4NDOB

Crystal structure molybdenum storage protein with fully mo-loaded cavity
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
268
structure length
268
Chain Sequence
b'NSTAELEELLMQRSLTDPQLQAAAAAAADFRILPDATVIKIGGQSVIDRGRAAVYPLVDEIVAARKNHKLLIGTGAGTRARHLYSIAAGLGLPAGVLAQLGSSVADQNAAMLGQLLAKHGIPVVGGAGLSAVPLSLAEVNAVVFSGMPPYKLWMRPAAEGVIPPYRTDAGCFLLAEQFGCKQMIFVKDEDGLYTANPKTSKDATFIPRISVDEMKAKGLHDSILEFPVLDLLQSAQHVREVQVVNGLVPGNLTRALAGEHVGTIITAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdenum storage protein subunit beta
publication title Structural diversity of polyoxomolybdate clusters along the three-fold axis of the molybdenum storage protein.
pubmed doi rcsb
molecule tags Metal binding protein
total genus 95
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2013-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 4ndoB00
3D41A 2IJ9A 4USJA 3K56A 2CDQA 2BRIA 1GS5A 1B7BA 1OHAA 2J4LA 2JJ4A 2BNFA 3LKKA 1E19A 4NDQB 3C1MA 4Q1TA 4NDQA 4F6TA 2A1FA 2WXBA 2JI5A 2R8VA 3EK6A 3AB2A 4A7XA 3L76A 3S6GA 2HMFA 2AP9A 2BNDA 3QVFA 2BRXA 4AXSA 1OHBA 3D40A 3QUOA 4JZ7A 2X2WA 4F6TB 2JJXA 2WE4A 3S6HA 3T7BA 4NDOB 2J0XA 4NDOA 3WWNA 2R98A 4KZTA 2WE5A 3ZZGA 2AKOA 2V5HA 1YBDA 2V4YA 3NWYA 3K52A 4NDRB 4OLCA 4NDRA 3C20A 2J5TA 3ZZIA 2BTYA 3ZZFA 2W21A 3KZFA 3AB4A 3B8GA 3EK5A 3LL9A 2BNEA 3QVHA 4JZ8A 3WWMA 2E9YA 3L86A 2J0WA 2OGXB 3K4YA 1GSJA 4NDPB 3QURA 1Z9DA 3TVIA 2OGXA 4NDPA 2BUFA 3QUNA 3C1NA 4JZ9A 3AAWA 2BMUA 2RD5A 3D2MA 3U6UA 2VA1A 2J5VA 2J4KA 4A7WA 3ZZHA 3LL5A 4I49A 3K4OA 3S6KA 3D2PA 4AB7A 1OH9A 2J4JA
chains in the Genus database with same CATH superfamily
3D41A 2IJ9A 4USJA 3K56A 2CDQA 2BRIA 1GS5A 1B7BA 1OHAA 2J4LA 2JJ4A 2BNFA 3LKKA 1E19A 4NDQB 3C1MA 4Q1TA 4NDQA 4F6TA 2A1FA 2WXBA 2JI5A 2R8VA 3EK6A 3AB2A 4A7XA 3L76A 3S6GA 2HMFA 2AP9A 2BNDA 3QVFA 2BRXA 4AXSA 1OHBA 3D40A 3QUOA 4JZ7A 2X2WA 4F6TB 2JJXA 2WE4A 3S6HA 3T7BA 4NDOB 2J0XA 4NDOA 3WWNA 2R98A 4KZTA 2WE5A 3ZZGA 2AKOA 2V5HA 1YBDA 2V4YA 3NWYA 3K52A 4NDRB 4OLCA 4NDRA 3C20A 2J5TA 3ZZIA 2BTYA 3ZZFA 2W21A 3KZFA 3AB4A 3B8GA 3EK5A 3LL9A 2BNEA 3QVHA 4JZ8A 3WWMA 2E9YA 3L86A 2J0WA 2OGXB 3K4YA 1GSJA 4NDPB 3QURA 1Z9DA 3TVIA 2OGXA 4NDPA 2BUFA 3QUNA 3C1NA 4JZ9A 3AAWA 2BMUA 2RD5A 3D2MA 3U6UA 2VA1A 2J5VA 2J4KA 4A7WA 3ZZHA 3LL5A 4I49A 3K4OA 3S6KA 3D2PA 4AB7A 1OH9A 2J4JA
chains in the Genus database with same CATH topology
3D41A 2IJ9A 4USJA 3K56A 2CDQA 2BRIA 1GS5A 1B7BA 1OHAA 2J4LA 2JJ4A 2BNFA 3LKKA 1E19A 4NDQB 3C1MA 4Q1TA 4NDQA 4F6TA 2A1FA 2WXBA 2JI5A 2R8VA 3EK6A 3AB2A 4A7XA 3L76A 3S6GA 2HMFA 2AP9A 2BNDA 3QVFA 2BRXA 4AXSA 1OHBA 3D40A 3QUOA 4JZ7A 2X2WA 4F6TB 2JJXA 2WE4A 3S6HA 3T7BA 4NDOB 2J0XA 4NDOA 3WWNA 2R98A 4KZTA 2WE5A 3ZZGA 2AKOA 2V5HA 1YBDA 2V4YA 3NWYA 3K52A 4NDRB 4OLCA 4NDRA 3C20A 2J5TA 3ZZIA 2BTYA 3ZZFA 2W21A 3KZFA 3AB4A 3B8GA 3EK5A 3LL9A 2BNEA 3QVHA 4JZ8A 3WWMA 2E9YA 3L86A 2J0WA 2OGXB 3K4YA 1GSJA 4NDPB 3QURA 1Z9DA 3TVIA 2OGXA 4NDPA 2BUFA 3QUNA 3C1NA 4JZ9A 3AAWA 2BMUA 2RD5A 3D2MA 3U6UA 2VA1A 2J5VA 2J4KA 4A7WA 3ZZHA 3LL5A 4I49A 3K4OA 3S6KA 3D2PA 4AB7A 1OH9A 2J4JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D41 A;  2IJ9 A;  4USJ A;  3K56 A;  2CDQ A;  2BRI A;  1GS5 A;  1B7B A;  1OHA A;  2J4L A;  2JJ4 A;  2BNF A;  3LKK A;  1E19 A;  4NDQ B;  3C1M A;  4Q1T A;  4NDQ A;  4F6T A;  2A1F A;  2WXB A;  2JI5 A;  2R8V A;  3EK6 A;  3AB2 A;  4A7X A;  3L76 A;  3S6G A;  2HMF A;  2AP9 A;  2BND A;  3QVF A;  2BRX A;  4AXS A;  1OHB A;  3D40 A;  3QUO A;  4JZ7 A;  2X2W A;  4F6T B;  2JJX A;  2WE4 A;  3S6H A;  3T7B A;  4NDO B;  2J0X A;  4NDO A;  3WWN A;  2R98 A;  4KZT A;  2WE5 A;  3ZZG A;  2AKO A;  2V5H A;  1YBD A;  2V4Y A;  3NWY A;  3K52 A;  4NDR B;  4OLC A;  4NDR A;  3C20 A;  2J5T A;  3ZZI A;  2BTY A;  3ZZF A;  2W21 A;  3KZF A;  3AB4 A;  3B8G A;  3EK5 A;  3LL9 A;  2BNE A;  3QVH A;  4JZ8 A;  3WWM A;  2E9Y A;  3L86 A;  2J0W A;  2OGX B;  3K4Y A;  1GSJ A;  4NDP B;  3QUR A;  1Z9D A;  3TVI A;  2OGX A;  4NDP A;  2BUF A;  3QUN A;  3C1N A;  4JZ9 A;  3AAW A;  2BMU A;  2RD5 A;  3D2M A;  3U6U A;  2VA1 A;  2J5V A;  2J4K A;  4A7W A;  3ZZH A;  3LL5 A;  4I49 A;  3K4O A;  3S6K A;  3D2P A;  4AB7 A;  1OH9 A;  2J4J A; 
#chains in the Genus database with same CATH topology
 3D41 A;  2IJ9 A;  4USJ A;  3K56 A;  2CDQ A;  2BRI A;  1GS5 A;  1B7B A;  1OHA A;  2J4L A;  2JJ4 A;  2BNF A;  3LKK A;  1E19 A;  4NDQ B;  3C1M A;  4Q1T A;  4NDQ A;  4F6T A;  2A1F A;  2WXB A;  2JI5 A;  2R8V A;  3EK6 A;  3AB2 A;  4A7X A;  3L76 A;  3S6G A;  2HMF A;  2AP9 A;  2BND A;  3QVF A;  2BRX A;  4AXS A;  1OHB A;  3D40 A;  3QUO A;  4JZ7 A;  2X2W A;  4F6T B;  2JJX A;  2WE4 A;  3S6H A;  3T7B A;  4NDO B;  2J0X A;  4NDO A;  3WWN A;  2R98 A;  4KZT A;  2WE5 A;  3ZZG A;  2AKO A;  2V5H A;  1YBD A;  2V4Y A;  3NWY A;  3K52 A;  4NDR B;  4OLC A;  4NDR A;  3C20 A;  2J5T A;  3ZZI A;  2BTY A;  3ZZF A;  2W21 A;  3KZF A;  3AB4 A;  3B8G A;  3EK5 A;  3LL9 A;  2BNE A;  3QVH A;  4JZ8 A;  3WWM A;  2E9Y A;  3L86 A;  2J0W A;  2OGX B;  3K4Y A;  1GSJ A;  4NDP B;  3QUR A;  1Z9D A;  3TVI A;  2OGX A;  4NDP A;  2BUF A;  3QUN A;  3C1N A;  4JZ9 A;  3AAW A;  2BMU A;  2RD5 A;  3D2M A;  3U6U A;  2VA1 A;  2J5V A;  2J4K A;  4A7W A;  3ZZH A;  3LL5 A;  4I49 A;  3K4O A;  3S6K A;  3D2P A;  4AB7 A;  1OH9 A;  2J4J A; 
#chains in the Genus database with same CATH homology
 3D41 A;  2IJ9 A;  4USJ A;  3K56 A;  2CDQ A;  2BRI A;  1GS5 A;  1B7B A;  1OHA A;  2J4L A;  2JJ4 A;  2BNF A;  3LKK A;  1E19 A;  4NDQ B;  3C1M A;  4Q1T A;  4NDQ A;  4F6T A;  2A1F A;  2WXB A;  2JI5 A;  2R8V A;  3EK6 A;  3AB2 A;  4A7X A;  3L76 A;  3S6G A;  2HMF A;  2AP9 A;  2BND A;  3QVF A;  2BRX A;  4AXS A;  1OHB A;  3D40 A;  3QUO A;  4JZ7 A;  2X2W A;  4F6T B;  2JJX A;  2WE4 A;  3S6H A;  3T7B A;  4NDO B;  2J0X A;  4NDO A;  3WWN A;  2R98 A;  4KZT A;  2WE5 A;  3ZZG A;  2AKO A;  2V5H A;  1YBD A;  2V4Y A;  3NWY A;  3K52 A;  4NDR B;  4OLC A;  4NDR A;  3C20 A;  2J5T A;  3ZZI A;  2BTY A;  3ZZF A;  2W21 A;  3KZF A;  3AB4 A;  3B8G A;  3EK5 A;  3LL9 A;  2BNE A;  3QVH A;  4JZ8 A;  3WWM A;  2E9Y A;  3L86 A;  2J0W A;  2OGX B;  3K4Y A;  1GSJ A;  4NDP B;  3QUR A;  1Z9D A;  3TVI A;  2OGX A;  4NDP A;  2BUF A;  3QUN A;  3C1N A;  4JZ9 A;  3AAW A;  2BMU A;  2RD5 A;  3D2M A;  3U6U A;  2VA1 A;  2J5V A;  2J4K A;  4A7W A;  3ZZH A;  3LL5 A;  4I49 A;  3K4O A;  3S6K A;  3D2P A;  4AB7 A;  1OH9 A;  2J4J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...