4NCZA

Spermidine n-acetyltransferase from vibrio cholerae in complex with 2-[n-cyclohexylamino]ethane sulfonate.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
170
structure length
170
Chain Sequence
NSQLTLRALERGDLRFIHNLNNNRNIMSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYILQSKYLNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermidine n1-acetyltransferase
publication title A Novel Polyamine Allosteric Site of SpeG from Vibrio cholerae Is Revealed by Its Dodecameric Structure.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Transferase
total genus 50
structure length 170
sequence length 170
chains with identical sequence B, C
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2013-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4nczA00
1NSLA 4KZTA 2WPXA 2OZGA 1V0CA 1Z9UA 3D3SA 3VWDA 5FVJA 2KCWA 2X7BA 1UFHA 1I12A 3K9UA 4UA3A 4JD6A 4YRHA 3IWGA 2AJ6A 3SXNA 3W6XA 1QSTA 4Y49B 2Q4YA 2PR1A 2B58A 3R95A 3TT2A 2VQYA 4HNYB 4ZBGA 5HMNA 3B8GA 3FXTA 2R8VA 4NCZA 2GE3A 2B5GA 5I0CA 1YLEA 3FIXA 4XNHC 2Z0ZA 2I00A 1BOBA 5IV0A 4ORFA 4KOWA 2B3UA 2J8MA 1P4NA 3PGPA 1I21A 3GKRA 2HV2A 2D4OA 2ARHA 3I9SA 2EVNA 2FSRA 3ZJ0A 4K30A 4UBRA 2OB0A 4AVCA 1M1DA 2FXFA 2PR8A 1RO5A 4XPDC 1Q2YA 3T90A 4QB9A 2RC4A 4KUBA 1IICA 2Q04A 2QECA 1Z4RA 1YREA 4E0AA 2O28A 3CXSA 4KLVA 4OADA 3ZZIA 4R9MA 2R7HA 3FB3A 4KVME 4NF1A 2CNSA 3DR8A 4U5YA 3CXQA 2VZYA 4KOXA 3TOBA 5ISVA 1R57A 2FE7A 1SQHA 3FNCA 1YVKA 3D8PA 2FIAA 2OH1A 4KLWA 2BSWA 2BL1A 2P6FA 3DSBA 3GY9A 4RI1A 3LD2A 1XF8A 4KORA 2QIRA 4MHDA 3KKWA 2OU2A 2DXQA 2K5TA 2B4DB 2P0WA 5GCNA 4NSQA 1PU9A 4ONUA 2ZW7A 4PSWA 4E8OA 1KUXA 1WK4A 2AE6A 2ATRA 3E0KA 4X5KA 2JEVA 5JPHA 1Z4EA 1KUYA 1S7LA 3BLNA 3PP9A 4H6ZA 3PZJA 1QSRA 3R9FA 4XPKA 1P0HA 1XEBA 4FD4A 1IB1E 2G3AA 1S7NA 1IYLA 4H89A 2R98A 4CAVA 2B3VA 2Z11A 3EFAA 2FS5A 3JUWA 1K4JA 4R87A 1KZFA 1MK4A 1S3ZA 3S6KA 4MBUA 4QBJA 2BUEA 3TCVA 3F5BA 2NMTA 2OZUA 1B87A 3F8KA 3QAHA 2Y0MA 3CXPA 1QSOA 2GIVA 3MGDA 1N71A 3SHPA 1XE4A 2P6GA 1KUVA 1M44A 1J4JA 5F47A 2FIWA 2A4NA 5CNPA 3TO9A 4XNHB 5KTDA 5KTAA 1TIQA 4NEXA 3TFYA 2REEA 2P6EA 4KUAA 4L89A 3UY5A 4FD7A 2QMLA 2Q7BA 4IF5A 4QUSA 3WR7A 5C88A 2WPWA 1YVOA 1S60A 4E2AA 1Y7RA 4XPLA 3BJ8A 4PK2A 3D2MA 2CNTA 3EO4A 4OLLA 2PSWA 4JXRA 2JLMA 2Q0YA 1WWZA 4HKFA 5C82A 4KOTA 4CS0B 4HNXB 1QSMA 5H86A 4RS2A 1VHSA 3FYNA 4JXQA 1RXTA 3FBUA 2B4DA 3TOAA 2CY2A 3VWEA 4JLYA 2Q44A 1Q2DA 5IX3A 2BEIA 2Q4VA 2GANA 4MJ8A 4OAEA 3EC4A 3S6HA 3R9GA 1QSNA 2VBQA 5F46A 3TE4A 4PV6A 4KVXA 1VKCA 1YR0A 4B5PB 2HUZA 2J8RA 3EY5A 5E96A 4B5OA 2REFA 3G3SA 1IIDA 1B6BA 2OZHA 4PK3A 5F49A 4F6AA 3DR6A 4R3KA 3P2FA 3EXNA 4JJXA 4YFJA 4UWJA 4MY3A 2ZW4A 4MY0A 4EVYA 4H6UA 3T9YA 3S6FA 1MJ9A 3QB8A 5H84A 4MI4A 4U9ZA 4CRZB 2VZZA 2G0BA 4AG7A 3SXOA 4YGOA 2B4BA 3FRMA 3R9EA 2H5MA 4R3LA 3LODA 4AB7A 3RYOA 4CAWA 3IGRA 3D2PA 1S7KA 4KOYA 1NE9A 2F5IA 3OWCA 4LUAA 3H4QA 3BJ7A 2FT0A 2JDDA 1S5KA 1Q2CA 5J8CA 5HH1A 4NXYA 5EBVA 4Y49C 3I3GA 4CAXA 2HQYA 4L8AA 4I49A 2ZXVA 4R57A 5EC4A 1MJAA 2JDCA 3TO6A 4XPDB 4AG9A 5J8FA 5IB0A 2VXKA 2FCKA 4LX9A 1I1DA 3TTHA 2C27A 1U6MA 1NMTA 1PUAA 2B5GB 2Z10A 1CJWA 2FL4A 4AVBA 5F48A 3JVNA 4BMHA 1M4DA 1GHEA 1Y9KA 4AVAA 2I79A 4F0YA 3G8WA 1OZPA 2PC1A 4JWPA 4U9YA 2CNMA 1M4IA 3W91A 4B5PA 2R1IA 4QC6A 2ZW5A 1YX0A 4KOSA 3W6SA 3R1KA 1CM0A 4UWIA 3S6GA 1YGHA 1S7FA 1IYKA 3R96A 5JQ4A 4HNWB 1Y9WA 2G3TA 5KTCA 4QVTA 2PDOA 3N7ZA 3P2HA 4IUSA 1ON0A 3NE7A 2EUIA 1FY7A 4M85A 2D4PA 4KOVA 1YK3A 1L0CA 4CRYB 2VI7A 3DDDA 3V8IA 2J8NA 1M4GA 4DNCA 1LRZA 1MJBA 3GYAA 4KOUA 5DWMA 3F0AA 2IL4A 2PRBA 3C26A 4II9A 3TO7A 1BO4A 2ZPAA 3DNSA 1XMTA 5DWNA 2VEZA 4FD5A 4M3SA 4PSXA 4KVOE 4J3GA 2ZW6A 2PQ8A 1XIXA 4GS4A 4FD6A
chains in the Genus database with same CATH superfamily
3SJXA 3LACA 4K3NA 1NSLA 4A31A 5F09A 1UWYA 3LMSA 2PVWA 4KZTA 2WPXA 2OZGA 1V0CA 1Z9UA 4MXUA 4B6ZA 3D3SA 3VWDA 1BLLE 3CDXA 3IIBA 1X12A 5FVJA 1VIXA 2KCWA 2X7BA 1UFHA 3K9TA 4NGTA 4UFWA 1I12A 3K9UA 4UA3A 2V77A 1KWMA 1XFOA 4JD6A 4YRHA 4G1PA 3IWGA 4OKOA 2AJ6A 3SXNA 3KQXA 5K8MA 3W6XA 1YW6A 1QSTA 4PQAA 1Y7EA 7CPAA 5HVHA 1YLOA 4YWYA 3RZAA 4Y49B 3S9LA 1IOIA 2Q4YA 1BPNA 2ZEFA 2PR1A 2ZEGA 2V8HA 5AGEA 1CX8A 3V7ZA 2B58A 4TWEA 4NGRA 3R95A 3TT2A 2Z3NA 2PJ9A 4C2ZA 2VQYA 4HNYB 4FAIA 4ZBGA 3ISXA 1CG2A 4ZY2A 3RBUA 2V8DA 1M4LA 5HMNA 2DEAA 3B8GA 3FXTA 1AYEA 2R8VA 2JBJA 4NCZA 2GE3A 1LAPA 3KI9A 4P6YA 2B5GA 5I0CA 3BI0A 4UIAA 1YLEA 2DPSA 3FIXA 2OR4A 4XNHC 2JEWA 1F2OA 2Z0ZA 2I00A 4ZYQA 1BOBA 5IV0A 4ORFA 4B12A 3SI2A 4KOWA 2B3UA 2J8MA 4X3RA 1P4NA 1CPSA 2C6CA 1I21A 3PGPA 4OIWA 3GKRA 2HV2A 2AFUA 2ARHA 2D4OA 1LAMA 2PJ7A 4O23A 2DPTA 3I9SA 2EVNA 2FSRA 2O53A 3KR5A 3ZJ0A 1ZLHA 2F7VA 3FMCA 2OB0A 2YNCC 1M1DA 4K30A 2GLFA 4UBRA 4A94A 2FXFA 5AG6A 4OC0A 3L2NA 2PR8A 1RO5A 4XPDC 1Q2YA 3T90A 4QB9A 2Z3KA 2RC4A 4KUBA 1IICA 2Q04A 2ZELA 2QECA 1Z4RA 4GM5A 1FNOA 4UEZA 1YREA 4E0AA 2O28A 3CXSA 4KLVA 4OADA 1OBRA 3QAYA 4NGSA 1QMUA 3NH5A 3ZZIA 5CBMA 4R9MA 4MFKA 2CXAA 2R7HA 4PXCA 4ZX9A 5JM6A 3IJ3A 2PRQA 5THWA 3FB3A 4KVME 4NF1A 2VL1A 3KR4A 1ARLA 4UFVA 2CNSA 3NH8A 5JH9A 3DR8A 4U5YA 3CXQA 2VZYA 3D66A 3SI0A 4KOXA 4M6GA 2AFMA 3TOBA 1ZG8A 2C1CA 2Z3LA 5ISVA 1Z8XA 2FVGA 2RFHA 1R57A 1TXRA 2FE7A 4Q36A 1SQHA 4A33A 3FNCA 1YVKA 1ZLIA 3VARA 3D8PA 2FIAA 2OH1A 1Q7LA 2ZENA 4KLWA 2BSWA 2BL1A 2P6FA 3DSBA 3GY9A 4PXDA 4RI1A 5LYIA 5A28A 2HB6A 2IJZA 3LD2A 1XF8A 4KORA 2QIRA 4MHDA 3KKWA 4ZY0A 2OU2A 2DXQA 4R8FA 2K5TA 2B4DB 2G9DA 3RNZA 2P0WA 2WZNA 3FVLA 5GCNA 2EWBA 4B10A 2YNEA 4NSQA 1PU9A 1TKFA 2ZW7A 4ONUA 4DUKA 4PSWA 3MN8A 5LRJA 1KUXA 1XJOA 4E8OA 1WK4A 4CGLA 2BCOA 2EK8A 2AE6A 2ATRA 4MCPA 5AG4A 4P4IA 3E0KA 1Z8TA 3SI1A 4ZX8A 2Q43A 4X5KA 2JEVA 5JPHA 1Z4EA 4P4BA 2CTCA 5DS0A 5HVGA 3LWUA 2EO8A 4OIDA 1KUYA 4LQ6A 3TC8A 2Q4ZA 4KS9A 1S7LA 3BLNA 3PP9A 4H6ZA 3PZJA 1QSRA 2ZEDA 4OP4A 3R9FA 3GLJA 4WWVA 4XPKA 1P0HA 1R43A 3D7FA 1XEBA 3D7DA 4CAEA 5HXDA 4FD4A 2RB7A 1IB1E 2G3AA 1S7NA 4OC2A 5G1ZA 1IYLA 5IB9A 2V8GA 4H89A 2R98A 2AFOA 4CAVA 3SJEA 2GLJA 2B3VA 2WSAA 2Z11A 3PB8X 3EFAA 2FS5A 1LCPA 1XBUA 2Z3OA 3BHXA 1K4JA 2PJ5A 3JUWA 4IK2A 3VH9A 4R87A 1PYTB 1KZFA 3KL9A 3VATA 1MK4A 1Z5RA 1S3ZA 3S6KA 4MBUA 4QBJA 3CPAA 2BUEA 4CGOA 2C6PA 3HLPA 4F0XA 4CYNA 2Q51A 4CGNA 3TCVA 3F5BA 1GYTA 2NMTA 4CYPA 2OZUA 2ANPA 1A2ZA 1B87A 2AFWA 3F8KA 3JRUA 3QAHA 4HPSA 2Y0MA 4CGMA 2PCUA 3CXPA 1QSOA 2GIVA 2V8VA 3MGDA 4LQGA 1N71A 4UFXA 2ODFA 3SHPA 1XE4A 2P6GA 2PJ1A 3H8EA 1KUVA 1CP6A 1M44A 1VHOA 3QNVA 1J4JA 4EWTA 5F47A 2FIWA 2A4NA 5CNPA 3TO9A 4H2KA 1TF9A 2GU2A 2ZOFA 4OC1A 4XNHB 4AXVA 5KTDA 2PJ6A 1IGBA 5KTAA 1Z2LA 1TIQA 3IC1A 1AMPA 4NEXA 3TFYA 2REEA 1JWQA 2P6EA 3PFOA 4AVCA 4MCRA 1HDUA 4KUAA 1X10A 4L89A 4R6TA 3UY5A 4BBHA 4DYOA 4FD7A 2QMLA 2Q7BA 4NJRA 2CTBA 4IF5A 2BO9A 4EMEA 4QUSA 3WR7A 5C88A 2WPWA 3B3VA 3GB0A 1YVOA 1S60A 3KZWA 2I3CA 1Y7RA 4P44A 4CPAA 4WJBA 1BAVA 4E2AA 3B3SA 3KASA 1ELMP 2AFXA 4XPLA 3PB6X 1XOVA 1Z8WA 2NSMA 3D4UA 2XEGA 4Z65A 4MMOA 3BJ8A 2GFQA 4PK2A 1EE3P 3D2MA 2XEIA 4MFJA 4OMEA 5I4MA 2CNTA 5JGFA 5K8OA 3EO4A 4YU9A 2Z3MA 4OLLA 4P4DA 3IO1A 5HVFA 2PSWA 3N5FA 5BWAB 2ZEPA 4JXRA 2JLMA 2Q0YA 2XEJA 1WWZA 4HKFA 4F9UA 2PJ4A 5C82A 2PJCA 3FF3A 2IMOA 4NGMA 4KOTA 4CS0B 4HNXB 2PJ2A 1QSMA 2C6GA 5G21A 5H86A 4RS2A 2OOTA 1TKJA 4FBEA 3WC5A 3IU1A 4A38A 1VHSA 4P10A 3FYNA 4A39A 4JXQA 4P4EA 3PBEA 1Y0YA 3HUVA 1IU8A 3IFEA 4B11A 1RXTA 1XMBA 4JZ0A 2QVPA 3FBUA 2B4DA 3TOAA 2CY2A 3VWEA 4JLYA 2Q44A 1Q2DA 2WYRA 1H8LA 5IX3A 1YW4A 2BEIA 2Q4VA 2GANA 4MJ8A 4M6HA 4OAEA 3EC4A 2EBJA 3A9LA 3S6HA 3R9GA 1DE4C 5LRGA 1QSNA 1CPXA 2CF4A 2VBQA 5F46A 3TE4A 3CZXA 2BOAA 3B2YA 3NE8A 4PV6A 4UCNA 4C2XA 3S9NA 4KVXA 4P4JA 1VKCA 1YR0A 1VHEA 4UCMA 4B5PB 4EFDA 2PJ8A 2HUZA 1CP7A 2HC9A 2J8RA 3EY5A 5E96A 4A2ZA 3BXMA 4B5OA 4CAFA 1HEEA 2REFA 3FX6A 3G3SA 4MFZA 1CBXA 4MHPA 1IIDA 1IOFA 1B6BA 2OZHA 4PK3A 5F49A 4F6AA 2POKA 1Z8LA 3DR6A 4R3KA 4UEFA 4MFQA 3P2FA 3EXNA 4JJXA 4R76A 4YFJA 3PEIA 4UWJA 4MY3A 4Q7AA 1QQ9A 4ZY1A 2ZW4A 2PJ0A 3IWEA 4MFPA 5K8NA 4MY0A 4PPZA 3IEHA 2ZEHA 4P4FA 2WUUA 2YNDA 1BPMA 4EVYA 4H6UA 3T9YA 1ZG7A 4MHNA 3S6FA 3WABA 1MJ9A 3GIUA 1LOKA 3QB8A 2PIZA 2QJ8A 4NGQA 4F9VA 3PB7X 4RN7A 3FJUA 5H84A 2J9AA 2PE3A 3B3WA 4MI4A 1ELLP 3MRUA 4U9ZA 4CRZB 3D7GA 1ZO0A 2GREA 2VZZA 2G0BA 4AG7A 4CYOA 3PFEA 3SXOA 4NGPA 4YGOA 1JQGA 4ZGYB 2B4BA 3KQZA 4A95A 3FRMA 3R9EA 2JBKA 3WT4A 2H5MA 4IHMA 4R3LA 3LODA 4AB7A 3RYOA 4CAWA 5LRKA 3IGRA 3D2PA 2ZEEA 2PJAA 4FUUA 3SJFA 3CT9A 1YSJA 3TX8A 4X8IA 1S7KA 8CPAA 4KOYA 4KSFA 1Y0RA 1F2PA 1NE9A 2F5IA 3OWCA 3CPXA 4LUAA 1YQEA 3H4QA 2YNCA 2YGWA 2PIYA 3BJ7A 2FT0A 2JDDA 1S5KA 1Q2CA 5J8CA 1F57A 3DGVA 5HH1A 5A27A 4NXYA 3B3TA 3H5ZA 4MCQA 5EBVA 5G20A 3D68A 4Y49C 4NGNA 6CPAA 3I3GA 4CAXA 2F8HA 2HQYA 4L8AA 2ZEOA 4I49A 2ZXVA 3PB4X 4R57A 4ZI6A 5EC4A 1MJAA 4FWUA 4A37A 2JDCA 4PXEA 3TO6A 3FEEA 4XPDB 4KSIA 3B35A 1DTDA 2PJ3A 4IAVA 4AG9A 5J8FA 3NA6A 5IB0A 2PJBA 4MHZA 4P45A 5D29A 3SJGA 4A32A 4MRIA 3GUXA 3RO0A 2VXKA 5EMIA 2FCKA 1IY7A 1XRYA 4MHYA 4UIBA 4LX9A 1I1DA 3TTHA 2C27A 1U6MA 4NJQA 1NMTA 1PUAA 1R3NA 2B5GB 3FECA 2ZOGA 2Z10A 1VGYA 1CJWA 2FL4A 4F8ZA 4AVBA 1AUGA 1ZG9A 2PVVA 5F48A 3JVNA 2ABZA 4BMHA 5CPAA 2DF5A 1M4DA 4C2YA 5LYLA 2Z3PA 1ARMA 2XEFA 4OC5A 4JYWA 1GHEA 4PXBA 4UF4A 1Y9KA 3KGQA 4W9YA 4A30A 3FH4A 1FT7A 5D8NA 2I79A 4AVAA 4B13A 4F0YA 4RUHA 2AFZA 3FEDA 5LYFA 3G8WA 5J1QA 1OZPA 2PC1A 4JWPA 2O4HA 4MCSA 4U9YA 3T8WA 3H8GA 3H8FA 2CNMA 1M4IA 3W91A 4BINA 4B5PA 2R1IA 3KHZA 5AG5A 4QC6A 2ZW5A 1YX0A 4KOSA 5LYDA 3W6SA 3KHXA 3R1KA 1CM0A 3NFZA 4UWIA 3S6GA 1YGHA 1S7FA 1IYKA 3PBBA 3R96A 5JQ4A 4HNWB 1Y9WA 2G3TA 3IWWA 2CIJA 4UCPA 3PB9X 4BD9A 5KTCA 4QVTA 4R7MA 3V38A 3WC7A 3RAMA 2PDOA 3JTKA 4OC4A 3N7ZA 3P2HA 4IUSA 3B3CA 2AFSA 4TNUA 4B14A 4GXHA 1ON0A 3IU2A 3NE7A 2EUIA 2QYVA 1RTQA 3K2KA 1FY7A 1TF8A 4M85A 2D4PA 3I1UA 4KOVA 4KSAA 1YK3A 1L0CA 4CRYB 3D67A 3DLJA 1YMEA 2ZEMA 2VI7A 3DDDA 4C7HA 3BI1A 4C7IA 4C68A 2Q7SA 3V8IA 2IQ6A 2J8NA 4CYQA 3NH4A 5AG7A 4DJLA 2NYQA 1M4GA 3WC6A 4DNCA 1LRZA 1MJBA 4MFLA 1HDQA 3GYAA 4KOUA 5DWMA 1LFWA 4X2TA 3F0AA 4M6IA 2IL4A 3S9MA 2PRBA 4CGPA 1TKHA 3ISZA 3B7IA 3C26A 4II9A 4ONWA 4UEEA 3TO7A 1BO4A 2ZPAA 5K8PA 1LANA 3DNSA 4Q38A 1XMTA 5G22A 5DWNA 2VEZA 4FD5A 1NSAA 4OC3A 4M3SA 4PSXA 3PRTA 4KVOE 5ELYA 4J3GA 2ZW6A 2PQ8A 4NFRA 1PCAA 1XIXA 4GS4A 2EK9A 4FD6A 3D7HA
chains in the Genus database with same CATH topology
1NSLA 4A31A 4KZTA 2WPXA 2OZGA 1V0CA 1Z9UA 3D3SA 3VWDA 5FVJA 2KCWA 2X7BA 1UFHA 4UFWA 1I12A 3K9UA 4UA3A 4JD6A 4YRHA 3IWGA 2AJ6A 3SXNA 3W6XA 1QSTA 4Y49B 2Q4YA 2PR1A 5AGEA 2B58A 3R95A 3TT2A 2Z3NA 4C2ZA 2VQYA 4HNYB 4ZBGA 5HMNA 3B8GA 3FXTA 2R8VA 4NCZA 2GE3A 2B5GA 5I0CA 1YLEA 2DPSA 3FIXA 4XNHC 2Z0ZA 2I00A 1BOBA 5IV0A 4ORFA 4B12A 4KOWA 2B3UA 2J8MA 1P4NA 3PGPA 1I21A 3GKRA 2HV2A 2D4OA 2ARHA 2DPTA 3I9SA 2EVNA 2FSRA 3ZJ0A 4K30A 4UBRA 2OB0A 2YNCC 1M1DA 4AVCA 2FXFA 5AG6A 2PR8A 1RO5A 4XPDC 1Q2YA 3T90A 4QB9A 2Z3KA 2RC4A 4KUBA 1IICA 2Q04A 2QECA 1Z4RA 1YREA 4E0AA 2O28A 3CXSA 4KLVA 4OADA 3ZZIA 4R9MA 4MFKA 2CXAA 2R7HA 3FB3A 4KVME 4NF1A 4UFVA 2CNSA 3DR8A 4U5YA 3CXQA 2VZYA 4KOXA 3TOBA 2Z3LA 5ISVA 4Q36A 1R57A 2FE7A 4A33A 1SQHA 3FNCA 1YVKA 3D8PA 2FIAA 2OH1A 4KLWA 2BSWA 3GY9A 3DSBA 2BL1A 2P6FA 4RI1A 5A28A 3LD2A 1XF8A 4KORA 2QIRA 4MHDA 3KKWA 2OU2A 2DXQA 2K5TA 2B4DB 2P0WA 5GCNA 4B10A 2YNEA 4NSQA 1PU9A 4ONUA 2ZW7A 4PSWA 4E8OA 1KUXA 1WK4A 2AE6A 2ATRA 5AG4A 3E0KA 4X5KA 2JEVA 5JPHA 1Z4EA 1KUYA 4KS9A 1S7LA 3BLNA 3PP9A 4H6ZA 3PZJA 1QSRA 3R9FA 4CGLA 4XPKA 4CAEA 1P0HA 1XEBA 4FD4A 1IB1E 2G3AA 1S7NA 5G1ZA 1IYLA 4H89A 2R98A 4CAVA 2B3VA 2WSAA 2Z11A 3EFAA 2FS5A 2Z3OA 3JUWA 1K4JA 4R87A 1KZFA 1MK4A 1S3ZA 3S6KA 4MBUA 4QBJA 2BUEA 4CGOA 4F0XA 4CYNA 4CGNA 3TCVA 3F5BA 2NMTA 4CYPA 2OZUA 1B87A 3F8KA 3QAHA 2Y0MA 4CGMA 3CXPA 1QSOA 2GIVA 3MGDA 4UFXA 1N71A 3SHPA 1XE4A 2P6GA 1KUVA 1M44A 1J4JA 5F47A 2FIWA 2A4NA 5CNPA 3TO9A 4XNHB 5KTDA 5KTAA 1TIQA 4NEXA 3TFYA 2REEA 2P6EA 4KUAA 4L89A 4BBHA 3UY5A 4FD7A 2QMLA 2Q7BA 4IF5A 4QUSA 3WR7A 5C88A 2WPWA 1YVOA 1S60A 4E2AA 1Y7RA 4XPLA 3BJ8A 4PK2A 3D2MA 4MFJA 2CNTA 3EO4A 2Z3MA 4OLLA 2PSWA 5BWAB 4JXRA 2JLMA 2Q0YA 1WWZA 4HKFA 5C82A 4KOTA 4CS0B 4HNXB 1QSMA 5G21A 5H86A 4RS2A 3IU1A 1VHSA 3FYNA 4JXQA 4B11A 1RXTA 3FBUA 2B4DA 3TOAA 2CY2A 3VWEA 4JLYA 2Q44A 1Q2DA 5IX3A 2BEIA 2Q4VA 2GANA 4MJ8A 4OAEA 3EC4A 3A9LA 3S6HA 3R9GA 1QSNA 2VBQA 5F46A 3TE4A 4PV6A 4UCNA 4C2XA 4KVXA 1VKCA 1YR0A 4B5PB 4UCMA 2HUZA 2J8RA 3EY5A 5E96A 4A2ZA 4B5OA 4CAFA 2REFA 3G3SA 4MFZA 1IIDA 1B6BA 2OZHA 4PK3A 5F49A 4F6AA 3DR6A 4R3KA 4MFQA 3P2FA 3EXNA 4JJXA 4YFJA 4UWJA 4MY3A 2ZW4A 3IWEA 4MFPA 4MY0A 2WUUA 2YNDA 4EVYA 4H6UA 3T9YA 3S6FA 1MJ9A 3QB8A 5H84A 4MI4A 4U9ZA 4CRZB 1ZO0A 2VZZA 2G0BA 4AG7A 4CYOA 3SXOA 4YGOA 4ZGYB 2B4BA 4A95A 3FRMA 3R9EA 2H5MA 4R3LA 3LODA 4AB7A 3RYOA 4CAWA 3IGRA 3D2PA 1S7KA 4KOYA 4KSFA 1NE9A 2F5IA 3OWCA 4LUAA 3H4QA 2YNCA 2YGWA 3BJ7A 2FT0A 2JDDA 1S5KA 1Q2CA 5J8CA 5HH1A 5A27A 4NXYA 3H5ZA 5EBVA 5G20A 4Y49C 3I3GA 4CAXA 2HQYA 4L8AA 4I49A 2ZXVA 4R57A 5EC4A 1MJAA 2JDCA 3TO6A 4XPDB 4AG9A 5J8FA 5IB0A 4A32A 2VXKA 2FCKA 4LX9A 1I1DA 3TTHA 2C27A 1U6MA 1NMTA 1PUAA 2B5GB 2Z10A 1CJWA 2FL4A 4AVBA 5F48A 3JVNA 4BMHA 4C2YA 1M4DA 2Z3PA 1GHEA 4A30A 1Y9KA 4B13A 4AVAA 2I79A 4F0YA 3G8WA 1OZPA 2PC1A 4JWPA 4U9YA 2CNMA 1M4IA 3W91A 4B5PA 2R1IA 5AG5A 4QC6A 2ZW5A 1YX0A 4KOSA 3W6SA 3R1KA 1CM0A 4UWIA 3S6GA 1YGHA 1S7FA 1IYKA 3R96A 5JQ4A 4HNWB 1Y9WA 2G3TA 4UCPA 5KTCA 4QVTA 2PDOA 3JTKA 3N7ZA 3P2HA 4IUSA 4B14A 1ON0A 3IU2A 3NE7A 2EUIA 1FY7A 4M85A 2D4PA 4KOVA 4KSAA 1YK3A 1L0CA 4CRYB 2VI7A 3DDDA 4C7HA 4C7IA 4C68A 4CYQA 3V8IA 2J8NA 5AG7A 1M4GA 4DNCA 1LRZA 1MJBA 4MFLA 3GYAA 4KOUA 5DWMA 3F0AA 2IL4A 2PRBA 4CGPA 3C26A 4II9A 3TO7A 1BO4A 2ZPAA 4Q38A 3DNSA 1XMTA 5G22A 5DWNA 2VEZA 4FD5A 4M3SA 4PSXA 4KVOE 4J3GA 2ZW6A 2PQ8A 1XIXA 4GS4A 4FD6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NSL A;  4KZT A;  2WPX A;  2OZG A;  1V0C A;  1Z9U A;  3D3S A;  3VWD A;  5FVJ A;  2KCW A;  2X7B A;  1UFH A;  1I12 A;  3K9U A;  4UA3 A;  4JD6 A;  4YRH A;  3IWG A;  2AJ6 A;  3SXN A;  3W6X A;  1QST A;  4Y49 B;  2Q4Y A;  2PR1 A;  2B58 A;  3R95 A;  3TT2 A;  2VQY A;  4HNY B;  4ZBG A;  5HMN A;  3B8G A;  3FXT A;  2R8V A;  4NCZ A;  2GE3 A;  2B5G A;  5I0C A;  1YLE A;  3FIX A;  4XNH C;  2Z0Z A;  2I00 A;  1BOB A;  5IV0 A;  4ORF A;  4KOW A;  2B3U A;  2J8M A;  1P4N A;  3PGP A;  1I21 A;  3GKR A;  2HV2 A;  2D4O A;  2ARH A;  3I9S A;  2EVN A;  2FSR A;  3ZJ0 A;  4K30 A;  4UBR A;  2OB0 A;  4AVC A;  1M1D A;  2FXF A;  2PR8 A;  1RO5 A;  4XPD C;  1Q2Y A;  3T90 A;  4QB9 A;  2RC4 A;  4KUB A;  1IIC A;  2Q04 A;  2QEC A;  1Z4R A;  1YRE A;  4E0A A;  2O28 A;  3CXS A;  4KLV A;  4OAD A;  3ZZI A;  4R9M A;  2R7H A;  3FB3 A;  4KVM E;  4NF1 A;  2CNS A;  3DR8 A;  4U5Y A;  3CXQ A;  2VZY A;  4KOX A;  3TOB A;  5ISV A;  1R57 A;  2FE7 A;  1SQH A;  3FNC A;  1YVK A;  3D8P A;  2FIA A;  2OH1 A;  4KLW A;  2BSW A;  2BL1 A;  2P6F A;  3DSB A;  3GY9 A;  4RI1 A;  3LD2 A;  1XF8 A;  4KOR A;  2QIR A;  4MHD A;  3KKW A;  2OU2 A;  2DXQ A;  2K5T A;  2B4D B;  2P0W A;  5GCN A;  4NSQ A;  1PU9 A;  4ONU A;  2ZW7 A;  4PSW A;  4E8O A;  1KUX A;  1WK4 A;  2AE6 A;  2ATR A;  3E0K A;  4X5K A;  2JEV A;  5JPH A;  1Z4E A;  1KUY A;  1S7L A;  3BLN A;  3PP9 A;  4H6Z A;  3PZJ A;  1QSR A;  3R9F A;  4XPK A;  1P0H A;  1XEB A;  4FD4 A;  1IB1 E;  2G3A A;  1S7N A;  1IYL A;  4H89 A;  2R98 A;  4CAV A;  2B3V A;  2Z11 A;  3EFA A;  2FS5 A;  3JUW A;  1K4J A;  4R87 A;  1KZF A;  1MK4 A;  1S3Z A;  3S6K A;  4MBU A;  4QBJ A;  2BUE A;  3TCV A;  3F5B A;  2NMT A;  2OZU A;  1B87 A;  3F8K A;  3QAH A;  2Y0M A;  3CXP A;  1QSO A;  2GIV A;  3MGD A;  1N71 A;  3SHP A;  1XE4 A;  2P6G A;  1KUV A;  1M44 A;  1J4J A;  5F47 A;  2FIW A;  2A4N A;  5CNP A;  3TO9 A;  4XNH B;  5KTD A;  5KTA A;  1TIQ A;  4NEX A;  3TFY A;  2REE A;  2P6E A;  4KUA A;  4L89 A;  3UY5 A;  4FD7 A;  2QML A;  2Q7B A;  4IF5 A;  4QUS A;  3WR7 A;  5C88 A;  2WPW A;  1YVO A;  1S60 A;  4E2A A;  1Y7R A;  4XPL A;  3BJ8 A;  4PK2 A;  3D2M A;  2CNT A;  3EO4 A;  4OLL A;  2PSW A;  4JXR A;  2JLM A;  2Q0Y A;  1WWZ A;  4HKF A;  5C82 A;  4KOT A;  4CS0 B;  4HNX B;  1QSM A;  5H86 A;  4RS2 A;  1VHS A;  3FYN A;  4JXQ A;  1RXT A;  3FBU A;  2B4D A;  3TOA A;  2CY2 A;  3VWE A;  4JLY A;  2Q44 A;  1Q2D A;  5IX3 A;  2BEI A;  2Q4V A;  2GAN A;  4MJ8 A;  4OAE A;  3EC4 A;  3S6H A;  3R9G A;  1QSN A;  2VBQ A;  5F46 A;  3TE4 A;  4PV6 A;  4KVX A;  1VKC A;  1YR0 A;  4B5P B;  2HUZ A;  2J8R A;  3EY5 A;  5E96 A;  4B5O A;  2REF A;  3G3S A;  1IID A;  1B6B A;  2OZH A;  4PK3 A;  5F49 A;  4F6A A;  3DR6 A;  4R3K A;  3P2F A;  3EXN A;  4JJX A;  4YFJ A;  4UWJ A;  4MY3 A;  2ZW4 A;  4MY0 A;  4EVY A;  4H6U A;  3T9Y A;  3S6F A;  1MJ9 A;  3QB8 A;  5H84 A;  4MI4 A;  4U9Z A;  4CRZ B;  2VZZ A;  2G0B A;  4AG7 A;  3SXO A;  4YGO A;  2B4B A;  3FRM A;  3R9E A;  2H5M A;  4R3L A;  3LOD A;  4AB7 A;  3RYO A;  4CAW A;  3IGR A;  3D2P A;  1S7K A;  4KOY A;  1NE9 A;  2F5I A;  3OWC A;  4LUA A;  3H4Q A;  3BJ7 A;  2FT0 A;  2JDD A;  1S5K A;  1Q2C A;  5J8C A;  5HH1 A;  4NXY A;  5EBV A;  4Y49 C;  3I3G A;  4CAX A;  2HQY A;  4L8A A;  4I49 A;  2ZXV A;  4R57 A;  5EC4 A;  1MJA A;  2JDC A;  3TO6 A;  4XPD B;  4AG9 A;  5J8F A;  5IB0 A;  2VXK A;  2FCK A;  4LX9 A;  1I1D A;  3TTH A;  2C27 A;  1U6M A;  1NMT A;  1PUA A;  2B5G B;  2Z10 A;  1CJW A;  2FL4 A;  4AVB A;  5F48 A;  3JVN A;  4BMH A;  1M4D A;  1GHE A;  1Y9K A;  4AVA A;  2I79 A;  4F0Y A;  3G8W A;  1OZP A;  2PC1 A;  4JWP A;  4U9Y A;  2CNM A;  1M4I A;  3W91 A;  4B5P A;  2R1I A;  4QC6 A;  2ZW5 A;  1YX0 A;  4KOS A;  3W6S A;  3R1K A;  1CM0 A;  4UWI A;  3S6G A;  1YGH A;  1S7F A;  1IYK A;  3R96 A;  5JQ4 A;  4HNW B;  1Y9W A;  2G3T A;  5KTC A;  4QVT A;  2PDO A;  3N7Z A;  3P2H A;  4IUS A;  1ON0 A;  3NE7 A;  2EUI A;  1FY7 A;  4M85 A;  2D4P A;  4KOV A;  1YK3 A;  1L0C A;  4CRY B;  2VI7 A;  3DDD A;  3V8I A;  2J8N A;  1M4G A;  4DNC A;  1LRZ A;  1MJB A;  3GYA A;  4KOU A;  5DWM A;  3F0A A;  2IL4 A;  2PRB A;  3C26 A;  4II9 A;  3TO7 A;  1BO4 A;  2ZPA A;  3DNS A;  1XMT A;  5DWN A;  2VEZ A;  4FD5 A;  4M3S A;  4PSX A;  4KVO E;  4J3G A;  2ZW6 A;  2PQ8 A;  1XIX A;  4GS4 A;  4FD6 A; 
#chains in the Genus database with same CATH topology
 3SJX A;  3LAC A;  4K3N A;  1NSL A;  4A31 A;  5F09 A;  1UWY A;  3LMS A;  2PVW A;  4KZT A;  2WPX A;  2OZG A;  1V0C A;  1Z9U A;  4MXU A;  4B6Z A;  3D3S A;  3VWD A;  1BLL E;  3CDX A;  3IIB A;  1X12 A;  5FVJ A;  1VIX A;  2KCW A;  2X7B A;  1UFH A;  3K9T A;  4NGT A;  4UFW A;  1I12 A;  3K9U A;  4UA3 A;  2V77 A;  1KWM A;  1XFO A;  4JD6 A;  4YRH A;  4G1P A;  3IWG A;  4OKO A;  2AJ6 A;  3SXN A;  3KQX A;  5K8M A;  3W6X A;  1YW6 A;  1QST A;  4PQA A;  1Y7E A;  7CPA A;  5HVH A;  1YLO A;  4YWY A;  3RZA A;  4Y49 B;  3S9L A;  1IOI A;  2Q4Y A;  1BPN A;  2ZEF A;  2PR1 A;  2ZEG A;  2V8H A;  5AGE A;  1CX8 A;  3V7Z A;  2B58 A;  4TWE A;  4NGR A;  3R95 A;  3TT2 A;  2Z3N A;  2PJ9 A;  4C2Z A;  2VQY A;  4HNY B;  4FAI A;  4ZBG A;  3ISX A;  1CG2 A;  4ZY2 A;  3RBU A;  2V8D A;  1M4L A;  5HMN A;  2DEA A;  3B8G A;  3FXT A;  1AYE A;  2R8V A;  2JBJ A;  4NCZ A;  2GE3 A;  1LAP A;  3KI9 A;  4P6Y A;  2B5G A;  5I0C A;  3BI0 A;  4UIA A;  1YLE A;  2DPS A;  3FIX A;  2OR4 A;  4XNH C;  2JEW A;  1F2O A;  2Z0Z A;  2I00 A;  4ZYQ A;  1BOB A;  5IV0 A;  4ORF A;  4B12 A;  3SI2 A;  4KOW A;  2B3U A;  2J8M A;  4X3R A;  1P4N A;  1CPS A;  2C6C A;  1I21 A;  3PGP A;  4OIW A;  3GKR A;  2HV2 A;  2AFU A;  2ARH A;  2D4O A;  1LAM A;  2PJ7 A;  4O23 A;  2DPT A;  3I9S A;  2EVN A;  2FSR A;  2O53 A;  3KR5 A;  3ZJ0 A;  1ZLH A;  2F7V A;  3FMC A;  2OB0 A;  2YNC C;  1M1D A;  4K30 A;  2GLF A;  4UBR A;  4A94 A;  2FXF A;  5AG6 A;  4OC0 A;  3L2N A;  2PR8 A;  1RO5 A;  4XPD C;  1Q2Y A;  3T90 A;  4QB9 A;  2Z3K A;  2RC4 A;  4KUB A;  1IIC A;  2Q04 A;  2ZEL A;  2QEC A;  1Z4R A;  4GM5 A;  1FNO A;  4UEZ A;  1YRE A;  4E0A A;  2O28 A;  3CXS A;  4KLV A;  4OAD A;  1OBR A;  3QAY A;  4NGS A;  1QMU A;  3NH5 A;  3ZZI A;  5CBM A;  4R9M A;  4MFK A;  2CXA A;  2R7H A;  4PXC A;  4ZX9 A;  5JM6 A;  3IJ3 A;  2PRQ A;  5THW A;  3FB3 A;  4KVM E;  4NF1 A;  2VL1 A;  3KR4 A;  1ARL A;  4UFV A;  2CNS A;  3NH8 A;  5JH9 A;  3DR8 A;  4U5Y A;  3CXQ A;  2VZY A;  3D66 A;  3SI0 A;  4KOX A;  4M6G A;  2AFM A;  3TOB A;  1ZG8 A;  2C1C A;  2Z3L A;  5ISV A;  1Z8X A;  2FVG A;  2RFH A;  1R57 A;  1TXR A;  2FE7 A;  4Q36 A;  1SQH A;  4A33 A;  3FNC A;  1YVK A;  1ZLI A;  3VAR A;  3D8P A;  2FIA A;  2OH1 A;  1Q7L A;  2ZEN A;  4KLW A;  2BSW A;  2BL1 A;  2P6F A;  3DSB A;  3GY9 A;  4PXD A;  4RI1 A;  5LYI A;  5A28 A;  2HB6 A;  2IJZ A;  3LD2 A;  1XF8 A;  4KOR A;  2QIR A;  4MHD A;  3KKW A;  4ZY0 A;  2OU2 A;  2DXQ A;  4R8F A;  2K5T A;  2B4D B;  2G9D A;  3RNZ A;  2P0W A;  2WZN A;  3FVL A;  5GCN A;  2EWB A;  4B10 A;  2YNE A;  4NSQ A;  1PU9 A;  1TKF A;  2ZW7 A;  4ONU A;  4DUK A;  4PSW A;  3MN8 A;  5LRJ A;  1KUX A;  1XJO A;  4E8O A;  1WK4 A;  4CGL A;  2BCO A;  2EK8 A;  2AE6 A;  2ATR A;  4MCP A;  5AG4 A;  4P4I A;  3E0K A;  1Z8T A;  3SI1 A;  4ZX8 A;  2Q43 A;  4X5K A;  2JEV A;  5JPH A;  1Z4E A;  4P4B A;  2CTC A;  5DS0 A;  5HVG A;  3LWU A;  2EO8 A;  4OID A;  1KUY A;  4LQ6 A;  3TC8 A;  2Q4Z A;  4KS9 A;  1S7L A;  3BLN A;  3PP9 A;  4H6Z A;  3PZJ A;  1QSR A;  2ZED A;  4OP4 A;  3R9F A;  3GLJ A;  4WWV A;  4XPK A;  1P0H A;  1R43 A;  3D7F A;  1XEB A;  3D7D A;  4CAE A;  5HXD A;  4FD4 A;  2RB7 A;  1IB1 E;  2G3A A;  1S7N A;  4OC2 A;  5G1Z A;  1IYL A;  5IB9 A;  2V8G A;  4H89 A;  2R98 A;  2AFO A;  4CAV A;  3SJE A;  2GLJ A;  2B3V A;  2WSA A;  2Z11 A;  3PB8 X;  3EFA A;  2FS5 A;  1LCP A;  1XBU A;  2Z3O A;  3BHX A;  1K4J A;  2PJ5 A;  3JUW A;  4IK2 A;  3VH9 A;  4R87 A;  1PYT B;  1KZF A;  3KL9 A;  3VAT A;  1MK4 A;  1Z5R A;  1S3Z A;  3S6K A;  4MBU A;  4QBJ A;  3CPA A;  2BUE A;  4CGO A;  2C6P A;  3HLP A;  4F0X A;  4CYN A;  2Q51 A;  4CGN A;  3TCV A;  3F5B A;  1GYT A;  2NMT A;  4CYP A;  2OZU A;  2ANP A;  1A2Z A;  1B87 A;  2AFW A;  3F8K A;  3JRU A;  3QAH A;  4HPS A;  2Y0M A;  4CGM A;  2PCU A;  3CXP A;  1QSO A;  2GIV A;  2V8V A;  3MGD A;  4LQG A;  1N71 A;  4UFX A;  2ODF A;  3SHP A;  1XE4 A;  2P6G A;  2PJ1 A;  3H8E A;  1KUV A;  1CP6 A;  1M44 A;  1VHO A;  3QNV A;  1J4J A;  4EWT A;  5F47 A;  2FIW A;  2A4N A;  5CNP A;  3TO9 A;  4H2K A;  1TF9 A;  2GU2 A;  2ZOF A;  4OC1 A;  4XNH B;  4AXV A;  5KTD A;  2PJ6 A;  1IGB A;  5KTA A;  1Z2L A;  1TIQ A;  3IC1 A;  1AMP A;  4NEX A;  3TFY A;  2REE A;  1JWQ A;  2P6E A;  3PFO A;  4AVC A;  4MCR A;  1HDU A;  4KUA A;  1X10 A;  4L89 A;  4R6T A;  3UY5 A;  4BBH A;  4DYO A;  4FD7 A;  2QML A;  2Q7B A;  4NJR A;  2CTB A;  4IF5 A;  2BO9 A;  4EME A;  4QUS A;  3WR7 A;  5C88 A;  2WPW A;  3B3V A;  3GB0 A;  1YVO A;  1S60 A;  3KZW A;  2I3C A;  1Y7R A;  4P44 A;  4CPA A;  4WJB A;  1BAV A;  4E2A A;  3B3S A;  3KAS A;  1ELM P;  2AFX A;  4XPL A;  3PB6 X;  1XOV A;  1Z8W A;  2NSM A;  3D4U A;  2XEG A;  4Z65 A;  4MMO A;  3BJ8 A;  2GFQ A;  4PK2 A;  1EE3 P;  3D2M A;  2XEI A;  4MFJ A;  4OME A;  5I4M A;  2CNT A;  5JGF A;  5K8O A;  3EO4 A;  4YU9 A;  2Z3M A;  4OLL A;  4P4D A;  3IO1 A;  5HVF A;  2PSW A;  3N5F A;  5BWA B;  2ZEP A;  4JXR A;  2JLM A;  2Q0Y A;  2XEJ A;  1WWZ A;  4HKF A;  4F9U A;  2PJ4 A;  5C82 A;  2PJC A;  3FF3 A;  2IMO A;  4NGM A;  4KOT A;  4CS0 B;  4HNX B;  2PJ2 A;  1QSM A;  2C6G A;  5G21 A;  5H86 A;  4RS2 A;  2OOT A;  1TKJ A;  4FBE A;  3WC5 A;  3IU1 A;  4A38 A;  1VHS A;  4P10 A;  3FYN A;  4A39 A;  4JXQ A;  4P4E A;  3PBE A;  1Y0Y A;  3HUV A;  1IU8 A;  3IFE A;  4B11 A;  1RXT A;  1XMB A;  4JZ0 A;  2QVP A;  3FBU A;  2B4D A;  3TOA A;  2CY2 A;  3VWE A;  4JLY A;  2Q44 A;  1Q2D A;  2WYR A;  1H8L A;  5IX3 A;  1YW4 A;  2BEI A;  2Q4V A;  2GAN A;  4MJ8 A;  4M6H A;  4OAE A;  3EC4 A;  2EBJ A;  3A9L A;  3S6H A;  3R9G A;  1DE4 C;  5LRG A;  1QSN A;  1CPX A;  2CF4 A;  2VBQ A;  5F46 A;  3TE4 A;  3CZX A;  2BOA A;  3B2Y A;  3NE8 A;  4PV6 A;  4UCN A;  4C2X A;  3S9N A;  4KVX A;  4P4J A;  1VKC A;  1YR0 A;  1VHE A;  4UCM A;  4B5P B;  4EFD A;  2PJ8 A;  2HUZ A;  1CP7 A;  2HC9 A;  2J8R A;  3EY5 A;  5E96 A;  4A2Z A;  3BXM A;  4B5O A;  4CAF A;  1HEE A;  2REF A;  3FX6 A;  3G3S A;  4MFZ A;  1CBX A;  4MHP A;  1IID A;  1IOF A;  1B6B A;  2OZH A;  4PK3 A;  5F49 A;  4F6A A;  2POK A;  1Z8L A;  3DR6 A;  4R3K A;  4UEF A;  4MFQ A;  3P2F A;  3EXN A;  4JJX A;  4R76 A;  4YFJ A;  3PEI A;  4UWJ A;  4MY3 A;  4Q7A A;  1QQ9 A;  4ZY1 A;  2ZW4 A;  2PJ0 A;  3IWE A;  4MFP A;  5K8N A;  4MY0 A;  4PPZ A;  3IEH A;  2ZEH A;  4P4F A;  2WUU A;  2YND A;  1BPM A;  4EVY A;  4H6U A;  3T9Y A;  1ZG7 A;  4MHN A;  3S6F A;  3WAB A;  1MJ9 A;  3GIU A;  1LOK A;  3QB8 A;  2PIZ A;  2QJ8 A;  4NGQ A;  4F9V A;  3PB7 X;  4RN7 A;  3FJU A;  5H84 A;  2J9A A;  2PE3 A;  3B3W A;  4MI4 A;  1ELL P;  3MRU A;  4U9Z A;  4CRZ B;  3D7G A;  1ZO0 A;  2GRE A;  2VZZ A;  2G0B A;  4AG7 A;  4CYO A;  3PFE A;  3SXO A;  4NGP A;  4YGO A;  1JQG A;  4ZGY B;  2B4B A;  3KQZ A;  4A95 A;  3FRM A;  3R9E A;  2JBK A;  3WT4 A;  2H5M A;  4IHM A;  4R3L A;  3LOD A;  4AB7 A;  3RYO A;  4CAW A;  5LRK A;  3IGR A;  3D2P A;  2ZEE A;  2PJA A;  4FUU A;  3SJF A;  3CT9 A;  1YSJ A;  3TX8 A;  4X8I A;  1S7K A;  8CPA A;  4KOY A;  4KSF A;  1Y0R A;  1F2P A;  1NE9 A;  2F5I A;  3OWC A;  3CPX A;  4LUA A;  1YQE A;  3H4Q A;  2YNC A;  2YGW A;  2PIY A;  3BJ7 A;  2FT0 A;  2JDD A;  1S5K A;  1Q2C A;  5J8C A;  1F57 A;  3DGV A;  5HH1 A;  5A27 A;  4NXY A;  3B3T A;  3H5Z A;  4MCQ A;  5EBV A;  5G20 A;  3D68 A;  4Y49 C;  4NGN A;  6CPA A;  3I3G A;  4CAX A;  2F8H A;  2HQY A;  4L8A A;  2ZEO A;  4I49 A;  2ZXV A;  3PB4 X;  4R57 A;  4ZI6 A;  5EC4 A;  1MJA A;  4FWU A;  4A37 A;  2JDC A;  4PXE A;  3TO6 A;  3FEE A;  4XPD B;  4KSI A;  3B35 A;  1DTD A;  2PJ3 A;  4IAV A;  4AG9 A;  5J8F A;  3NA6 A;  5IB0 A;  2PJB A;  4MHZ A;  4P45 A;  5D29 A;  3SJG A;  4A32 A;  4MRI A;  3GUX A;  3RO0 A;  2VXK A;  5EMI A;  2FCK A;  1IY7 A;  1XRY A;  4MHY A;  4UIB A;  4LX9 A;  1I1D A;  3TTH A;  2C27 A;  1U6M A;  4NJQ A;  1NMT A;  1PUA A;  1R3N A;  2B5G B;  3FEC A;  2ZOG A;  2Z10 A;  1VGY A;  1CJW A;  2FL4 A;  4F8Z A;  4AVB A;  1AUG A;  1ZG9 A;  2PVV A;  5F48 A;  3JVN A;  2ABZ A;  4BMH A;  5CPA A;  2DF5 A;  1M4D A;  4C2Y A;  5LYL A;  2Z3P A;  1ARM A;  2XEF A;  4OC5 A;  4JYW A;  1GHE A;  4PXB A;  4UF4 A;  1Y9K A;  3KGQ A;  4W9Y A;  4A30 A;  3FH4 A;  1FT7 A;  5D8N A;  2I79 A;  4AVA A;  4B13 A;  4F0Y A;  4RUH A;  2AFZ A;  3FED A;  5LYF A;  3G8W A;  5J1Q A;  1OZP A;  2PC1 A;  4JWP A;  2O4H A;  4MCS A;  4U9Y A;  3T8W A;  3H8G A;  3H8F A;  2CNM A;  1M4I A;  3W91 A;  4BIN A;  4B5P A;  2R1I A;  3KHZ A;  5AG5 A;  4QC6 A;  2ZW5 A;  1YX0 A;  4KOS A;  5LYD A;  3W6S A;  3KHX A;  3R1K A;  1CM0 A;  3NFZ A;  4UWI A;  3S6G A;  1YGH A;  1S7F A;  1IYK A;  3PBB A;  3R96 A;  5JQ4 A;  4HNW B;  1Y9W A;  2G3T A;  3IWW A;  2CIJ A;  4UCP A;  3PB9 X;  4BD9 A;  5KTC A;  4QVT A;  4R7M A;  3V38 A;  3WC7 A;  3RAM A;  2PDO A;  3JTK A;  4OC4 A;  3N7Z A;  3P2H A;  4IUS A;  3B3C A;  2AFS A;  4TNU A;  4B14 A;  4GXH A;  1ON0 A;  3IU2 A;  3NE7 A;  2EUI A;  2QYV A;  1RTQ A;  3K2K A;  1FY7 A;  1TF8 A;  4M85 A;  2D4P A;  3I1U A;  4KOV A;  4KSA A;  1YK3 A;  1L0C A;  4CRY B;  3D67 A;  3DLJ A;  1YME A;  2ZEM A;  2VI7 A;  3DDD A;  4C7H A;  3BI1 A;  4C7I A;  4C68 A;  2Q7S A;  3V8I A;  2IQ6 A;  2J8N A;  4CYQ A;  3NH4 A;  5AG7 A;  4DJL A;  2NYQ A;  1M4G A;  3WC6 A;  4DNC A;  1LRZ A;  1MJB A;  4MFL A;  1HDQ A;  3GYA A;  4KOU A;  5DWM A;  1LFW A;  4X2T A;  3F0A A;  4M6I A;  2IL4 A;  3S9M A;  2PRB A;  4CGP A;  1TKH A;  3ISZ A;  3B7I A;  3C26 A;  4II9 A;  4ONW A;  4UEE A;  3TO7 A;  1BO4 A;  2ZPA A;  5K8P A;  1LAN A;  3DNS A;  4Q38 A;  1XMT A;  5G22 A;  5DWN A;  2VEZ A;  4FD5 A;  1NSA A;  4OC3 A;  4M3S A;  4PSX A;  3PRT A;  4KVO E;  5ELY A;  4J3G A;  2ZW6 A;  2PQ8 A;  4NFR A;  1PCA A;  1XIX A;  4GS4 A;  2EK9 A;  4FD6 A;  3D7H A; 
#chains in the Genus database with same CATH homology
 1NSL A;  4A31 A;  4KZT A;  2WPX A;  2OZG A;  1V0C A;  1Z9U A;  3D3S A;  3VWD A;  5FVJ A;  2KCW A;  2X7B A;  1UFH A;  4UFW A;  1I12 A;  3K9U A;  4UA3 A;  4JD6 A;  4YRH A;  3IWG A;  2AJ6 A;  3SXN A;  3W6X A;  1QST A;  4Y49 B;  2Q4Y A;  2PR1 A;  5AGE A;  2B58 A;  3R95 A;  3TT2 A;  2Z3N A;  4C2Z A;  2VQY A;  4HNY B;  4ZBG A;  5HMN A;  3B8G A;  3FXT A;  2R8V A;  4NCZ A;  2GE3 A;  2B5G A;  5I0C A;  1YLE A;  2DPS A;  3FIX A;  4XNH C;  2Z0Z A;  2I00 A;  1BOB A;  5IV0 A;  4ORF A;  4B12 A;  4KOW A;  2B3U A;  2J8M A;  1P4N A;  3PGP A;  1I21 A;  3GKR A;  2HV2 A;  2D4O A;  2ARH A;  2DPT A;  3I9S A;  2EVN A;  2FSR A;  3ZJ0 A;  4K30 A;  4UBR A;  2OB0 A;  2YNC C;  1M1D A;  4AVC A;  2FXF A;  5AG6 A;  2PR8 A;  1RO5 A;  4XPD C;  1Q2Y A;  3T90 A;  4QB9 A;  2Z3K A;  2RC4 A;  4KUB A;  1IIC A;  2Q04 A;  2QEC A;  1Z4R A;  1YRE A;  4E0A A;  2O28 A;  3CXS A;  4KLV A;  4OAD A;  3ZZI A;  4R9M A;  4MFK A;  2CXA A;  2R7H A;  3FB3 A;  4KVM E;  4NF1 A;  4UFV A;  2CNS A;  3DR8 A;  4U5Y A;  3CXQ A;  2VZY A;  4KOX A;  3TOB A;  2Z3L A;  5ISV A;  4Q36 A;  1R57 A;  2FE7 A;  4A33 A;  1SQH A;  3FNC A;  1YVK A;  3D8P A;  2FIA A;  2OH1 A;  4KLW A;  2BSW A;  3GY9 A;  3DSB A;  2BL1 A;  2P6F A;  4RI1 A;  5A28 A;  3LD2 A;  1XF8 A;  4KOR A;  2QIR A;  4MHD A;  3KKW A;  2OU2 A;  2DXQ A;  2K5T A;  2B4D B;  2P0W A;  5GCN A;  4B10 A;  2YNE A;  4NSQ A;  1PU9 A;  4ONU A;  2ZW7 A;  4PSW A;  4E8O A;  1KUX A;  1WK4 A;  2AE6 A;  2ATR A;  5AG4 A;  3E0K A;  4X5K A;  2JEV A;  5JPH A;  1Z4E A;  1KUY A;  4KS9 A;  1S7L A;  3BLN A;  3PP9 A;  4H6Z A;  3PZJ A;  1QSR A;  3R9F A;  4CGL A;  4XPK A;  4CAE A;  1P0H A;  1XEB A;  4FD4 A;  1IB1 E;  2G3A A;  1S7N A;  5G1Z A;  1IYL A;  4H89 A;  2R98 A;  4CAV A;  2B3V A;  2WSA A;  2Z11 A;  3EFA A;  2FS5 A;  2Z3O A;  3JUW A;  1K4J A;  4R87 A;  1KZF A;  1MK4 A;  1S3Z A;  3S6K A;  4MBU A;  4QBJ A;  2BUE A;  4CGO A;  4F0X A;  4CYN A;  4CGN A;  3TCV A;  3F5B A;  2NMT A;  4CYP A;  2OZU A;  1B87 A;  3F8K A;  3QAH A;  2Y0M A;  4CGM A;  3CXP A;  1QSO A;  2GIV A;  3MGD A;  4UFX A;  1N71 A;  3SHP A;  1XE4 A;  2P6G A;  1KUV A;  1M44 A;  1J4J A;  5F47 A;  2FIW A;  2A4N A;  5CNP A;  3TO9 A;  4XNH B;  5KTD A;  5KTA A;  1TIQ A;  4NEX A;  3TFY A;  2REE A;  2P6E A;  4KUA A;  4L89 A;  4BBH A;  3UY5 A;  4FD7 A;  2QML A;  2Q7B A;  4IF5 A;  4QUS A;  3WR7 A;  5C88 A;  2WPW A;  1YVO A;  1S60 A;  4E2A A;  1Y7R A;  4XPL A;  3BJ8 A;  4PK2 A;  3D2M A;  4MFJ A;  2CNT A;  3EO4 A;  2Z3M A;  4OLL A;  2PSW A;  5BWA B;  4JXR A;  2JLM A;  2Q0Y A;  1WWZ A;  4HKF A;  5C82 A;  4KOT A;  4CS0 B;  4HNX B;  1QSM A;  5G21 A;  5H86 A;  4RS2 A;  3IU1 A;  1VHS A;  3FYN A;  4JXQ A;  4B11 A;  1RXT A;  3FBU A;  2B4D A;  3TOA A;  2CY2 A;  3VWE A;  4JLY A;  2Q44 A;  1Q2D A;  5IX3 A;  2BEI A;  2Q4V A;  2GAN A;  4MJ8 A;  4OAE A;  3EC4 A;  3A9L A;  3S6H A;  3R9G A;  1QSN A;  2VBQ A;  5F46 A;  3TE4 A;  4PV6 A;  4UCN A;  4C2X A;  4KVX A;  1VKC A;  1YR0 A;  4B5P B;  4UCM A;  2HUZ A;  2J8R A;  3EY5 A;  5E96 A;  4A2Z A;  4B5O A;  4CAF A;  2REF A;  3G3S A;  4MFZ A;  1IID A;  1B6B A;  2OZH A;  4PK3 A;  5F49 A;  4F6A A;  3DR6 A;  4R3K A;  4MFQ A;  3P2F A;  3EXN A;  4JJX A;  4YFJ A;  4UWJ A;  4MY3 A;  2ZW4 A;  3IWE A;  4MFP A;  4MY0 A;  2WUU A;  2YND A;  4EVY A;  4H6U A;  3T9Y A;  3S6F A;  1MJ9 A;  3QB8 A;  5H84 A;  4MI4 A;  4U9Z A;  4CRZ B;  1ZO0 A;  2VZZ A;  2G0B A;  4AG7 A;  4CYO A;  3SXO A;  4YGO A;  4ZGY B;  2B4B A;  4A95 A;  3FRM A;  3R9E A;  2H5M A;  4R3L A;  3LOD A;  4AB7 A;  3RYO A;  4CAW A;  3IGR A;  3D2P A;  1S7K A;  4KOY A;  4KSF A;  1NE9 A;  2F5I A;  3OWC A;  4LUA A;  3H4Q A;  2YNC A;  2YGW A;  3BJ7 A;  2FT0 A;  2JDD A;  1S5K A;  1Q2C A;  5J8C A;  5HH1 A;  5A27 A;  4NXY A;  3H5Z A;  5EBV A;  5G20 A;  4Y49 C;  3I3G A;  4CAX A;  2HQY A;  4L8A A;  4I49 A;  2ZXV A;  4R57 A;  5EC4 A;  1MJA A;  2JDC A;  3TO6 A;  4XPD B;  4AG9 A;  5J8F A;  5IB0 A;  4A32 A;  2VXK A;  2FCK A;  4LX9 A;  1I1D A;  3TTH A;  2C27 A;  1U6M A;  1NMT A;  1PUA A;  2B5G B;  2Z10 A;  1CJW A;  2FL4 A;  4AVB A;  5F48 A;  3JVN A;  4BMH A;  4C2Y A;  1M4D A;  2Z3P A;  1GHE A;  4A30 A;  1Y9K A;  4B13 A;  4AVA A;  2I79 A;  4F0Y A;  3G8W A;  1OZP A;  2PC1 A;  4JWP A;  4U9Y A;  2CNM A;  1M4I A;  3W91 A;  4B5P A;  2R1I A;  5AG5 A;  4QC6 A;  2ZW5 A;  1YX0 A;  4KOS A;  3W6S A;  3R1K A;  1CM0 A;  4UWI A;  3S6G A;  1YGH A;  1S7F A;  1IYK A;  3R96 A;  5JQ4 A;  4HNW B;  1Y9W A;  2G3T A;  4UCP A;  5KTC A;  4QVT A;  2PDO A;  3JTK A;  3N7Z A;  3P2H A;  4IUS A;  4B14 A;  1ON0 A;  3IU2 A;  3NE7 A;  2EUI A;  1FY7 A;  4M85 A;  2D4P A;  4KOV A;  4KSA A;  1YK3 A;  1L0C A;  4CRY B;  2VI7 A;  3DDD A;  4C7H A;  4C7I A;  4C68 A;  4CYQ A;  3V8I A;  2J8N A;  5AG7 A;  1M4G A;  4DNC A;  1LRZ A;  1MJB A;  4MFL A;  3GYA A;  4KOU A;  5DWM A;  3F0A A;  2IL4 A;  2PRB A;  4CGP A;  3C26 A;  4II9 A;  3TO7 A;  1BO4 A;  2ZPA A;  4Q38 A;  3DNS A;  1XMT A;  5G22 A;  5DWN A;  2VEZ A;  4FD5 A;  4M3S A;  4PSX A;  4KVO E;  4J3G A;  2ZW6 A;  2PQ8 A;  1XIX A;  4GS4 A;  4FD6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...