4NCZA

Spermidine n-acetyltransferase from vibrio cholerae in complex with 2-[n-cyclohexylamino]ethane sulfonate.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
170
structure length
170
Chain Sequence
NSQLTLRALERGDLRFIHNLNNNRNIMSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYILQSKYLNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermidine n1-acetyltransferase
publication title A Novel Polyamine Allosteric Site of SpeG from Vibrio cholerae Is Revealed by Its Dodecameric Structure.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Transferase
total genus 50
structure length 170
sequence length 170
chains with identical sequence B, C
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2013-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4nczA00
4OADA 3TE4A 2ZW7A 2B4BA 5F48A 1YK3A 2WPWA 1IIDA 1NMTA 3DR8A 1XE4A 3I9SA 2I00A 3H4QA 1I21A 4CRZB 2J8RA 3UY5A 1Q2CA 4QBJA 2F5IA 4IUSA 2FL4A 4E0AA 4FD5A 2CNTA 4YFJA 3V8IA 4KUAA 3ZJ0A 4CAXA 4XPKA 2J8MA 3E0KA 2A4NA 4KLVA 4H89A 1YVKA 2IL4A 5GCNA 4AG9A 2B4DB 4U5YA 2R1IA 4CAWA 4I49A 2EVNA 1P4NA 3W6SA 3ZZIA 1S7NA 4HNXB 1XIXA 1R57A 5F47A 4K30A 3S6HA 2R98A 2FSRA 1Z4RA 4R87A 1S5KA 5E96A 1NSLA 4UBRA 3R9GA 3S6GA 1MJBA 4MY3A 2VXKA 1I12A 1QSTA 2PSWA 2C27A 1Q2DA 4MHDA 4PV6A 4HNYB 3EO4A 4L8AA 4J3GA 2WPXA 2PR1A 3QB8A 2OZUA 1IICA 2Z0ZA 3MGDA 1M4IA 4AB7A 4JXRA 1TIQA 3EC4A 2VZZA 4DNCA 4KLWA 1Y9WA 4KOYA 4LUAA 2BUEA 2DXQA 3DNSA 2G3AA 5FVJA 1XMTA 2OH1A 3BLNA 1YVOA 1M4DA 4II9A 3R95A 1ON0A 3TOBA 5EC4A 3G3SA 2ZPAA 4X5KA 2R7HA 2AJ6A 3GYAA 4AVBA 3VWEA 4AVCA 3IWGA 2AE6A 4RI1A 1RO5A 5IV0A 4B5PA 3QAHA 3W91A 2OB0A 2FS5A 4ORFA 1S7FA 2Y0MA 4PK3A 5C88A 2BL1A 3F5BA 4R3LA 1IB1E 1N71A 2VBQA 2EUIA 4KOUA 2CNSA 2PRBA 3FNCA 1CM0A 1BOBA 1XEBA 2G3TA 3PP9A 2HUZA 3FRMA 2P6FA 3EXNA 3JUWA 5KTAA 2NMTA 2B4DA 5H84A 3FXTA 4UWIA 3R1KA 3TTHA 4KOXA 1IYKA 2OZGA 5EBVA 3LODA 2BSWA 5C82A 5I0CA 3DSBA 2ZXVA 1MK4A 4EVYA 4KOSA 4AG7A 2PQ8A 5DWNA 3R9FA 3LD2A 2D4OA 2FE7A 4KORA 4R3KA 2Q4YA 4KOWA 3EFAA 2QMLA 4MI4A 2J8NA 1Y9KA 4H6ZA 4PSXA 2PC1A 2HQYA 3R9EA 1RXTA 5IX3A 1WK4A 4CAVA 3OWCA 4YGOA 2ZW5A 4KOVA 1QSOA 4NXYA 3SXOA 1IYLA 4LX9A 1M44A 2Q04A 1YREA 1VHSA 1B87A 2I79A 2B3UA 1KUXA 1K4JA 1PU9A 3CXQA 3D2PA 2ZW4A 4PSWA 1MJ9A 3JVNA 2B3VA 4E8OA 4M3SA 1MJAA 2HV2A 3CXSA 4KZTA 4F6AA 3TOAA 2GIVA 4JWPA 2VI7A 1Z9UA 1V0CA 1PUAA 1L0CA 4JLYA 3DDDA 3KKWA 2ARHA 4JJXA 1YLEA 5F49A 4KVXA 5ISVA 4YRHA 3TO7A 1SQHA 1YR0A 4ONUA 4U9YA 3T9YA 2JDDA 4FD6A 2GANA 3N7ZA 3GKRA 3B8GA 4QC6A 3WR7A 3RYOA 2B58A 1BO4A 2P6EA 5DWMA 2JDCA 3IGRA 1M1DA 4R9MA 4MY0A 3TFYA 4XNHC 4UWJA 1Z4EA 4XNHB 4PK2A 4MJ8A 2Q4VA 1P0HA 2REEA 3S6KA 4OLLA 1WWZA 2O28A 4HKFA 5HMNA 2Q0YA 3FIXA 2VZYA 3P2HA 4M85A 3DR6A 2REFA 3G8WA 5F46A 3VWDA 4NSQA 4NCZA 3TT2A 3GY9A 1S3ZA 4JXQA 4H6UA 4QVTA 4U9ZA 3TCVA 1LRZA 2CNMA 1KZFA 2R8VA 2H5MA 1CJWA 2Z10A 3PZJA 2B5GB 2CY2A 2X7BA 5HH1A 1Y7RA 4IF5A 5CNPA 4QB9A 4CRYB 4CS0B 4XPDC 2FXFA 3K9UA 5IB0A 2GE3A 2RC4A 2P0WA 2VEZA 2QECA 5J8CA 3BJ7A 4XPDB 3S6FA 4B5PB 4QUSA 4UA3A 3D3SA 1UFHA 3F8KA 2KCWA 2JLMA 3T90A 1S7LA 3D2MA 4NEXA 2QIRA 1FY7A 1OZPA 2ZW6A 4HNWB 4ZBGA 4F0YA 3R96A 5JPHA 1VKCA 3SXNA 5JQ4A 1S60A 1KUYA 3BJ8A 4FD4A 1NE9A 2Z11A 1J4JA 3TO6A 2FT0A 2G0BA 5KTCA 4R57A 4L89A 4Y49C 3C26A 4XPLA 4Y49B 4JD6A 2ATRA 2PDOA 4KUBA 3D8PA 1QSRA 2VQYA 2FIAA 2Q7BA 5KTDA 1Q2YA 3FB3A 2D4PA 4KVME 4OAEA 1GHEA 3FYNA 4NF1A 1YX0A 1YGHA 2Q44A 2PR8A 2OU2A 4KVOE 4E2AA 1QSMA 3I3GA 3NE7A 1U6MA 2JEVA 3TO9A 4KOTA 2FCKA 1S7KA 3EY5A 3FBUA 2BEIA 4MBUA 5H86A 3CXPA 4GS4A 4B5OA 4BMHA 3F0AA 2B5GA 2FIWA 1B6BA 4AVAA 4RS2A 1KUVA 4FD7A 3SHPA 1XF8A 2P6GA 3PGPA 3P2FA 3W6XA 2OZHA 1M4GA 2K5TA 1QSNA 5J8FA 1I1DA
chains in the Genus database with same CATH superfamily
3FH4A 2ZELA 4OADA 3TE4A 2ZW7A 2B4BA 4CYOA 3CZXA 3IJ3A 5F48A 1KWMA 1YK3A 2WPWA 1IIDA 4X3RA 1NMTA 4P4EA 3DR8A 4KSAA 1XE4A 3I9SA 2I00A 4F8ZA 5HVHA 3H4QA 1I21A 4CRZB 2J8RA 3IWWA 4R6TA 1TXRA 3KZWA 5G20A 3ISZA 3UY5A 1Q2CA 3RNZA 3CPAA 2F5IA 4IUSA 3FEDA 4QBJA 1M4LA 2FL4A 4ZGYB 4OIDA 3RAMA 4E0AA 4FD5A 4P10A 3JTKA 2CNTA 4YFJA 5HXDA 2GREA 2PVVA 3V8IA 4Q7AA 4KUAA 3ZJ0A 4CAXA 4XPKA 4RUHA 2CTCA 2J8MA 3E0KA 2A4NA 3NH5A 1F57A 3KI9A 4KLVA 2XEGA 4H89A 1CG2A 2XEJA 4Z65A 1YVKA 4C2ZA 2IL4A 1CPXA 5GCNA 4AG9A 1BPNA 4RN7A 3KHZA 2B4DB 2Z3OA 4U5YA 2R1IA 4CAWA 4I49A 4R8FA 2EVNA 1P4NA 2ZEHA 4LQ6A 3TX8A 2ODFA 3W6SA 3ZZIA 1S7NA 1VIXA 4HNXB 1XIXA 1R57A 2J9AA 2V8DA 5F47A 4K30A 3S6HA 2DF5A 4M6IA 2R98A 2FSRA 1Z4RA 4CAEA 1FT7A 4R87A 1F2OA 1S5KA 5E96A 3V7ZA 4JYWA 4MCPA 5LRKA 4A94A 1NSLA 5LRGA 4P45A 1FNOA 4UBRA 3R9GA 3RZAA 3S6GA 4A31A 1MJBA 3KL9A 4X8IA 4MY3A 2VXKA 1I12A 1QSTA 3D66A 1IY7A 2PSWA 2XEFA 1XBUA 1BAVA 5A28A 2RFHA 2C27A 1GYTA 1Q2DA 4MHDA 4PV6A 4HNYB 3EO4A 3LACA 4L8AA 3PFOA 4J3GA 2WPXA 5D8NA 1TKFA 1PYTB 2PR1A 4NGPA 3QB8A 1HDUA 2V8VA 4EFDA 2OZUA 1IICA 2GLFA 3D7DA 3QNVA 4NGSA 2Z0ZA 1LAPA 3DGVA 3MGDA 4PXBA 1M4IA 4MFPA 4AB7A 1Z8LA 4JXRA 1TIQA 3EC4A 6CPAA 8CPAA 2JBJA 2VZZA 4DNCA 4KLWA 5DS0A 1Y9WA 4KOYA 4KS9A 4LUAA 2BUEA 3LMSA 1Z8XA 2DXQA 3DNSA 2C1CA 4UFVA 4CYNA 2G3AA 5FVJA 3H5ZA 4MFKA 1ZO0A 2Q4ZA 2Z3PA 1XMTA 2OH1A 3BLNA 1YVOA 1ZG9A 1M4DA 1CX8A 5K8NA 3R95A 4II9A 1ON0A 1LOKA 3TOBA 4HPSA 5EC4A 3VH9A 5LYFA 2AFUA 2IQ6A 2Z3NA 3G3SA 2YNCA 2ZPAA 1ELLP 4X5KA 2R7HA 1ZLHA 3LWUA 4EMEA 2AJ6A 3H8EA 3GYAA 4AVBA 2HC9A 3B7IA 2BCOA 3VWEA 4AVCA 4B10A 3IWGA 2AE6A 4UCPA 4RI1A 1RO5A 5IV0A 4C68A 4B5PA 4A95A 5JGFA 3QAHA 3W91A 2OB0A 2FS5A 4ORFA 1OBRA 1S7FA 3H8GA 3PB7X 2Y0MA 1IOFA 3KGQA 1AUGA 4PK3A 4MFLA 4W9YA 3IO1A 3DLJA 4MHZA 2BL1A 3F5BA 4UIAA 5EMIA 5C88A 4R3LA 1IB1E 1N71A 2AFZA 2VBQA 2EUIA 4KOUA 2QVPA 3FECA 2CNSA 3FF3A 1ZG7A 4C7HA 2PRBA 1BLLE 1F2PA 3FNCA 3SJGA 4MHYA 1BOBA 1CM0A 1XEBA 4A33A 2PJCA 4JZ0A 2G3TA 3QAYA 3SI2A 2AFOA 4A30A 2YNEA 4P4DA 3IU2A 2AFMA 3PP9A 2HUZA 3FRMA 4FAIA 1QMUA 1ARLA 2P6FA 3B3TA 3EXNA 3JUWA 5KTAA 3SJXA 2NMTA 4Q36A 3B3CA 2B4DA 2NYQA 5H84A 3WC6A 3RBUA 4PXEA 3FXTA 3BHXA 4UWIA 3S9LA 3R1KA 3TTHA 4KOXA 1IYKA 1Y0RA 2OZGA 2DEAA 1Z5RA 3LODA 4P44A 2BSWA 2F8HA 5EBVA 5C82A 2EBJA 5I0CA 1X10A 3DSBA 2ZXVA 4F9UA 3GLJA 1MK4A 4NJQA 4EVYA 4KOSA 1NSAA 4AG7A 4NJRA 3TO9A 2ZEMA 2PQ8A 4ONWA 2Q7SA 5CBMA 3NH4A 4OC1A 3PB6X 3N5FA 3WABA 4MCQA 5DWNA 3R9FA 3LD2A 2ZEDA 2D4OA 2FE7A 4MHPA 2HB6A 3NA6A 2PJ5A 4KORA 4PQAA 2ZENA 4MFJA 2PJ6A 1YLOA 2C6PA 2Q4YA 4R3KA 3KR5A 4MFQA 3CT9A 5AG6A 1YSJA 4KOWA 3EFAA 2QMLA 1R3NA 1XJOA 4MI4A 4O23A 2J8NA 1Y9KA 4H6ZA 4PSXA 2DPTA 4NGTA 5JH9A 2PC1A 5HVFA 4OC0A 2HQYA 4OMEA 1RXTA 3R9EA 1LAMA 1WK4A 4OKOA 3D67A 4CAVA 3OWCA 5IX3A 3FEEA 3IC1A 4YGOA 3B3SA 2ZW5A 4KOVA 2BOAA 4B14A 1QSOA 4NXYA 3SXOA 1IYLA 5AGEA 4YU9A 4LX9A 2ANPA 1M44A 2Q04A 4A32A 4GM5A 1YREA 3PB8X 3FX6A 2ZEOA 1A2ZA 4MMOA 5A27A 4CAFA 3BI0A 1VHSA 3NH8A 1B87A 2I79A 2JBKA 4IK2A 2B3UA 1KUXA 3WC5A 1K4JA 2PIZA 2V8GA 1PU9A 3CXQA 3D2PA 5LYLA 1JWQA 2ZW4A 4PSWA 1MJ9A 3JVNA 2B3VA 4E8OA 4M3SA 2AFSA 1MJAA 4M6GA 4PXDA 4P4BA 2AFXA 2HV2A 2Z3LA 1X12A 3CXSA 1QQ9A 1IGBA 2ABZA 4KZTA 4F6AA 3TOAA 2GIVA 3I1UA 4JWPA 2VI7A 1Z9UA 1V0CA 3V38A 1PUAA 2V8HA 1L0CA 4JLYA 4X2TA 5JM6A 3DDDA 3KKWA 2ARHA 3D7GA 4JJXA 2FVGA 1YLEA 4IHMA 4KVXA 5F49A 4UCMA 5ISVA 4YRHA 3TO7A 4ZI6A 1SQHA 1YR0A 4ONUA 2CTBA 4U9YA 2Z3MA 2JDDA 4FD6A 4NGQA 4OC3A 3T9YA 2GANA 3L2NA 1HDQA 4IAVA 4UEZA 3N7ZA 2NSMA 3GKRA 3B8GA 2BO9A 3H8FA 3IIBA 4F9VA 3PB4X 2PJBA 4QC6A 3WR7A 3RYOA 4A2ZA 2B58A 2PJAA 1BO4A 3T8WA 2P6EA 5DWMA 2YGWA 2ZOGA 3KHXA 2JDCA 3IGRA 3HUVA 4UEFA 2I3CA 1BPMA 1Y7EA 4GXHA 1Z2LA 3D7FA 1M1DA 4R9MA 2C6GA 4UF4A 2PJ3A 4MY0A 4AXVA 2PIYA 3TFYA 4XNHC 5K8PA 3D4UA 2GLJA 4M6HA 4UWJA 4NGMA 1LFWA 2JEWA 3SJEA 3CPXA 3IU1A 1Z4EA 4XNHB 4R76A 2C6CA 2PJ8A 2IMOA 4PK2A 4MJ8A 2Q4VA 4CGMA 1P0HA 4EWTA 2REEA 4MFZA 3NE8A 3S6KA 4OLLA 1LANA 2PJ7A 4ZX9A 4MXUA 1WWZA 2CF4A 4NGNA 4OC5A 2XEIA 4FBEA 4A38A 2O28A 2EK9A 2PJ2A 2OOTA 2QYVA 4HKFA 4Q38A 3CDXA 5HMNA 2Q0YA 2WUUA 3FIXA 2VZYA 3P2HA 4M85A 5G21A 4B12A 1Y0YA 3DR6A 2Q51A 2REFA 2RB7A 3K9TA 4C2XA 3G8WA 3WT4A 5F46A 3VWDA 1EE3P 4NSQA 2CXAA 3PBEA 4NCZA 3TT2A 3GY9A 4A37A 5BWAB 1S3ZA 4CPAA 4FWUA 4JXQA 1DE4C 1VHEA 2CIJA 4H6UA 1Q7LA 4QVTA 4U9ZA 1LRZA 2CNMA 4UCNA 3TCVA 4C7IA 4ZY1A 1KZFA 1XMBA 1AYEA 2R8VA 3KQZA 4BD9A 3KR4A 2H5MA 3PRTA 1LCPA 1CJWA 2Z10A 1CP6A 3BXMA 1XFOA 4FUUA 2EWBA 3PZJA 3WC7A 1AMPA 1IU8A 2B5GB 2CY2A 2X7BA 3FVLA 3B3VA 2AFWA 5AG7A 1ELMP 1Y7RA 5HH1A 4C2YA 1HEEA 1YQEA 5LRJA 2V77A 3KQXA 2ZEGA 4IF5A 5CNPA 4QB9A 5AG5A 1ARMA 4CRYB 4TNUA 1XOVA 5F09A 5K8OA 1CPSA 4CYQA 4PPZA 4CS0B 4XPDC 2FXFA 3K9UA 5IB0A 2GE3A 2RC4A 2PJ1A 2P0WA 2Z3KA 4MRIA 2VEZA 4B11A 2QECA 5J8CA 2O4HA 3FJUA 1H8LA 3BJ7A 3MRUA 1Z8WA 4QUSA 4XPDB 3S6FA 3SI0A 4B5PB 1RTQA 3D3SA 4OP4A 1UFHA 3F8KA 2KCWA 2EK8A 1ZLIA 4UA3A 4BBHA 1Z8TA 2JLMA 3T90A 1S7LA 3D2MA 4NEXA 1R43A 3PFEA 3KASA 4NFRA 4P4FA 4B6ZA 3SJFA 5CPAA 2QIRA 5LYIA 1FY7A 3SI1A 1OZPA 2ZW6A 4HNWB 4ZBGA 4F0YA 2VL1A 1TF8A 3R96A 5JPHA 5K8MA 1VGYA 4TWEA 1VHOA 1VKCA 4YWYA 1YW6A 3JRUA 3PB9X 1UWYA 1CBXA 3SXNA 7CPAA 2EO8A 5JQ4A 5THWA 4UIBA 1S60A 1KUYA 2PVWA 3BJ8A 3GUXA 4FD4A 1NE9A 2Z11A 1J4JA 3PEIA 2F7VA 3VARA 2PJ9A 3GIUA 4CGPA 3D7HA 3TO6A 4KSFA 4CYPA 2FT0A 3S9NA 5G1ZA 1ZG8A 2G0BA 5AG4A 5KTCA 4R7MA 5G22A 3K2KA 4R57A 4CGNA 5HVGA 1JQGA 5IB9A 3A9LA 4L89A 1XRYA 4Y49C 4MHNA 3C26A 4XPLA 4A39A 4P4IA 4Y49B 4JD6A 1PCAA 2ATRA 3B35A 2PRQA 4UFXA 2WSAA 4ZY2A 2PDOA 3IEHA 4KUBA 3BI1A 3D8PA 4UEEA 2O53A 3B2YA 1QSRA 2VQYA 2WZNA 2FIAA 3D68A 2Q7BA 2IJZA 1Q2YA 5KTDA 3FB3A 2ZEPA 2D4PA 4KVME 2POKA 4UFWA 2G9DA 4B13A 1YW4A 3NFZA 1TF9A 5ELYA 4ZY0A 3TC8A 4WWVA 4LQGA 4OAEA 1GHEA 2PCUA 3B3WA 3FYNA 4NF1A 5J1QA 3S9MA 2QJ8A 1YX0A 1YGHA 2Q44A 2PR8A 2OU2A 4KVOE 2YNDA 4K3NA 4E2AA 4BINA 4DJLA 3IFEA 1QSMA 2ZOFA 3IWEA 3I3GA 3NE7A 4ZX8A 1U6MA 1YMEA 2JEVA 5D29A 4KOTA 2WYRA 4H2KA 2FCKA 4KSIA 4MCSA 4DYOA 4MCRA 1S7KA 3EY5A 5LYDA 5I4MA 4P6YA 1TKHA 1DTDA 2ZEEA 1TKJA 3ISXA 4DUKA 3FBUA 3GB0A 2BEIA 4MBUA 5H86A 3CXPA 2GU2A 1IOIA 2OR4A 2Q43A 3PBBA 4GS4A 4B5OA 4BMHA 3MN8A 2ZEFA 3F0AA 2B5GA 4NGRA 2FIWA 1B6BA 4AVAA 4CGOA 3FMCA 4RS2A 2YNCC 2PJ0A 4PXCA 1KUVA 4OC2A 3RO0A 4WJBA 4FD7A 2PJ4A 4OC4A 4G1PA 2PE3A 3SHPA 1CP7A 1XF8A 3HLPA 2DPSA 4CGLA 3VATA 2P6GA 3PGPA 3P2FA 4ZYQA 4P4JA 4F0XA 3W6XA 2OZHA 1M4GA 4OIWA 2GFQA 2K5TA 1QSNA 5J8FA 1I1DA
chains in the Genus database with same CATH topology
4OADA 3TE4A 2ZW7A 2B4BA 4CYOA 5F48A 1YK3A 2WPWA 1IIDA 1NMTA 3DR8A 4KSAA 1XE4A 3I9SA 2I00A 3H4QA 1I21A 4CRZB 2J8RA 5G20A 3UY5A 1Q2CA 4QBJA 2F5IA 4IUSA 4ZGYB 2FL4A 4E0AA 4FD5A 3JTKA 2CNTA 4YFJA 3V8IA 4KUAA 3ZJ0A 4CAXA 4XPKA 2J8MA 3E0KA 2A4NA 4KLVA 4H89A 1YVKA 4C2ZA 2IL4A 5GCNA 4AG9A 2B4DB 2Z3OA 4U5YA 2R1IA 4CAWA 4I49A 2EVNA 1P4NA 3W6SA 3ZZIA 1S7NA 4HNXB 1XIXA 1R57A 5F47A 4K30A 3S6HA 2R98A 2FSRA 1Z4RA 4CAEA 4R87A 1S5KA 5E96A 1NSLA 4UBRA 3R9GA 3S6GA 4A31A 1MJBA 4MY3A 2VXKA 1I12A 1QSTA 2PSWA 5A28A 2C27A 1Q2DA 4MHDA 4PV6A 4HNYB 3EO4A 4L8AA 4J3GA 2WPXA 2PR1A 3QB8A 2OZUA 1IICA 2Z0ZA 3MGDA 1M4IA 4MFPA 4AB7A 4JXRA 1TIQA 3EC4A 2VZZA 4DNCA 4KLWA 1Y9WA 4KOYA 4KS9A 4LUAA 2BUEA 2DXQA 3DNSA 4UFVA 4CYNA 2G3AA 5FVJA 3H5ZA 4MFKA 1ZO0A 2Z3PA 1XMTA 2OH1A 3BLNA 1YVOA 1M4DA 4II9A 3R95A 1ON0A 3TOBA 5EC4A 2Z3NA 3G3SA 2YNCA 2ZPAA 4X5KA 2R7HA 2AJ6A 3GYAA 4AVBA 3VWEA 4AVCA 4B10A 3IWGA 2AE6A 4UCPA 4RI1A 1RO5A 5IV0A 4C68A 4B5PA 4A95A 3QAHA 3W91A 2OB0A 2FS5A 4ORFA 1S7FA 2Y0MA 4PK3A 4MFLA 5C88A 2BL1A 3F5BA 4R3LA 1IB1E 1N71A 2VBQA 2EUIA 4KOUA 2CNSA 4C7HA 2PRBA 3FNCA 1CM0A 1BOBA 1XEBA 4A33A 2G3TA 4A30A 2YNEA 3IU2A 3PP9A 2HUZA 3FRMA 2P6FA 3EXNA 3JUWA 5KTAA 2NMTA 4Q36A 2B4DA 5H84A 3FXTA 4UWIA 3R1KA 3TTHA 4KOXA 1IYKA 2OZGA 5EBVA 3LODA 2BSWA 5C82A 5I0CA 3DSBA 2ZXVA 1MK4A 4EVYA 4KOSA 4AG7A 2PQ8A 5DWNA 3R9FA 3LD2A 2D4OA 2FE7A 4KORA 4MFJA 4R3KA 2Q4YA 4MFQA 5AG6A 4KOWA 3EFAA 2QMLA 4MI4A 2J8NA 4H6ZA 1Y9KA 4PSXA 2DPTA 2PC1A 2HQYA 3R9EA 1RXTA 5IX3A 1WK4A 4CAVA 3OWCA 4YGOA 2ZW5A 4KOVA 4B14A 1QSOA 4NXYA 3SXOA 1IYLA 5AGEA 4LX9A 1M44A 2Q04A 4A32A 1YREA 5A27A 4CAFA 1VHSA 1B87A 2I79A 2B3UA 1KUXA 1K4JA 1PU9A 3CXQA 3D2PA 2ZW4A 4PSWA 1MJ9A 3JVNA 2B3VA 4E8OA 4M3SA 1MJAA 2Z3LA 2HV2A 3CXSA 4KZTA 4F6AA 3TOAA 2GIVA 4JWPA 2VI7A 1Z9UA 1V0CA 1PUAA 1L0CA 4JLYA 3DDDA 3KKWA 2ARHA 4JJXA 1YLEA 5F49A 4KVXA 4UCMA 5ISVA 4YRHA 3TO7A 1SQHA 1YR0A 4ONUA 4U9YA 2Z3MA 2JDDA 4FD6A 3T9YA 2GANA 3N7ZA 3GKRA 3B8GA 4QC6A 3WR7A 4A2ZA 3RYOA 2B58A 1BO4A 2P6EA 5DWMA 2YGWA 2JDCA 3IGRA 1M1DA 4R9MA 4MY0A 3TFYA 4XNHC 4UWJA 3IU1A 1Z4EA 4XNHB 4CGMA 4PK2A 4MJ8A 2Q4VA 1P0HA 2REEA 4MFZA 3S6KA 4OLLA 1WWZA 2O28A 4HKFA 4Q38A 5HMNA 2Q0YA 2WUUA 3FIXA 2VZYA 3P2HA 4M85A 5G21A 4B12A 3DR6A 2REFA 4C2XA 3G8WA 5F46A 3VWDA 4NSQA 2CXAA 4NCZA 3TT2A 3GY9A 5BWAB 1S3ZA 4JXQA 4H6UA 4UCNA 4C7IA 4QVTA 4U9ZA 3TCVA 1LRZA 2CNMA 1KZFA 2R8VA 2H5MA 1CJWA 2Z10A 3PZJA 2B5GB 2CY2A 2X7BA 5AG7A 4C2YA 5HH1A 1Y7RA 4IF5A 5CNPA 4QB9A 5AG5A 4CRYB 4CYQA 4CS0B 4XPDC 2FXFA 3K9UA 5IB0A 2GE3A 2RC4A 2Z3KA 2P0WA 4B11A 2VEZA 2QECA 5J8CA 3BJ7A 4XPDB 3S6FA 4B5PB 4QUSA 4UA3A 3D3SA 1UFHA 3F8KA 2KCWA 4BBHA 2JLMA 3T90A 1S7LA 3D2MA 4NEXA 2QIRA 1FY7A 1OZPA 2ZW6A 4HNWB 4ZBGA 4F0YA 3R96A 5JPHA 1VKCA 3SXNA 5JQ4A 1S60A 1KUYA 3BJ8A 4FD4A 1NE9A 2Z11A 1J4JA 4CGPA 3TO6A 4KSFA 4CYPA 2FT0A 5G1ZA 2G0BA 5AG4A 5KTCA 5G22A 4R57A 4CGNA 3A9LA 4L89A 4Y49C 3C26A 4XPLA 4Y49B 4JD6A 2ATRA 4UFXA 2WSAA 2PDOA 4KUBA 3D8PA 1QSRA 2VQYA 2FIAA 2Q7BA 5KTDA 1Q2YA 3FB3A 2D4PA 4KVME 4UFWA 4B13A 4OAEA 1GHEA 3FYNA 4NF1A 1YX0A 1YGHA 2Q44A 2PR8A 2OU2A 4KVOE 2YNDA 4E2AA 1QSMA 3IWEA 3I3GA 3NE7A 1U6MA 2JEVA 3TO9A 4KOTA 2FCKA 1S7KA 3EY5A 3FBUA 2BEIA 4MBUA 5H86A 3CXPA 4GS4A 4B5OA 4BMHA 3F0AA 2B5GA 2FIWA 1B6BA 4AVAA 4CGOA 4RS2A 2YNCC 1KUVA 4FD7A 3SHPA 1XF8A 2DPSA 4CGLA 2P6GA 3PGPA 3P2FA 4F0XA 3W6XA 2OZHA 1M4GA 2K5TA 1QSNA 5J8FA 1I1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OAD A;  3TE4 A;  2ZW7 A;  2B4B A;  5F48 A;  1YK3 A;  2WPW A;  1IID A;  1NMT A;  3DR8 A;  1XE4 A;  3I9S A;  2I00 A;  3H4Q A;  1I21 A;  4CRZ B;  2J8R A;  3UY5 A;  1Q2C A;  4QBJ A;  2F5I A;  4IUS A;  2FL4 A;  4E0A A;  4FD5 A;  2CNT A;  4YFJ A;  3V8I A;  4KUA A;  3ZJ0 A;  4CAX A;  4XPK A;  2J8M A;  3E0K A;  2A4N A;  4KLV A;  4H89 A;  1YVK A;  2IL4 A;  5GCN A;  4AG9 A;  2B4D B;  4U5Y A;  2R1I A;  4CAW A;  4I49 A;  2EVN A;  1P4N A;  3W6S A;  3ZZI A;  1S7N A;  4HNX B;  1XIX A;  1R57 A;  5F47 A;  4K30 A;  3S6H A;  2R98 A;  2FSR A;  1Z4R A;  4R87 A;  1S5K A;  5E96 A;  1NSL A;  4UBR A;  3R9G A;  3S6G A;  1MJB A;  4MY3 A;  2VXK A;  1I12 A;  1QST A;  2PSW A;  2C27 A;  1Q2D A;  4MHD A;  4PV6 A;  4HNY B;  3EO4 A;  4L8A A;  4J3G A;  2WPX A;  2PR1 A;  3QB8 A;  2OZU A;  1IIC A;  2Z0Z A;  3MGD A;  1M4I A;  4AB7 A;  4JXR A;  1TIQ A;  3EC4 A;  2VZZ A;  4DNC A;  4KLW A;  1Y9W A;  4KOY A;  4LUA A;  2BUE A;  2DXQ A;  3DNS A;  2G3A A;  5FVJ A;  1XMT A;  2OH1 A;  3BLN A;  1YVO A;  1M4D A;  4II9 A;  3R95 A;  1ON0 A;  3TOB A;  5EC4 A;  3G3S A;  2ZPA A;  4X5K A;  2R7H A;  2AJ6 A;  3GYA A;  4AVB A;  3VWE A;  4AVC A;  3IWG A;  2AE6 A;  4RI1 A;  1RO5 A;  5IV0 A;  4B5P A;  3QAH A;  3W91 A;  2OB0 A;  2FS5 A;  4ORF A;  1S7F A;  2Y0M A;  4PK3 A;  5C88 A;  2BL1 A;  3F5B A;  4R3L A;  1IB1 E;  1N71 A;  2VBQ A;  2EUI A;  4KOU A;  2CNS A;  2PRB A;  3FNC A;  1CM0 A;  1BOB A;  1XEB A;  2G3T A;  3PP9 A;  2HUZ A;  3FRM A;  2P6F A;  3EXN A;  3JUW A;  5KTA A;  2NMT A;  2B4D A;  5H84 A;  3FXT A;  4UWI A;  3R1K A;  3TTH A;  4KOX A;  1IYK A;  2OZG A;  5EBV A;  3LOD A;  2BSW A;  5C82 A;  5I0C A;  3DSB A;  2ZXV A;  1MK4 A;  4EVY A;  4KOS A;  4AG7 A;  2PQ8 A;  5DWN A;  3R9F A;  3LD2 A;  2D4O A;  2FE7 A;  4KOR A;  4R3K A;  2Q4Y A;  4KOW A;  3EFA A;  2QML A;  4MI4 A;  2J8N A;  1Y9K A;  4H6Z A;  4PSX A;  2PC1 A;  2HQY A;  3R9E A;  1RXT A;  5IX3 A;  1WK4 A;  4CAV A;  3OWC A;  4YGO A;  2ZW5 A;  4KOV A;  1QSO A;  4NXY A;  3SXO A;  1IYL A;  4LX9 A;  1M44 A;  2Q04 A;  1YRE A;  1VHS A;  1B87 A;  2I79 A;  2B3U A;  1KUX A;  1K4J A;  1PU9 A;  3CXQ A;  3D2P A;  2ZW4 A;  4PSW A;  1MJ9 A;  3JVN A;  2B3V A;  4E8O A;  4M3S A;  1MJA A;  2HV2 A;  3CXS A;  4KZT A;  4F6A A;  3TOA A;  2GIV A;  4JWP A;  2VI7 A;  1Z9U A;  1V0C A;  1PUA A;  1L0C A;  4JLY A;  3DDD A;  3KKW A;  2ARH A;  4JJX A;  1YLE A;  5F49 A;  4KVX A;  5ISV A;  4YRH A;  3TO7 A;  1SQH A;  1YR0 A;  4ONU A;  4U9Y A;  3T9Y A;  2JDD A;  4FD6 A;  2GAN A;  3N7Z A;  3GKR A;  3B8G A;  4QC6 A;  3WR7 A;  3RYO A;  2B58 A;  1BO4 A;  2P6E A;  5DWM A;  2JDC A;  3IGR A;  1M1D A;  4R9M A;  4MY0 A;  3TFY A;  4XNH C;  4UWJ A;  1Z4E A;  4XNH B;  4PK2 A;  4MJ8 A;  2Q4V A;  1P0H A;  2REE A;  3S6K A;  4OLL A;  1WWZ A;  2O28 A;  4HKF A;  5HMN A;  2Q0Y A;  3FIX A;  2VZY A;  3P2H A;  4M85 A;  3DR6 A;  2REF A;  3G8W A;  5F46 A;  3VWD A;  4NSQ A;  4NCZ A;  3TT2 A;  3GY9 A;  1S3Z A;  4JXQ A;  4H6U A;  4QVT A;  4U9Z A;  3TCV A;  1LRZ A;  2CNM A;  1KZF A;  2R8V A;  2H5M A;  1CJW A;  2Z10 A;  3PZJ A;  2B5G B;  2CY2 A;  2X7B A;  5HH1 A;  1Y7R A;  4IF5 A;  5CNP A;  4QB9 A;  4CRY B;  4CS0 B;  4XPD C;  2FXF A;  3K9U A;  5IB0 A;  2GE3 A;  2RC4 A;  2P0W A;  2VEZ A;  2QEC A;  5J8C A;  3BJ7 A;  4XPD B;  3S6F A;  4B5P B;  4QUS A;  4UA3 A;  3D3S A;  1UFH A;  3F8K A;  2KCW A;  2JLM A;  3T90 A;  1S7L A;  3D2M A;  4NEX A;  2QIR A;  1FY7 A;  1OZP A;  2ZW6 A;  4HNW B;  4ZBG A;  4F0Y A;  3R96 A;  5JPH A;  1VKC A;  3SXN A;  5JQ4 A;  1S60 A;  1KUY A;  3BJ8 A;  4FD4 A;  1NE9 A;  2Z11 A;  1J4J A;  3TO6 A;  2FT0 A;  2G0B A;  5KTC A;  4R57 A;  4L89 A;  4Y49 C;  3C26 A;  4XPL A;  4Y49 B;  4JD6 A;  2ATR A;  2PDO A;  4KUB A;  3D8P A;  1QSR A;  2VQY A;  2FIA A;  2Q7B A;  5KTD A;  1Q2Y A;  3FB3 A;  2D4P A;  4KVM E;  4OAE A;  1GHE A;  3FYN A;  4NF1 A;  1YX0 A;  1YGH A;  2Q44 A;  2PR8 A;  2OU2 A;  4KVO E;  4E2A A;  1QSM A;  3I3G A;  3NE7 A;  1U6M A;  2JEV A;  3TO9 A;  4KOT A;  2FCK A;  1S7K A;  3EY5 A;  3FBU A;  2BEI A;  4MBU A;  5H86 A;  3CXP A;  4GS4 A;  4B5O A;  4BMH A;  3F0A A;  2B5G A;  2FIW A;  1B6B A;  4AVA A;  4RS2 A;  1KUV A;  4FD7 A;  3SHP A;  1XF8 A;  2P6G A;  3PGP A;  3P2F A;  3W6X A;  2OZH A;  1M4G A;  2K5T A;  1QSN A;  5J8F A;  1I1D A; 
#chains in the Genus database with same CATH topology
 3FH4 A;  2ZEL A;  4OAD A;  3TE4 A;  2ZW7 A;  2B4B A;  4CYO A;  3CZX A;  3IJ3 A;  5F48 A;  1KWM A;  1YK3 A;  2WPW A;  1IID A;  4X3R A;  1NMT A;  4P4E A;  3DR8 A;  4KSA A;  1XE4 A;  3I9S A;  2I00 A;  4F8Z A;  5HVH A;  3H4Q A;  1I21 A;  4CRZ B;  2J8R A;  3IWW A;  4R6T A;  1TXR A;  3KZW A;  5G20 A;  3ISZ A;  3UY5 A;  1Q2C A;  3RNZ A;  3CPA A;  2F5I A;  4IUS A;  3FED A;  4QBJ A;  1M4L A;  2FL4 A;  4ZGY B;  4OID A;  3RAM A;  4E0A A;  4FD5 A;  4P10 A;  3JTK A;  2CNT A;  4YFJ A;  5HXD A;  2GRE A;  2PVV A;  3V8I A;  4Q7A A;  4KUA A;  3ZJ0 A;  4CAX A;  4XPK A;  4RUH A;  2CTC A;  2J8M A;  3E0K A;  2A4N A;  3NH5 A;  1F57 A;  3KI9 A;  4KLV A;  2XEG A;  4H89 A;  1CG2 A;  2XEJ A;  4Z65 A;  1YVK A;  4C2Z A;  2IL4 A;  1CPX A;  5GCN A;  4AG9 A;  1BPN A;  4RN7 A;  3KHZ A;  2B4D B;  2Z3O A;  4U5Y A;  2R1I A;  4CAW A;  4I49 A;  4R8F A;  2EVN A;  1P4N A;  2ZEH A;  4LQ6 A;  3TX8 A;  2ODF A;  3W6S A;  3ZZI A;  1S7N A;  1VIX A;  4HNX B;  1XIX A;  1R57 A;  2J9A A;  2V8D A;  5F47 A;  4K30 A;  3S6H A;  2DF5 A;  4M6I A;  2R98 A;  2FSR A;  1Z4R A;  4CAE A;  1FT7 A;  4R87 A;  1F2O A;  1S5K A;  5E96 A;  3V7Z A;  4JYW A;  4MCP A;  5LRK A;  4A94 A;  1NSL A;  5LRG A;  4P45 A;  1FNO A;  4UBR A;  3R9G A;  3RZA A;  3S6G A;  4A31 A;  1MJB A;  3KL9 A;  4X8I A;  4MY3 A;  2VXK A;  1I12 A;  1QST A;  3D66 A;  1IY7 A;  2PSW A;  2XEF A;  1XBU A;  1BAV A;  5A28 A;  2RFH A;  2C27 A;  1GYT A;  1Q2D A;  4MHD A;  4PV6 A;  4HNY B;  3EO4 A;  3LAC A;  4L8A A;  3PFO A;  4J3G A;  2WPX A;  5D8N A;  1TKF A;  1PYT B;  2PR1 A;  4NGP A;  3QB8 A;  1HDU A;  2V8V A;  4EFD A;  2OZU A;  1IIC A;  2GLF A;  3D7D A;  3QNV A;  4NGS A;  2Z0Z A;  1LAP A;  3DGV A;  3MGD A;  4PXB A;  1M4I A;  4MFP A;  4AB7 A;  1Z8L A;  4JXR A;  1TIQ A;  3EC4 A;  6CPA A;  8CPA A;  2JBJ A;  2VZZ A;  4DNC A;  4KLW A;  5DS0 A;  1Y9W A;  4KOY A;  4KS9 A;  4LUA A;  2BUE A;  3LMS A;  1Z8X A;  2DXQ A;  3DNS A;  2C1C A;  4UFV A;  4CYN A;  2G3A A;  5FVJ A;  3H5Z A;  4MFK A;  1ZO0 A;  2Q4Z A;  2Z3P A;  1XMT A;  2OH1 A;  3BLN A;  1YVO A;  1ZG9 A;  1M4D A;  1CX8 A;  5K8N A;  3R95 A;  4II9 A;  1ON0 A;  1LOK A;  3TOB A;  4HPS A;  5EC4 A;  3VH9 A;  5LYF A;  2AFU A;  2IQ6 A;  2Z3N A;  3G3S A;  2YNC A;  2ZPA A;  1ELL P;  4X5K A;  2R7H A;  1ZLH A;  3LWU A;  4EME A;  2AJ6 A;  3H8E A;  3GYA A;  4AVB A;  2HC9 A;  3B7I A;  2BCO A;  3VWE A;  4AVC A;  4B10 A;  3IWG A;  2AE6 A;  4UCP A;  4RI1 A;  1RO5 A;  5IV0 A;  4C68 A;  4B5P A;  4A95 A;  5JGF A;  3QAH A;  3W91 A;  2OB0 A;  2FS5 A;  4ORF A;  1OBR A;  1S7F A;  3H8G A;  3PB7 X;  2Y0M A;  1IOF A;  3KGQ A;  1AUG A;  4PK3 A;  4MFL A;  4W9Y A;  3IO1 A;  3DLJ A;  4MHZ A;  2BL1 A;  3F5B A;  4UIA A;  5EMI A;  5C88 A;  4R3L A;  1IB1 E;  1N71 A;  2AFZ A;  2VBQ A;  2EUI A;  4KOU A;  2QVP A;  3FEC A;  2CNS A;  3FF3 A;  1ZG7 A;  4C7H A;  2PRB A;  1BLL E;  1F2P A;  3FNC A;  3SJG A;  4MHY A;  1BOB A;  1CM0 A;  1XEB A;  4A33 A;  2PJC A;  4JZ0 A;  2G3T A;  3QAY A;  3SI2 A;  2AFO A;  4A30 A;  2YNE A;  4P4D A;  3IU2 A;  2AFM A;  3PP9 A;  2HUZ A;  3FRM A;  4FAI A;  1QMU A;  1ARL A;  2P6F A;  3B3T A;  3EXN A;  3JUW A;  5KTA A;  3SJX A;  2NMT A;  4Q36 A;  3B3C A;  2B4D A;  2NYQ A;  5H84 A;  3WC6 A;  3RBU A;  4PXE A;  3FXT A;  3BHX A;  4UWI A;  3S9L A;  3R1K A;  3TTH A;  4KOX A;  1IYK A;  1Y0R A;  2OZG A;  2DEA A;  1Z5R A;  3LOD A;  4P44 A;  2BSW A;  2F8H A;  5EBV A;  5C82 A;  2EBJ A;  5I0C A;  1X10 A;  3DSB A;  2ZXV A;  4F9U A;  3GLJ A;  1MK4 A;  4NJQ A;  4EVY A;  4KOS A;  1NSA A;  4AG7 A;  4NJR A;  3TO9 A;  2ZEM A;  2PQ8 A;  4ONW A;  2Q7S A;  5CBM A;  3NH4 A;  4OC1 A;  3PB6 X;  3N5F A;  3WAB A;  4MCQ A;  5DWN A;  3R9F A;  3LD2 A;  2ZED A;  2D4O A;  2FE7 A;  4MHP A;  2HB6 A;  3NA6 A;  2PJ5 A;  4KOR A;  4PQA A;  2ZEN A;  4MFJ A;  2PJ6 A;  1YLO A;  2C6P A;  2Q4Y A;  4R3K A;  3KR5 A;  4MFQ A;  3CT9 A;  5AG6 A;  1YSJ A;  4KOW A;  3EFA A;  2QML A;  1R3N A;  1XJO A;  4MI4 A;  4O23 A;  2J8N A;  1Y9K A;  4H6Z A;  4PSX A;  2DPT A;  4NGT A;  5JH9 A;  2PC1 A;  5HVF A;  4OC0 A;  2HQY A;  4OME A;  1RXT A;  3R9E A;  1LAM A;  1WK4 A;  4OKO A;  3D67 A;  4CAV A;  3OWC A;  5IX3 A;  3FEE A;  3IC1 A;  4YGO A;  3B3S A;  2ZW5 A;  4KOV A;  2BOA A;  4B14 A;  1QSO A;  4NXY A;  3SXO A;  1IYL A;  5AGE A;  4YU9 A;  4LX9 A;  2ANP A;  1M44 A;  2Q04 A;  4A32 A;  4GM5 A;  1YRE A;  3PB8 X;  3FX6 A;  2ZEO A;  1A2Z A;  4MMO A;  5A27 A;  4CAF A;  3BI0 A;  1VHS A;  3NH8 A;  1B87 A;  2I79 A;  2JBK A;  4IK2 A;  2B3U A;  1KUX A;  3WC5 A;  1K4J A;  2PIZ A;  2V8G A;  1PU9 A;  3CXQ A;  3D2P A;  5LYL A;  1JWQ A;  2ZW4 A;  4PSW A;  1MJ9 A;  3JVN A;  2B3V A;  4E8O A;  4M3S A;  2AFS A;  1MJA A;  4M6G A;  4PXD A;  4P4B A;  2AFX A;  2HV2 A;  2Z3L A;  1X12 A;  3CXS A;  1QQ9 A;  1IGB A;  2ABZ A;  4KZT A;  4F6A A;  3TOA A;  2GIV A;  3I1U A;  4JWP A;  2VI7 A;  1Z9U A;  1V0C A;  3V38 A;  1PUA A;  2V8H A;  1L0C A;  4JLY A;  4X2T A;  5JM6 A;  3DDD A;  3KKW A;  2ARH A;  3D7G A;  4JJX A;  2FVG A;  1YLE A;  4IHM A;  4KVX A;  5F49 A;  4UCM A;  5ISV A;  4YRH A;  3TO7 A;  4ZI6 A;  1SQH A;  1YR0 A;  4ONU A;  2CTB A;  4U9Y A;  2Z3M A;  2JDD A;  4FD6 A;  4NGQ A;  4OC3 A;  3T9Y A;  2GAN A;  3L2N A;  1HDQ A;  4IAV A;  4UEZ A;  3N7Z A;  2NSM A;  3GKR A;  3B8G A;  2BO9 A;  3H8F A;  3IIB A;  4F9V A;  3PB4 X;  2PJB A;  4QC6 A;  3WR7 A;  3RYO A;  4A2Z A;  2B58 A;  2PJA A;  1BO4 A;  3T8W A;  2P6E A;  5DWM A;  2YGW A;  2ZOG A;  3KHX A;  2JDC A;  3IGR A;  3HUV A;  4UEF A;  2I3C A;  1BPM A;  1Y7E A;  4GXH A;  1Z2L A;  3D7F A;  1M1D A;  4R9M A;  2C6G A;  4UF4 A;  2PJ3 A;  4MY0 A;  4AXV A;  2PIY A;  3TFY A;  4XNH C;  5K8P A;  3D4U A;  2GLJ A;  4M6H A;  4UWJ A;  4NGM A;  1LFW A;  2JEW A;  3SJE A;  3CPX A;  3IU1 A;  1Z4E A;  4XNH B;  4R76 A;  2C6C A;  2PJ8 A;  2IMO A;  4PK2 A;  4MJ8 A;  2Q4V A;  4CGM A;  1P0H A;  4EWT A;  2REE A;  4MFZ A;  3NE8 A;  3S6K A;  4OLL A;  1LAN A;  2PJ7 A;  4ZX9 A;  4MXU A;  1WWZ A;  2CF4 A;  4NGN A;  4OC5 A;  2XEI A;  4FBE A;  4A38 A;  2O28 A;  2EK9 A;  2PJ2 A;  2OOT A;  2QYV A;  4HKF A;  4Q38 A;  3CDX A;  5HMN A;  2Q0Y A;  2WUU A;  3FIX A;  2VZY A;  3P2H A;  4M85 A;  5G21 A;  4B12 A;  1Y0Y A;  3DR6 A;  2Q51 A;  2REF A;  2RB7 A;  3K9T A;  4C2X A;  3G8W A;  3WT4 A;  5F46 A;  3VWD A;  1EE3 P;  4NSQ A;  2CXA A;  3PBE A;  4NCZ A;  3TT2 A;  3GY9 A;  4A37 A;  5BWA B;  1S3Z A;  4CPA A;  4FWU A;  4JXQ A;  1DE4 C;  1VHE A;  2CIJ A;  4H6U A;  1Q7L A;  4QVT A;  4U9Z A;  1LRZ A;  2CNM A;  4UCN A;  3TCV A;  4C7I A;  4ZY1 A;  1KZF A;  1XMB A;  1AYE A;  2R8V A;  3KQZ A;  4BD9 A;  3KR4 A;  2H5M A;  3PRT A;  1LCP A;  1CJW A;  2Z10 A;  1CP6 A;  3BXM A;  1XFO A;  4FUU A;  2EWB A;  3PZJ A;  3WC7 A;  1AMP A;  1IU8 A;  2B5G B;  2CY2 A;  2X7B A;  3FVL A;  3B3V A;  2AFW A;  5AG7 A;  1ELM P;  1Y7R A;  5HH1 A;  4C2Y A;  1HEE A;  1YQE A;  5LRJ A;  2V77 A;  3KQX A;  2ZEG A;  4IF5 A;  5CNP A;  4QB9 A;  5AG5 A;  1ARM A;  4CRY B;  4TNU A;  1XOV A;  5F09 A;  5K8O A;  1CPS A;  4CYQ A;  4PPZ A;  4CS0 B;  4XPD C;  2FXF A;  3K9U A;  5IB0 A;  2GE3 A;  2RC4 A;  2PJ1 A;  2P0W A;  2Z3K A;  4MRI A;  2VEZ A;  4B11 A;  2QEC A;  5J8C A;  2O4H A;  3FJU A;  1H8L A;  3BJ7 A;  3MRU A;  1Z8W A;  4QUS A;  4XPD B;  3S6F A;  3SI0 A;  4B5P B;  1RTQ A;  3D3S A;  4OP4 A;  1UFH A;  3F8K A;  2KCW A;  2EK8 A;  1ZLI A;  4UA3 A;  4BBH A;  1Z8T A;  2JLM A;  3T90 A;  1S7L A;  3D2M A;  4NEX A;  1R43 A;  3PFE A;  3KAS A;  4NFR A;  4P4F A;  4B6Z A;  3SJF A;  5CPA A;  2QIR A;  5LYI A;  1FY7 A;  3SI1 A;  1OZP A;  2ZW6 A;  4HNW B;  4ZBG A;  4F0Y A;  2VL1 A;  1TF8 A;  3R96 A;  5JPH A;  5K8M A;  1VGY A;  4TWE A;  1VHO A;  1VKC A;  4YWY A;  1YW6 A;  3JRU A;  3PB9 X;  1UWY A;  1CBX A;  3SXN A;  7CPA A;  2EO8 A;  5JQ4 A;  5THW A;  4UIB A;  1S60 A;  1KUY A;  2PVW A;  3BJ8 A;  3GUX A;  4FD4 A;  1NE9 A;  2Z11 A;  1J4J A;  3PEI A;  2F7V A;  3VAR A;  2PJ9 A;  3GIU A;  4CGP A;  3D7H A;  3TO6 A;  4KSF A;  4CYP A;  2FT0 A;  3S9N A;  5G1Z A;  1ZG8 A;  2G0B A;  5AG4 A;  5KTC A;  4R7M A;  5G22 A;  3K2K A;  4R57 A;  4CGN A;  5HVG A;  1JQG A;  5IB9 A;  3A9L A;  4L89 A;  1XRY A;  4Y49 C;  4MHN A;  3C26 A;  4XPL A;  4A39 A;  4P4I A;  4Y49 B;  4JD6 A;  1PCA A;  2ATR A;  3B35 A;  2PRQ A;  4UFX A;  2WSA A;  4ZY2 A;  2PDO A;  3IEH A;  4KUB A;  3BI1 A;  3D8P A;  4UEE A;  2O53 A;  3B2Y A;  1QSR A;  2VQY A;  2WZN A;  2FIA A;  3D68 A;  2Q7B A;  2IJZ A;  1Q2Y A;  5KTD A;  3FB3 A;  2ZEP A;  2D4P A;  4KVM E;  2POK A;  4UFW A;  2G9D A;  4B13 A;  1YW4 A;  3NFZ A;  1TF9 A;  5ELY A;  4ZY0 A;  3TC8 A;  4WWV A;  4LQG A;  4OAE A;  1GHE A;  2PCU A;  3B3W A;  3FYN A;  4NF1 A;  5J1Q A;  3S9M A;  2QJ8 A;  1YX0 A;  1YGH A;  2Q44 A;  2PR8 A;  2OU2 A;  4KVO E;  2YND A;  4K3N A;  4E2A A;  4BIN A;  4DJL A;  3IFE A;  1QSM A;  2ZOF A;  3IWE A;  3I3G A;  3NE7 A;  4ZX8 A;  1U6M A;  1YME A;  2JEV A;  5D29 A;  4KOT A;  2WYR A;  4H2K A;  2FCK A;  4KSI A;  4MCS A;  4DYO A;  4MCR A;  1S7K A;  3EY5 A;  5LYD A;  5I4M A;  4P6Y A;  1TKH A;  1DTD A;  2ZEE A;  1TKJ A;  3ISX A;  4DUK A;  3FBU A;  3GB0 A;  2BEI A;  4MBU A;  5H86 A;  3CXP A;  2GU2 A;  1IOI A;  2OR4 A;  2Q43 A;  3PBB A;  4GS4 A;  4B5O A;  4BMH A;  3MN8 A;  2ZEF A;  3F0A A;  2B5G A;  4NGR A;  2FIW A;  1B6B A;  4AVA A;  4CGO A;  3FMC A;  4RS2 A;  2YNC C;  2PJ0 A;  4PXC A;  1KUV A;  4OC2 A;  3RO0 A;  4WJB A;  4FD7 A;  2PJ4 A;  4OC4 A;  4G1P A;  2PE3 A;  3SHP A;  1CP7 A;  1XF8 A;  3HLP A;  2DPS A;  4CGL A;  3VAT A;  2P6G A;  3PGP A;  3P2F A;  4ZYQ A;  4P4J A;  4F0X A;  3W6X A;  2OZH A;  1M4G A;  4OIW A;  2GFQ A;  2K5T A;  1QSN A;  5J8F A;  1I1D A; 
#chains in the Genus database with same CATH homology
 4OAD A;  3TE4 A;  2ZW7 A;  2B4B A;  4CYO A;  5F48 A;  1YK3 A;  2WPW A;  1IID A;  1NMT A;  3DR8 A;  4KSA A;  1XE4 A;  3I9S A;  2I00 A;  3H4Q A;  1I21 A;  4CRZ B;  2J8R A;  5G20 A;  3UY5 A;  1Q2C A;  4QBJ A;  2F5I A;  4IUS A;  4ZGY B;  2FL4 A;  4E0A A;  4FD5 A;  3JTK A;  2CNT A;  4YFJ A;  3V8I A;  4KUA A;  3ZJ0 A;  4CAX A;  4XPK A;  2J8M A;  3E0K A;  2A4N A;  4KLV A;  4H89 A;  1YVK A;  4C2Z A;  2IL4 A;  5GCN A;  4AG9 A;  2B4D B;  2Z3O A;  4U5Y A;  2R1I A;  4CAW A;  4I49 A;  2EVN A;  1P4N A;  3W6S A;  3ZZI A;  1S7N A;  4HNX B;  1XIX A;  1R57 A;  5F47 A;  4K30 A;  3S6H A;  2R98 A;  2FSR A;  1Z4R A;  4CAE A;  4R87 A;  1S5K A;  5E96 A;  1NSL A;  4UBR A;  3R9G A;  3S6G A;  4A31 A;  1MJB A;  4MY3 A;  2VXK A;  1I12 A;  1QST A;  2PSW A;  5A28 A;  2C27 A;  1Q2D A;  4MHD A;  4PV6 A;  4HNY B;  3EO4 A;  4L8A A;  4J3G A;  2WPX A;  2PR1 A;  3QB8 A;  2OZU A;  1IIC A;  2Z0Z A;  3MGD A;  1M4I A;  4MFP A;  4AB7 A;  4JXR A;  1TIQ A;  3EC4 A;  2VZZ A;  4DNC A;  4KLW A;  1Y9W A;  4KOY A;  4KS9 A;  4LUA A;  2BUE A;  2DXQ A;  3DNS A;  4UFV A;  4CYN A;  2G3A A;  5FVJ A;  3H5Z A;  4MFK A;  1ZO0 A;  2Z3P A;  1XMT A;  2OH1 A;  3BLN A;  1YVO A;  1M4D A;  4II9 A;  3R95 A;  1ON0 A;  3TOB A;  5EC4 A;  2Z3N A;  3G3S A;  2YNC A;  2ZPA A;  4X5K A;  2R7H A;  2AJ6 A;  3GYA A;  4AVB A;  3VWE A;  4AVC A;  4B10 A;  3IWG A;  2AE6 A;  4UCP A;  4RI1 A;  1RO5 A;  5IV0 A;  4C68 A;  4B5P A;  4A95 A;  3QAH A;  3W91 A;  2OB0 A;  2FS5 A;  4ORF A;  1S7F A;  2Y0M A;  4PK3 A;  4MFL A;  5C88 A;  2BL1 A;  3F5B A;  4R3L A;  1IB1 E;  1N71 A;  2VBQ A;  2EUI A;  4KOU A;  2CNS A;  4C7H A;  2PRB A;  3FNC A;  1CM0 A;  1BOB A;  1XEB A;  4A33 A;  2G3T A;  4A30 A;  2YNE A;  3IU2 A;  3PP9 A;  2HUZ A;  3FRM A;  2P6F A;  3EXN A;  3JUW A;  5KTA A;  2NMT A;  4Q36 A;  2B4D A;  5H84 A;  3FXT A;  4UWI A;  3R1K A;  3TTH A;  4KOX A;  1IYK A;  2OZG A;  5EBV A;  3LOD A;  2BSW A;  5C82 A;  5I0C A;  3DSB A;  2ZXV A;  1MK4 A;  4EVY A;  4KOS A;  4AG7 A;  2PQ8 A;  5DWN A;  3R9F A;  3LD2 A;  2D4O A;  2FE7 A;  4KOR A;  4MFJ A;  4R3K A;  2Q4Y A;  4MFQ A;  5AG6 A;  4KOW A;  3EFA A;  2QML A;  4MI4 A;  2J8N A;  4H6Z A;  1Y9K A;  4PSX A;  2DPT A;  2PC1 A;  2HQY A;  3R9E A;  1RXT A;  5IX3 A;  1WK4 A;  4CAV A;  3OWC A;  4YGO A;  2ZW5 A;  4KOV A;  4B14 A;  1QSO A;  4NXY A;  3SXO A;  1IYL A;  5AGE A;  4LX9 A;  1M44 A;  2Q04 A;  4A32 A;  1YRE A;  5A27 A;  4CAF A;  1VHS A;  1B87 A;  2I79 A;  2B3U A;  1KUX A;  1K4J A;  1PU9 A;  3CXQ A;  3D2P A;  2ZW4 A;  4PSW A;  1MJ9 A;  3JVN A;  2B3V A;  4E8O A;  4M3S A;  1MJA A;  2Z3L A;  2HV2 A;  3CXS A;  4KZT A;  4F6A A;  3TOA A;  2GIV A;  4JWP A;  2VI7 A;  1Z9U A;  1V0C A;  1PUA A;  1L0C A;  4JLY A;  3DDD A;  3KKW A;  2ARH A;  4JJX A;  1YLE A;  5F49 A;  4KVX A;  4UCM A;  5ISV A;  4YRH A;  3TO7 A;  1SQH A;  1YR0 A;  4ONU A;  4U9Y A;  2Z3M A;  2JDD A;  4FD6 A;  3T9Y A;  2GAN A;  3N7Z A;  3GKR A;  3B8G A;  4QC6 A;  3WR7 A;  4A2Z A;  3RYO A;  2B58 A;  1BO4 A;  2P6E A;  5DWM A;  2YGW A;  2JDC A;  3IGR A;  1M1D A;  4R9M A;  4MY0 A;  3TFY A;  4XNH C;  4UWJ A;  3IU1 A;  1Z4E A;  4XNH B;  4CGM A;  4PK2 A;  4MJ8 A;  2Q4V A;  1P0H A;  2REE A;  4MFZ A;  3S6K A;  4OLL A;  1WWZ A;  2O28 A;  4HKF A;  4Q38 A;  5HMN A;  2Q0Y A;  2WUU A;  3FIX A;  2VZY A;  3P2H A;  4M85 A;  5G21 A;  4B12 A;  3DR6 A;  2REF A;  4C2X A;  3G8W A;  5F46 A;  3VWD A;  4NSQ A;  2CXA A;  4NCZ A;  3TT2 A;  3GY9 A;  5BWA B;  1S3Z A;  4JXQ A;  4H6U A;  4UCN A;  4C7I A;  4QVT A;  4U9Z A;  3TCV A;  1LRZ A;  2CNM A;  1KZF A;  2R8V A;  2H5M A;  1CJW A;  2Z10 A;  3PZJ A;  2B5G B;  2CY2 A;  2X7B A;  5AG7 A;  4C2Y A;  5HH1 A;  1Y7R A;  4IF5 A;  5CNP A;  4QB9 A;  5AG5 A;  4CRY B;  4CYQ A;  4CS0 B;  4XPD C;  2FXF A;  3K9U A;  5IB0 A;  2GE3 A;  2RC4 A;  2Z3K A;  2P0W A;  4B11 A;  2VEZ A;  2QEC A;  5J8C A;  3BJ7 A;  4XPD B;  3S6F A;  4B5P B;  4QUS A;  4UA3 A;  3D3S A;  1UFH A;  3F8K A;  2KCW A;  4BBH A;  2JLM A;  3T90 A;  1S7L A;  3D2M A;  4NEX A;  2QIR A;  1FY7 A;  1OZP A;  2ZW6 A;  4HNW B;  4ZBG A;  4F0Y A;  3R96 A;  5JPH A;  1VKC A;  3SXN A;  5JQ4 A;  1S60 A;  1KUY A;  3BJ8 A;  4FD4 A;  1NE9 A;  2Z11 A;  1J4J A;  4CGP A;  3TO6 A;  4KSF A;  4CYP A;  2FT0 A;  5G1Z A;  2G0B A;  5AG4 A;  5KTC A;  5G22 A;  4R57 A;  4CGN A;  3A9L A;  4L89 A;  4Y49 C;  3C26 A;  4XPL A;  4Y49 B;  4JD6 A;  2ATR A;  4UFX A;  2WSA A;  2PDO A;  4KUB A;  3D8P A;  1QSR A;  2VQY A;  2FIA A;  2Q7B A;  5KTD A;  1Q2Y A;  3FB3 A;  2D4P A;  4KVM E;  4UFW A;  4B13 A;  4OAE A;  1GHE A;  3FYN A;  4NF1 A;  1YX0 A;  1YGH A;  2Q44 A;  2PR8 A;  2OU2 A;  4KVO E;  2YND A;  4E2A A;  1QSM A;  3IWE A;  3I3G A;  3NE7 A;  1U6M A;  2JEV A;  3TO9 A;  4KOT A;  2FCK A;  1S7K A;  3EY5 A;  3FBU A;  2BEI A;  4MBU A;  5H86 A;  3CXP A;  4GS4 A;  4B5O A;  4BMH A;  3F0A A;  2B5G A;  2FIW A;  1B6B A;  4AVA A;  4CGO A;  4RS2 A;  2YNC C;  1KUV A;  4FD7 A;  3SHP A;  1XF8 A;  2DPS A;  4CGL A;  2P6G A;  3PGP A;  3P2F A;  4F0X A;  3W6X A;  2OZH A;  1M4G A;  2K5T A;  1QSN A;  5J8F A;  1I1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...