A 2F9OA 1T32A 1P02A 1LDTT 3MTYA 1CGHA 2FOFA 1LHEH 1G37A 2BHGA 3E90B 3T5FH 2B9LA 2YMSD 2VNTA 2XC0A 4WXIA 1J14A 1LO6A 3BTHE 1HAHH 2QYIA 1OP8A 3KQBA 3O8DA 1KXCA 2LELA 1GJCB 1HFDA 3SU6A 3PTBA 2M5TA 1KXEA 3L3TA 2QF5A 4DURA 2F9VA 1FJSA 1IQIA 2DE8A 3ZV8A 4WH6A 1ETTH 4NWKA 3RMLH 3RXJA 3SV8A 1LTOA 5E8EH 5LGOA 1QQUA 2CGAA 1C2GA 5DP4A 1KTSB 1V2QT 3PWCA 4O03A 5AF9H 5EW2H 1AWHB 2F4LA 1F92A 3SQHE 3EA7A 4CHAB 1LKAA 3OTPA 2HPPH 1PYTD 4YO9A 2H5CA 2ZU3A 6CHAC 5KECA 1H8HD 5EXNA 1EQ9A 1XVMA 1PFXC 4H4FA 5EW1H 2BYAX 3AVZA 3ATKA 2HOBA 1ABJH 4ASHA 1C4V2 4PROA 3FO8D 3GCOA 1NROH 3QTOH 1FLEE 4ZKSU 3E6PH 1C5UA 2AIQA 2XNIA 1VCPA 2L6OA 4HI3A 4DJZB 1CHGA 2H9HA 3LU9B 4U2WA 2VIWA 1GBEA 1K2I1 2ZNKH 3UQVA 3ATWA 1EAUA 1FI8A 3CP7A 5FPTA 1GHWH 3PROA 1P2NA 3SUGA 5E0JA 2ZO3H 1GBBA 1XM1A 5EGMA 4GVUA 3NRLA 1W3CA 3LKWA 1LHGH 2O8WA 4XBDA 3RXLA 2Z6BD 1Q3XA 1Z6EA 3SJ8A 5JB9S 1D3DB 3GCHC 3NXPA 4A1TA 1QL8A 3E0PB 1BTXA 3MWIU 1EPTB 3T26A 2FESH 3FFGA 3F2HA 1QBOA 2KZ4A 1ZRKA 4IW4E 4WVPE 3PV5A 4XSKU 3B8JA 3F2GA 3SGBE 1SGDE 3ELAH 1NN6A 2FEQH 2HALA 1C2JA 1O3OA 1O2SA 2OD3B 4YESB 4IMQA 1EAIA 3E3TA 1GCDA 4GSOA 2BZ6H 4I32A 2ZECA 3FP6E 1FY4A 4X2XA 1HAXB 1O2RA 1T8LA 3M7QA 1V2JT 1LKBA 4CRCA 4X1RU 3D62A 1KIGH 1E35B 1UTMA 1Y5UT 1S6HA 1A5IA 1TPPA 4JMYA 2WV4A 5FX5A 3U8TH 1K1OA 1N8OC 4BTTB 3UY9A 3TVJB 2NWNA 2ZCHP 1O2JA 3OX7U 1OYQA 2QXIA 1D6WA 1AVGH 2XTTB 2PKSC 4B2BA 2D2DA 1O36A 2KFWA 1O5CB 3F1SB 1RIWB 4K1SA 3LGTA 1T8OA 1ARBA 1Z8IB 4IC6A 3S9CA 1O3MA 3SNBA 4WMFA 1S84A 1GBKA 1JRTA 1OSSA 4FVDA 3A8DA 5EXLA 2YNAA 3UNSA 2PP6A 3I29A 3MNCA 1B0FA 3MOCA 1O2WA 3SN8A 1MD8A 3TNTA 1TIOA 1HB0B 2BXTH 3RXBA 5CDFE 1JBUH 1O34A 2ZZUH 4X2VA 2FX4A 1XUJA 4UEHH 2IPHA 4Y8ZA 2BDBA 3OSYA 4XFQA 1BTWA 3Q3KA 1NM6A 3MU1A 1ZPBA 2FMJA 1TNJA 4O9VA 5FBEA 1YKTA 2SNVA 1TNLA 2ZPQA 1OYTH 1QBVH 1PQ8A 3SNEA 3SYJA 1UTLM 1DXWA 1DSUA 1VITF 2IOTA 2RA3A 1GL1A 3LT3A 1SQTA 4CR9A 2BOHB 1GDUA 4DW2U 4YLQH 2BXUH 2SGEE 4U01A 2TIOA 3RXTA 1TX6A 4Y11E 1NFUA 1ZSJA 3KQEA 2GVFA 5HYOA 2JKHA 2D8WA 1PPHE 2VWOA 1O3CA 3SNAA 4MNVA 4JZEH 3SU3A 3M5MA 2G81E 5DP5A 4TT3D 5T3HA 3VB6A 2FOMB 1HUTH 1ETSH 3SU5A 1ZLRA 1GVZA 3P70B 1QQ4A 6CHAB 2GZ8A 1VGCB 2A7CA 5ETXA 1KLIH 1O3GA 1UTPA 5ABWA 1BDAA 3MU5A 1EB1H 2B0FA 2PW8H 2RDEA 1HGTH 4YM9A 3S0NA 4NFFA 2H9TH 3DSGA 4DT7B 4FUFA 1MKXH 1C9PA 2SGFE 1TBZH 1ABIH 2R0KA 3S7KB 1AKSA 3RC4A 5F8TA 1QL9A 2K0QA 4NFEA 5L30H 2ZFRH 1O3EA 3F9HA 1O5DH 2FOHA 3DA9B 2QIQA 5HIYA 3PYHA 5A8ZA 1LHCH 5EJZA 3Q76A 1E38B 4THNH 1W13U 2R2WU 2Y80A 5FPSA 1P2KA 3RU4E 1W0JD 4CH8B 1S6LA 4R0IA 1O33A 4B74A 4ABEA 1M9UA 2A7HA 3UOUA 4BOHA 3RXEA 3SUDA 4XRNA 3PO1C 1O2NA 4TPIZ 3TPIZ 1BA8B 1A7SA 1G3CA 2UWOA 2QXGA 3GCHB 2BD9A 2ANWA 4NIYA 1DWCH 1GDQA 1TA2A 2BDYA 2JETC 3CNRA 3R0FA 3DFLA 1QJ6B 5DJ7A 3TH4H 4BAMB 4Y0YE 1TNKA 1UVPA 2ULLA 3TGIE 3N7DA 1UVUH 1GHBF 3AW1A 3Q3YA 1GJBB 3ATIA 4FUGA 2XXLA 3MH6A 1TRYA 3OEED 4YZUA 4RN6A 1C5MD 1A3EH 2W7SA 2A1DB 1GL0E 4H6SB 3GY3A 1A0JA 3FZZA 1KSNA 4ISOA 3O8RA 1P06A 1UTKA 2A7JA 2AERH 1TGSZ 4DIHH 2P95A 2ANYA 2ANMH 2AFQB 2ALPA 4XD7D 1SGTA 2YOLA 4MPWA 1O2MA 2BVXH 4AZ2B 1YBWA 1N8OB 2ZCLP 1P01A 1DXPA 4FUJA 4NWLA 1O2VA 4JYVH 2BM2A 1HJAB 3ATMA 1GI4A 2QA9E 1JXPA 2VIPA 3UPEA 4I8KA 2AH4X 3LGUA 4ZHAA 5TCAA 3TU7H 5LPRA 3T28A 1CVWH 1V2MT 1Y8TA 2PR3A 1QY6A 1SHHB 1UTNA 5HXFA 3GCTF 1BBRE 2ODQA 5ESBA 3QO6A 3W94A 1E1QD 2VWNA 2BDAA 3BIVH 1VCQA 2GTBA 1BUIA 2J2UA 3MNSA 3VXFH 2OLGA 1MAYA 1ZR0A 1B7XB 2O8MA 1BOQA 4B71A 4BAOB 2C93B 2G52A 2V3MA 3K6YA 7ESTE 1IQHA 5BRRE 3UUZA 1VJAU 2A2XH 3P8NA 4O3TA 5C0UA 2H2ZA 1MTUA 2J95A 1Y5BT 3UOPA 4ASUD 4DGJA 2PGBB 1SB1H 2KCOA 1ZRBA 3STJA 4DCDA 1MTNC 4YT6H 2IJOB 3F3BA 1GJAB 1HRTH 4TWYA 1D6RA 1P2IA 2ZKSA 3MH7A 4D9RA 4WF8A 4IMZA 2GMTC 3ODFA 4TY7A 1XKAC 1TMUH 1TA6A 2OC0A 3ZVGA 1NT1A 1ZGVA 3TJUA 4F4OC 1C4U2 1MH0A 1C1SA 2FXRA 3F2FA 4GHQA 2BX3A 1JWTA 3A87A 4HGCA 2G55A 5FPYA 1ZMJA 2FOEA 3KYFA 3E91A 2P93A 2YMSC 1G9IE 2C8XB 3QGJA 1BZXE 2ZI2H 2FS8A 5AFZH 1F0RA 1DPOA 1AI8H 2SGQE 1JIRA 2FM2A 1BBRK 2W5EA 3BIUH 3M5LA 4D9QA 1IQMA 1THPB 2Z9KA 4NZLA 1B5GH 3E0NB 1YCPK 1MCVA 3ZZ3A 2YNBA 1LMWB 3GDVA 1NO9H 1BMLA 1EOLA 5EXMA 1ELAA 5DP3A 3RMOH 2J9NA 3A7ZA 7KMEH 1FPHH 1YLDA 2KX4A 4NZQA 1YYY1 2G8TA 2LP6A 2ZIQH 1NRNH 5AFYH 2P16A 3W1EA 4IS5A 3FANA 2GDEH 5C1YA 4TWWA 1WSSH 3UWJH 4X6PA 5C20A 5T6DA 3DSPA 3SZNA 3H5CB 2AEIH 1C2DA 3A7TA 1VITH 3F0OA 3VB3A 5CMXH 1FN6A 2HVYB 4WJG2 1K21H 1MAXA 3UIRA 4FUHA 2PTNA 5KGOA 2BQ6B 2FOCA 5C17A 1PQ5A 3PO1B 4BNRA 2FOGA 2HNTF 2WINI 1GBLA 1A46H 3KQCA 4TY6A 4CRAA 2GKVE 2JETB 1GMDF 4WMEA 1V6DA 1O5EH 1T31A 4XE4A 5HM9A 5C0TA 4X1SU 1BRBE 3RLYH 3SHAH 3F0PA 4JK5A 1WV7H 1K1IA 2JH0D 5FAHA 2FLRH 1A0HB 4CBOA 2FZZA 1QB6A 4UONA 2VVUA 1L1JA 2ZC9H 7GCHF 1O2YA 5DK1A 2ZPSA 3F68H 1UTOA 3GY4A 1QTFA 1GCTC 1L4DA 2J94A 2WUBA 4ZHLU 1BB0B 1DVAH 1GWAA 1SGFG 2JH6D 5A0CA 2PLXA 5FHTA 2W3KA 4E06H 5DN6D 4X2WA 2AHME 1XUHA 1AFEH 1VJ9U 2ZQ1A 2UUFB 3K9XB 1FY3A 4UFFH 3OY6U 3SQEE 2TGAA 2FTMA 1H1BA 2HRVA 2BD4A 4I8JA 1CT0E 1C1TA 5B6OA 3K65B 1DT2A 2GJGA 4FUDA 3RXRA 1ZSLA 3U8RH 2EY4C 3F9GA 2GZ9A 1F0SA 1NRSH 1Z6JH 4NGAH 2ZTZA 1IQNA 1G2MA 2BMGB 3IG6B 4P02A 4E7NA 3PLPA 1EPTA 3FP7E 3LGIA 2CN0H 1C5QA 2FOBA 2PHBA 4OS1A 3VG8A 4JYTA 2Y5HA 4WWYA 2ZQ2A 3SGAE 4AFQA 1OP0A 4WH8A 1C5WB 1YPMH 2Z9LA 1T7CA 1EUFA 4UFEH 1QRXA 1O0DH 1MTSA 2VB0A 3EAJA 8GCHF 4JZDH 1P0SH 3P95A 1ZHPA 4FVBA 5IK2D 2AGIX 2Q6DA 1QRZA 2FX6A 1J17T 2TBSA 3RP2A 4KELA 3V13A 1MTNB 4YOJA 4GCHG 5IDKA 1SOTA 1S82A 3MI4A 5DP7A 4NSYA 1MTVA 3ZYDA 1XUGA 5A8YA 1TRNA 1Y3UA 3HGNA 4Q7YA 1MCTA 2AMQA 1BIOA 5GJ4B 2QF3A 5EJ1A 1UMAH 1FN8A 2Q6GA 5FXLA 1Z8RA 1THRH 1W0KD 4Y8YA 4D7FA 1CGJE 1TLDA 1KMHB 2VWLA 1TNIA 3BTKE 1H4WA 1FIZA 3SU1A 3ZVFA 1V2LT 2DUCA 1O2GH 3MQKC 3LONA 5DO4H 1HAVA 2PUXB 1WOFA 1O2HA 2XNDD 5CHAB 3E8LA 1ACBE 1AD8H 2BD7A 1ZHRA 1C2IA 1F0TA 4Q80A 4BXSA 3MU4A 5FL7D 1D3PB 3ZV9A 4AFZA 1FDPA 3ATLA 2C4FH 1KDQB 1HAPH 2XCNA 1SLVB 4IN2A 3M3SA 1BCUH 1SGEE 2A5AA 1WDIA 2B5TB 1TAWA 3LC5A 1GI7B 3GCNA 1BTHH 3MU0A 5DP8A 4D76A 2NU1E 2GCHF 2FWWA 1TYNA 1ID5H 5F03A 2Q6FA 4Y10E 1N6YA 4F55A 5EOKA 3M7UA 2Z7FE 2TGDA 4ABFA 5AHGH 3LIWA 2VH0A 3PLBA 4VGCC 3RXOA 2SNWA 3H7TA 3RXQA 1HAOH 1K1MA 3QWCH 4UFDH 3ZZ4A 2NU3E 4RKJB 3SU4A 4GLYA 3KCGH 3RXCA 2GV7A 3BN9A 1LCYA 2P8OC 2ZF0H 1LPKB 3LC3A 1O39A 3MU8A 2VVVA 2IN2A 3C1KA 2VIOA 2CJIA 4BTUB 3PV4A 2RFKC 2BD5A 4D7GA 1C5VA 1ORFA 1SL3A 1BRCE 2OQ5A 5IYTA 3KF2A 3SHCH 1BRUP 1GBHA 1CA0C 4AG2A 5DGJA 3PMAB 2ZGXH 1BTYA 4FOUC 1D3QB 1GCTB 3E1XB 3PMBB 2WYJA 4DG4A 8ESTE 2ZDLA 1S0QA 3MH4A 4UD9H 1SLXB 1EP5A 3RC5A 4K1EA 4ZKOU 2STBE 1SHYA 2WPKS 3PM3A 3O8BA 4UFGH 2FI4E 3A88A 3Q00A 3D23A 4ZXXH 1O3HA 2EC9H 4ISNA 1OHHD 2Z9IA 1C1PA 1GMHG 1SOZA 3S69A 3VGCC 3MNBA 2BY8X 1ZYOA 1AFQB 2ZDMA 2TGPZ 3BTEE 1YP9A 3ESTA 3SGQE 2OK5A 1TGTA 1NFWA 4DY7B 2QE7D 3VB7A 1AWFH 3UREA 1S85A 1DDJA 1SMFE 1QGFA 1XXDA 4F48B 1AVWA 1X7AC 1H9IE 3N7EA 3WWFA 3T2NA 1P9UA 5A0BA 1DOJA 3OY5U 4KTSA 1UK3A 1B0EA 1GHYH 3SUEA 1QB1A 2OUAA 3T29A 3TGKE 3A7XA 2NU2E 1PPCE 1AN1E 2M2AA 4K3JA 1J15A 2HVXA 1C1RA 1VR1H 1T8MA 2V6NA 4DVAU 1GMCF 1HCGA 2BLOA 1RJXB 1T4UH 3I77A 2OBQA 4AX9H 1O2LA 4ESTE 2FOAA 1RS0A 1L1NA 1P2JA 3GS9A 2ILNA 3HK3B 4NA8A 1GJ4H 3SI4H 1WQVH 2J92A 4CREA 2AMPA 3GDSA 2HLCA 1AY6H 2VH6A 1PPBH 1YPEH 3TH3H 4Y7BA 3HK6B 1GBTA 2PKAB 1LVBA 3PMJA 2QN5T 3V12A 2EEKA 3CENA 1GJ6A 1QURH 4RT1A 4AC9A 2Z94A 5EG4A 1GBIA 3O8CA 2W7UA 3ZVEA 5J4SA 1O3BA 2J34A 8LPRA 2ZEBA 4X1NU 1Z8GA 1F0UA 2CF8H 2PSYA 1CBWC 2OP9A 4ZMAH 4I8GA 1P2MA 2R3YA 1BBRH 2W6ID 4BXWA 4AYVB 3P17H 1C1OA 2ZDKA 3LGYA 3PWBA 1FY8E 2R2MB 1WTHD 2FI5E 4J2YB 1YCPH 2KCYA 4GAWA 1C1MA 1XVOA 3LGVA 2XBYA 5C67A 3ZYEA 1MKWK 2Z9JA 1SBWA 1W7XH 1V2WT 1YGCH 2ZU2A 4ABGA 3EE0B 2BDGA 2OC1A 1G36A 1GI9B 1VZQH 1SC8U 1G3DA 1C1VH 2OXSA 1ESAA 3P8OA 5JBTA 2BOKA 5B6LA 1EJAA 4MPVA 1GBMA 5HKKD 1W12U 1IQKA 3GDUA 2ZU4A 2A4GA 2G5NA 3TK6A 1MBMA 5A09A 2I6QA 3RLWH 1ESBA 4X2YA 1AB9C 2I6SA 2Z3DA 5JPMH 2A45B 1VKYA 2EI8A 4AB8A 1G3EA 1S6FA 1ZTLA 4VGCB 3DHKH 3KNXA 4HZHA 4Y79A 1NRPH 1S5SA 1BQYA 4I33A 3EDXB 4KTCA 3OFND 3NUMA 4ABAA 5C5OA 4A5TS 2P8OB 6GCHG 2UUJB 1Y3XA 4NG9H 1AU8A 1LHFH 1NTPA 1WCZA 1Y59T 3RDZA 2BLWA 1PPZA 4AOQA 3RXSA 1CA0B 1SKYE 4Z0KA 1NRQH 1KYNA 3UNQA 2HNTE 1P12E 1SLUB 2ZDAH 1PQ7A 2VIQA 3D65E 3IITA 3QZQA 4J1YA 4YTAA 2WPJS 2W26A 1O2UA 3TLOA 1D9IA 1SGRE 4OS6A 1W0YH 5EIYA 1HDTH 5K0HA 1HIAA 2GDDA 3GY5A 1C5YB 1QL7A 2CHAC 4KTUA 1GG6C 4Q7ZA 5C3NA 1NFXA 3MFJA 3CS0A 5HGGA 1O5BB 3H09A 1DM4B 1DX5M 3L33A 3PMHB 4K8YA 4DOQA 4MPXA 4ISHH 1S81A 1NC6A 2A5IA 2FLBH 4X8SH 1CO7E 4RSPA 1J16A 1P09A 2ZWLH 2BD3A 1JIMA 1OOKB 3RXUA 5GDSH 1W0ZU 3UR6A 4TPYA 3KQ5A 2C3SA 3HGPA 1BRAA 1SLWB 2ZGJA 2AIPA 3N99A 1FX0B 5T6GA 4KKDA 1GI8B 8KME2 2C8ZB 1DWEH 3A82A 3BF6H 3RXFA 2QCYA 3SZEA 4AFSA 5EQQA 1C9TA 1YPGH 2PKSB 4LZ4B 1QJ7B 2ZDNA 1HBTH 3KEEA 1EJMA 3STIA 3RXHA 1MTWA 3BV9B 1O3JA 3RXDA 1DWDH 1QB9A 3GYLB 3A7YA 4ABJA 4M9FA 3KL6A 1V2KT 4B1TA 1P8VC 3PB1E 2GT7A 3QZRA 3VEQB 1P11E 5DG6A 2IJD1 2W3IA 1GHAF 3QX5H 1EZUC 4NA9H 1SGNE 3RXPA 1YPJH 1P2OA 2OBOA 1TPOA 2OQUA 1XUFA 1WAYB 3QLPH 1GBFA 1ELVA 2Y81A 1W14U 1ZTJA 4FUIA 1KLTA 1A1RA 1SR5C 1O31A 3TIUA 3VXEH 3JZ2B 2V7QD 2BD2A 3TITA 1H9HE 2STAE 4OS5A 1GI5A 1EZSC 2ZFPH 4ABDA 1EOJA 3V7TA 2ZP0H 2P94A 4YOIA 5T1VA 2BTCE 1SI5H 2KCAA 3P92A 4X6MA 4DT4A 1GJ9B 2O9QA 2C8YB 1HXEH 1FY5A 1VCWA 2O8UA 1SGQE 1ZPZA 1P2QA 3URDA 3HATH 4U30A 2KAIA 1GDNA 2HNTC 2A4RA 3W95A 2ZA5A 1GJDB 3UB0A 1D4PB 1WTGH 3OEHD 1EATA 3M3TA 2QGRA 2JJ1D 2ESTE 5JBBS 1PPFE 2XBVA 4AN7A 2ZFQH 1EKBB 1GHVH 5A2MH 1C5RA 1BMAA 4LOYH 4KP0A 3UFAA 3LJOA 3UTUH 1H8ED 3DFJA 1O2PA 1AB9B 3RMMH 2QC2A 1OWIA 1WQSA 3NK8A 1JOUB 1QBNA 4JZ1A 2FYRA 1C5NH 1XUIA 2C8WB 4WY3A 3OU0A 1QHRB 4FU8A 4RT0A 1FV9A 1N1LA 3SBKA 2H6MA 4E7RG 1RD3B 2J5UA 3EQ0H 7LPRA 4ZKNU 4JZIA 1MU6B 1SGCA 2ZHFH 2PUQH 4Y8XA 4BAHB 4CRDA 1CA8B 2F9BH 2GZ7A 1O3LA 1NS3A 1PYTC 3BTQE 5CHBA 1U6QA 1SQOA 3KQDA 1IQJA 1CSOE 1EZQA 1WU1A 1HAGE 2EI6A 1KDQA 2TGTA 5J4QA 1KLJH 4MNWA 3PLKA 5GCHF 5EODA 2XCFA 5A0AE 4I7YH 1LQEA 1GHZA 1GMDG 3LDXH 4IBLH 2G00A 5EQSA 1Y3YA 1HAIH 1NZQH 1OWEA 1TMTH 3P6ZB 4TSFD 4ISLA 1ESTA 1G3BA 2GD4B 2LPRA 1BTZA 3A8CA 2DE9A 2BZAA 2EI7A 3V3MA 2KM0A 5EPNA 3LH1A 1LPZB 3QK1A 1OKXA 1OP2A 2V0BA 1O30A 4SGAE 1C4Y2 4BAQB 4GUXA 2A31A 3JZ1B 1BHXB 7GCHG 1SGFA 1GG6B 1ETRH 5GNDA 4AFUA 2BX4A 4MVNA 4ACBA 2V3OH 1O2KA 4BANB 1BT7A 1E0FD 1A2CH 1KXAA 5GWZA 2FP7B 3M5OA 3KIDU 4P00A 1HLTH 1H8IH 1IQLA 2HWLB 5EQRA 5L2ZH 4A1VA 1O3NA 2VGCC 2BY6X 1NRRH 1TGCA 1FAXA 2PFEA 5T6FA 2QXJA 1K1NA 1O2ZA 2R3UA 1CHOG 4A92A 2W6JD 3MO6A 1A5GH 1EJNA 4MPUA 4K60A 1K1LA 2FTLE 2SGAA 2WPLS 1EPTC 1C5SA 2OCVB 3F9FA 2THFB 3AW0A 1GVLA 4Q4LA 1V2OT 1RFNA 2Z3CA 4I86A 2V3HH 3KHVA 1WYKA 2BDCA 2BVRH 2QAAA 3QTVH 3MH5A 1GI6A 1QFKH 3TH2H 3LGWA 2CXVA 4XDEA 1UCYE 1RGQA 1CGIE 2ODPA 3DCLA 1ELTA 5F53A 2BVSH 4JCNA 2R0LA 5KEDA 3AAUA 1YPKH 1IHSH 5E2OA 3NCLA 3ZZDA 1PQAA 2ZTYA 2Y7ZA 2BDIA 2XC5A 3BG4C 4OS4A 1K28D 3EA8A 2FI3E 2B8OH 2UUKB 3MYWA 4WMDA 1Q2WA 1HXFH 1THSH 2ALVA 2Y82A 1HNEE 1FAKH 2BLVA 1K22H 2GV6A 1OWKA 2JDID 1NPMA 1ELFA 1UVOA 4MG3A 1F5RA 2F91A 4OGYA 1V2TT 3A7WA 1RIWC 2GMTB 1CT2E 2VBCA 2ASUB 1AIXH 1RRKA 3GY7A 5FCRA 1HAZB 3GICB 4JZFH 5DP9A 3QDZB 3ZVBA 2J98B 1MKWH 1F5KU 1FXYA 2YMSB 1SSXA 5C1UA 2WV5A 1KXBA 3PRDA 1PPGE 1ELEE 2AMDA 3FOAA 1O3IA 4GCHF 1O37A 4KGAA 1KTTB 1P3EA 5EPYA 4CH2B 1DLKB 4Q7XA 3A86A 1Y3VA 2RG3A 2G5VA 2ZHWH 1AQ7A 1NU9A 1TGNA 4CBNA 4INHA 2ZDVH 3GOVB 2QF0A 1IQGA 2XW9A 2PKAA 3KGPA 3F9EA 3M61U 2ZFTA 1Z1JA 3PV2A 2ZHQH 1DLEA 2J97A 2ZTXA 2F9UA 2HGTH 3K6ZA 4GHTA 1UCYK 2XYAA 1QA0A 2GCHG 2FIRH 3A8AA 4FU7A 1C2LA 1E36B 1C5ZB 1CU1A 2OTVA 1AE8H 1CT4E 5JBCS 2BQWB 4IGDA 1FUJA 3N7OA 1O3AA 3WY8A 2A0QB 5BPEA 2D26C 5F6MA 1EAWA 5E0HA 1UHBB 2WPIS 2NU0E 3FVFB 2KR7A 1G30B 2G4UA 1EAXA 1O5FH 3LJJA 1BMFD 4Y0ZE 1GBJA 1XX9A 3EE7A 5TJXA 5A8XA 5E2PA 2BDHA 3ZVCA 1UTQA 1VGCC 3MO3A 3LOXA 2PTCE 1OXGA 3RU4T 1BITA 2L74A 1GI3A 4FUEA 4X1PU 1TALA 1YCPM 3U98H 1NBMD 2VU8E 3HPTB 1TB6H 1A0LA 3NPSA 5C2ZA 1IAUA 1RXPA 4X8TH 1SGPE 5HM2A 2JJ2D 1C5XB 1MQ5A 5DKMA 2OC8A 1SPJA 2GX4A 4FUCA 4HG6A 5GPIB 1A3BH 1L0ZA 1SGIB 4NIVA 3SNDA 2O8LA 4X6NA 1ZPCA 3ENSB 1TQ0B 3BTDE 3RM2H 3BTFE 1V2PT 1W2KH 3BTWE 3M35A 1O3FA 2HPQH 1A5HA 1C5PA 1K1PA 1TWXB 2VGCB 2XBWA 3ZZCA 1S83A 1PPEE 3QGNB 3BG8A 1ZZZA 2J4IA 4NCYA 3DT0H 1O35A 2FO9A 1OWJA 1EP6A 1GI1A 1C1WH 4INLA 2AGGX 3ZZAA 2B7DH 1C2FA 5L2YH 1EZXC 1ZOMA 4JK6A 2TPIZ 1C2KA 3M5NA 4B75A 3ODDA 5L6NH 3SI3H 1IOEA 1MZDA 1P9SA 1AMHA 4HTCH 2R9PA 2NU4E 1TX7A 3UNRA 3BEUA 4A6LA 1YPHE 1DSTA 2P59A 3K2UA 3UR9A 1JMOH 1C5TA 1MMJN 5CE1A 1GBAA 1K0HA 5H4IB 2F9NA 2WPDD 3D49H 1GMCG 1O5GH 1GMHF 1GI0A 4E05H 3S9BA 2A4OA 3E16B 3GY2A 1FONA 2PV9B 3NZIA 3ZZ8A 2ZU1A 1AGJA 1E79D 2Q1JA 3SORA 2ODYB 3DD2H 3HKIB 2J38A 1E1RD 1COWD 3BG4B 1C2EA 3AASA 1AZ8A 1Z1IA 3URCA 1F2SE 4XBCA 4MTBA 1HJAC 2BY5X 1E37B 1SG8B 3KN2A 4NSVA 1AVXA 1OWHA 1C2MA 2XBXA 1GBCA 3TJOA 2Z9GA 3NWUA 1ANCA 1FMGA 1UW7A 1XUKA 2FODA 3M7TA 1BTUA 3SV9A 4JYUH 4Y76A 1NESE 2TRMA 1BJUA 4FUBA 2KCPA 3MMGA 1ZGIA 3TJNA 1HYLA 1EASA 1VITG 3RMNH 3SW2B 1HAVB 1FY1A 1TOCB 2VIVA 3FAOA 1P04A 2CMYA 2QY0B 2PGQB 1OS8A 3GYMA 2WSSD 5I25A 1FNIA
chains in the Genus database with same CATH topology
1QRWA 2RA0A 2ZU5A 1L2EA 3ITIA 3U8OH 4Y7AA 1ZTKA 1J9CH 5SGAE 2ZGHA 4AG1A 4ZUHA 1OPHB 4A1XA 2G51A 3DUXH 3SUFA 4B2AA 1HJ8A 2FYQA 5C1XA 3SU0A 6ESTA 1O2OA 1EXFA 1QIXB 4NIWA 1Y3WA 3RM0H 1DUEA 4D8NA 2WPMS 4UE7H 1DITH 2OC7A 1TFXA 2ZHEH 3SV7A 4ZROA 1CQQA 3RUOA 1TBRH 9ESTA 1QR3E 3A81A 1AHTH 1TNGA 1ELDE 1UJ1A 1XKBC 4IC5A 1PJPA 1O2IA 1GVKB 3C27B 3EA9A 4I8HA 1KY9A 4YT7H 2A2QH 3EGKH 1AZZA 3U9AH 6LPRA 3ZZ7A 1XMNB 4B76A 4X0WU 5LPFA 1TQ7B 2XC4A 4NIXA 1V2RT 1F7ZA 2EA3A 4OGXA 2ZGBH 2C90B 1J8AA 1V2VT 1TNHA 2CF9H 2JH5D 4ZKRU 1YPHC 3B23B 5FX6A 3SO3A 1QA7A 1ANEA 3P8GA 2F9PA 4HFPB 2BY7X 2P3TB 4MNYA 4CRBA 3SV6A 3HKJB 4ZAEA 1GJ5H 1H8DH 1GHXH 1Q31A 1NFYA 4XOJA 3A84A 3BTME 5FCKA 3T25A 4F49A 5LPEA 4OS2A 5K7RA 1TONA 1GHBG 2GT8A 1DE7H 1CE5A 1Y5AT 1UTJA 1MQ6A 6GCHF 1W8BH 2GCTC 5DPAA 1DY9A 4AYYB 4ABBA 4K1TA 4K2YA 3TK5A 3UWIA 3A83A 1KXDA 3A8BA 3ZZBA 3VGCB 1TOMH 1NY22 1SGYE 5LH8A 2ZHDA 3VB5A 3TGJE 4I31A 2H9EH 2Y6TA 3BSQA 4MQAA 1P03A 4I8LA 1C2HA 2FPZA 2F83A 4OS7A 2SGDE 5JDUB 3Q3XA 1SFQB 3ZVAA 1BMNH 1O3DA 4MDSA 1C5LH 2BQ7B 1BJVA 2VINA 1RTLA 1TPAE 2VWMA 4AGJA 3NKKA 3BTGE 3GCTG 2CV3A 2Y5GA 2K1QA 1C5OH 1A61H 1EX3A 3LH3A 3U1JB 2F3CE 4ZXYH 1GBDA 2BD8A 3SV2H 1FQ3A 1GHAG 1C1UH 1JRSA 3SJIA 2GP9B 1YPLH 1O38A 1W7GH 1W10U 1Z7KA 2BLQA 4XBBA 4INKA 3A85A 5HMAA 1L4ZA 3MO9A 4CR5A 3A7VA 1SQAA 1ANBA 4WXVA 4Q2KA 1TX8A 5G4BA 3S7HB 1AO5A 3T62A 1HJ9A 2XRCA 3L6PA 3ZZ6A 1D3TB 1MBQA 1O3PB 1P57B 1MZAA 2ZGCA 1O3KA 1MUEB 2D1JA 1RTFB 1H9LB 1BHXF 1ELGA 3H7OA 3RC6A 4ZHMU 1C1NA 1YF4A 3OYPA 1TE0A 1TPSA 3QN7A 3FZDA 1CBWB 1A4WH 5ESTE 5F8ZA 1ZHMA 5JBAS 1BTPA 4LZ1H 2ANKH 4K69A 1DICA 1FPCH 3CS7A 5DP6A 2UWLA 3MNXA 2WPHS 3GY8A 4X8UH 1GGDC 1WBGB 4QT8C 5GIBA 2PSXA 1O32A 3SJKA 1DY8A 1LVYA 2QV1A 1HAYB 5JB8S 3V0XA 5FBIA 1UCYH 1K9OE 3R3GB 3RXVA 3RXGA 5PTPA 1OX1A 4A7IB 4CRFA 4Y71A 1V2UT 3PTNA 2XWAA 1ZSKA 3U69H 3VFEA 1W11U 3ZVDA 2ZFFH 1DANH 1AKSB 1XXFA 1AUJA 1Z71A 4ABHA 2QXHA 4Z6AH 3RXMA 2BY9X 5CHAC 2UWPA 1TMBH 4O97A 1O2XA 3TK9A 1O2TA 3RXAA 2ZG0H 3IWMA 2A5KA 1UVTH 1AUTC 4M7GA 1V3XA 1WUNH 1V2NT 2A4QA 3SJOA 3FP8E 1FZZA 1V2ST 2O8TA 4BAKB 5GCHG 4TYDA 3SJ9A 1HV7A 2VVCA 1ELBA 1F5LA 1ZJKA 2OINA 4R8TB 3P8FA 5JYIA 2BB4A 4B2CA 1UO6A 3RXKA 4UDWH 4CHAC 1UVSH 3EYDA 1GI2A 4K5ZA 4LK4A 3M36A 4ABIA 1GJ7B 3OTJE 1GPZA 4FXGH 2RCEA 3VPKA 1TRMA 4H42U 4AB9A 1LHDH 2SGPE 1UK2A 3BEIB 1QCPA 1HIAB 1S0RA 5I46H 4O3UA 3TNSA 4BTIB 3I78A 4ZH8A 3GY6A 1K1JA 1DFPA 9LPRA 3SU2A 5C5NA 1L1GA 1C1QA 1ZMNA 1MKXK 1T8NA 3SOSA 4AGKA 2GCTB 2CHAB 1UHBA 1ZJDA 3LPRA 1ARCA 1LQDB 2PWXA 1RTKA 1KXFA 2VJ1A 3TJVA 1ELCA 1MU8B 4K8BA 4GPGA 4RKOB 2AGEX 1P10A 1P3CA 3BTTE 5EU8A 4YOGA 2H5DA 2H1UA 4Y6DA 1DS2E 2P3UB 4B73A 2V35A 1O5AB 1LVOA 4YLUA 2Z3EA 1N6XA 1NU7B 2SFAA 1TGBA 2LNCA 1O2QA 5GXPA 1G32B 4FU9A 2VIDA 1LPGB 3MHWU 3UQOA 1BMMH 3T27A 3A89A 3BEFB 3A80A 4AORA 1OWDA 1IQFA 4IN1A 1QNJA 1SVPA 3Q77A 1FIWA 1AE5A 2FDAA 2WYGA 1E34B 4SGBE 2ZCKP 2ZFSA 3B9FH 3F6UH 1ANDA 4X8VH 1YLCA 1Z8JB 3S9AA 3M37A 1TBQH 8GCHG 2WUCA 5AVDA 1AFQC 4LXBH 2RDLA 1G2LA 1CHOF 4X1QU 1SFIA 3G01A 1TABE 1QJ1B 4NA7A 1UK4A 2FS9A 2G4TA 2XWBI 3VB4A 2Y7XA 3M3VA 4U32A 1GJ8B 2ZPRA 1ZMLA 1YM0A 3U1IB 1YC0A 2AYWA 2P3FH 5TCCA 5F8XA 2UUYA 4DIIH 1IHTH 3GISB 5E0GA 2A32A 1MD7A 1DUAA 1T4VH 4CRGA 1INCA 1LVMA 2KAIB 3RXIA 3SNCA 2AS9A 4MLFB 2GGVB 1GGDB 3AAVA 1EB2A 2Y5FA 3ZZ5A 3QUMP 4H6TA 4X6OA 3RU4D 4ISIH 4MNXA 1DWBH 1IQEA 1P05A 1HPGA 3ZZ9A 2F9OA 1T32A 1P02A 1LDTT 3MTYA 1CGHA 1LHEH 2BHGA 1G37A 2FOFA 3E90B 3T5FH 2B9LA 2VNTA 2XC0A 4WXIA 1J14A 1LO6A 3BTHE 1HAHH 2QYIA 1OP8A 3KQBA 3O8DA 1KXCA 1GJCB 1HFDA 3SU6A 3PTBA 2M5TA 1KXEA 3L3TA 4DURA 2F9VA 1FJSA 1IQIA 2DE8A 3ZV8A 4WH6A 1ETTH 4NWKA 3RMLH 3RXJA 3SV8A 1LTOA 5E8EH 5LGOA 1QQUA 2CGAA 1C2GA 5DP4A 1KTSB 1V2QT 3PWCA 4O03A 5AF9H 5EW2H 1AWHB 1F92A 3SQHE 3EA7A 4CHAB 1LKAA 2HPPH 1PYTD 4YO9A 2H5CA 2ZU3A 6CHAC 5EXNA 1EQ9A 1XVMA 1PFXC 4H4FA 5EW1H 2BYAX 3AVZA 3ATKA 2HOBA 1ABJH 4ASHA 1C4V2 4PROA 3GCOA 1NROH 3QTOH 1FLEE 4ZKSU 3E6PH 1C5UA 2AIQA 2XNIA 1VCPA 4HI3A 4DJZB 1CHGA 2H9HA 3LU9B 4U2WA 2VIWA 1GBEA 1K2I1 2ZNKH 3UQVA 3ATWA 1EAUA 1FI8A 3CP7A 5FPTA 1GHWH 3PROA 1P2NA 3SUGA 5E0JA 2ZO3H 1GBBA 1XM1A 5EGMA 4GVUA 1W3CA 3LKWA 1LHGH 2O8WA 4XBDA 3RXLA 2Z6BD 1Q3XA 1Z6EA 3SJ8A 5JB9S 1D3DB 3GCHC 3NXPA 4A1TA 1QL8A 3E0PB 1BTXA 3MWIU 1EPTB 3T26A 2FESH 3FFGA 1QBOA 1ZRKA 4IW4E 4WVPE 4XSKU 3B8JA 3SGBE 1SGDE 3ELAH 1NN6A 2FEQH 2HALA 1C2JA 1O3OA 1O2SA 2OD3B 4YESB 4IMQA 1EAIA 3E3TA 1GCDA 4GSOA 2BZ6H 4I32A 2ZECA 3FP6E 1FY4A 4X2XA 1HAXB 1O2RA 1T8LA 3M7QA 1V2JT 1LKBA 4CRCA 4X1RU 3D62A 1KIGH 1E35B 1UTMA 1Y5UT 1S6HA 1A5IA 1TPPA 4JMYA 2WV4A 5FX5A 3U8TH 1K1OA 1N8OC 4BTTB 3UY9A 3TVJB 2NWNA 2ZCHP 1O2JA 3OX7U 1OYQA 2QXIA 1D6WA 1AVGH 2XTTB 2PKSC 4B2BA 2D2DA 1O36A 1O5CB 3F1SB 1RIWB 4K1SA 3LGTA 1T8OA 1ARBA 1Z8IB 4IC6A 3S9CA 1O3MA 3SNBA 4WMFA 1S84A 1GBKA 1JRTA 1OSSA 4FVDA 3A8DA 5EXLA 2YNAA 3UNSA 3I29A 3MNCA 1B0FA 3MOCA 1O2WA 3SN8A 1MD8A 3TNTA 1TIOA 1HB0B 2BXTH 3RXBA 1JBUH 1O34A 2ZZUH 4X2VA 2FX4A 1XUJA 4UEHH 2IPHA 4Y8ZA 2BDBA 3OSYA 4XFQA 1BTWA 3Q3KA 1NM6A 3MU1A 1ZPBA 2FMJA 1TNJA 4O9VA 5FBEA 1YKTA 2SNVA 1TNLA 2ZPQA 1OYTH 1QBVH 1PQ8A 3SNEA 1DXWA 1UTLM 1DSUA 1VITF 2IOTA 2RA3A 1GL1A 3LT3A 1SQTA 4CR9A 2BOHB 1GDUA 4DW2U 4YLQH 2BXUH 2SGEE 4U01A 2TIOA 3RXTA 1TX6A 4Y11E 1NFUA 1ZSJA 3KQEA 2GVFA 5HYOA 2JKHA 2D8WA 1PPHE 2VWOA 1O3CA 3SNAA 4MNVA 4JZEH 3SU3A 3M5MA 2G81E 5DP5A 5T3HA 3VB6A 2FOMB 1HUTH 1ETSH 3SU5A 1ZLRA 1GVZA 3P70B 1QQ4A 6CHAB 2GZ8A 1VGCB 2A7CA 5ETXA 1KLIH 1O3GA 1UTPA 5ABWA 1BDAA 3MU5A 1EB1H 2B0FA 2PW8H 1HGTH 4YM9A 3S0NA 4NFFA 2H9TH 4DT7B 4FUFA 1MKXH 1C9PA 2SGFE 1TBZH 1ABIH 2R0KA 3S7KB 1AKSA 3RC4A 5F8TA 1QL9A 4NFEA 5L30H 2ZFRH 1O3EA 3F9HA 1O5DH 2FOHA 3DA9B 2QIQA 3PYHA 5A8ZA 1LHCH 3Q76A 1E38B 4THNH 1W13U 2R2WU 2Y80A 5FPSA 1P2KA 3RU4E 4CH8B 4R0IA 1O33A 4B74A 4ABEA 1M9UA 2A7HA 3UOUA 4BOHA 3RXEA 3SUDA 3PO1C 1O2NA 4TPIZ 3TPIZ 1BA8B 1A7SA 1G3CA 2UWOA 2QXGA 3GCHB 2BD9A 2ANWA 4NIYA 1DWCH 1GDQA 1TA2A 2BDYA 2JETC 3R0FA 3DFLA 1QJ6B 5DJ7A 3TH4H 4BAMB 4Y0YE 1TNKA 1UVPA 2ULLA 3TGIE 1UVUH 1GHBF 3AW1A 3Q3YA 1GJBB 3ATIA 4FUGA 2XXLA 3MH6A 1TRYA 4YZUA 4RN6A 1C5MD 1A3EH 2W7SA 2A1DB 1GL0E 4H6SB 3GY3A 1A0JA 3FZZA 1KSNA 4ISOA 3O8RA 1P06A 1UTKA 2A7JA 2AERH 1TGSZ 4DIHH 2P95A 2ANYA 2ANMH 2AFQB 2ALPA 1SGTA 2YOLA 4MPWA 1O2MA 2BVXH 4AZ2B 1YBWA 1N8OB 2ZCLP 1P01A 1DXPA 4FUJA 4NWLA 1O2VA 4JYVH 2BM2A 1HJAB 3ATMA 1GI4A 2QA9E 1JXPA 2VIPA 3UPEA 4I8KA 2AH4X 3LGUA 4ZHAA 5TCAA 3TU7H 5LPRA 3T28A 1CVWH 1V2MT 1Y8TA 2PR3A 1QY6A 1SHHB 1UTNA 5HXFA 3GCTF 1BBRE 2ODQA 5ESBA 3QO6A 3W94A 2VWNA 2BDAA 3BIVH 1VCQA 2GTBA 1BUIA 2J2UA 3MNSA 3VXFH 2OLGA 1MAYA 1ZR0A 1B7XB 2O8MA 1BOQA 4B71A 4BAOB 2C93B 2G52A 3K6YA 7ESTE 1IQHA 5BRRE 3UUZA 1VJAU 2A2XH 3P8NA 4O3TA 2H2ZA 1MTUA 2J95A 1Y5BT 3UOPA 4DGJA 2PGBB 1SB1H 1ZRBA 3STJA 4DCDA 1MTNC 4YT6H 2IJOB 1GJAB 1HRTH 4TWYA 1D6RA 1P2IA 2ZKSA 3MH7A 4D9RA 4WF8A 4IMZA 2GMTC 3ODFA 4TY7A 1XKAC 1TMUH 1TA6A 2OC0A 3ZVGA 1NT1A 1ZGVA 3TJUA 4F4OC 1C4U2 1MH0A 1C1SA 2FXRA 4GHQA 2BX3A 1JWTA 3A87A 4HGCA 2G55A 5FPYA 1ZMJA 2FOEA 3E91A 2P93A 1G9IE 2C8XB 3QGJA 1BZXE 2ZI2H 2FS8A 5AFZH 1F0RA 1DPOA 1AI8H 2SGQE 1JIRA 2FM2A 1BBRK 2W5EA 3BIUH 3M5LA 4D9QA 1IQMA 1THPB 2Z9KA 4NZLA 1B5GH 3E0NB 1YCPK 1MCVA 3ZZ3A 2YNBA 1LMWB 3GDVA 1NO9H 1BMLA 1EOLA 5EXMA 1ELAA 5DP3A 3RMOH 2J9NA 3A7ZA 7KMEH 1FPHH 1YLDA 4NZQA 1YYY1 2G8TA 2ZIQH 1NRNH 5AFYH 2P16A 4IS5A 3FANA 2GDEH 5C1YA 4TWWA 1WSSH 3UWJH 4X6PA 5C20A 5T6DA 3SZNA 3H5CB 2AEIH 1C2DA 3A7TA 1VITH 3VB3A 5CMXH 1FN6A 4WJG2 1K21H 1MAXA 3UIRA 4FUHA 2PTNA 2BQ6B 2FOCA 1PQ5A 3PO1B 4BNRA 2FOGA 2HNTF 2WINI 1GBLA 1A46H 3KQCA 4TY6A 4CRAA 2GKVE 2JETB 1GMDF 4WMEA 1V6DA 1O5EH 1T31A 4XE4A 5HM9A 4X1SU 1BRBE 3RLYH 3SHAH 4JK5A 1WV7H 1K1IA 2JH0D 5FAHA 2FLRH 1A0HB 4CBOA 2FZZA 1QB6A 4UONA 2VVUA 1L1JA 2ZC9H 7GCHF 1O2YA 5DK1A 2ZPSA 3F68H 1UTOA 3GY4A 1QTFA 1GCTC 1L4DA 2J94A 2WUBA 4ZHLU 1BB0B 1DVAH 1GWAA 1SGFG 2JH6D 5A0CA 2PLXA 5FHTA 2W3KA 4E06H 4X2WA 1XUHA 1AFEH 1VJ9U 2ZQ1A 2UUFB 3K9XB 1FY3A 4UFFH 3OY6U