4NDOB

Crystal structure molybdenum storage protein with fully mo-loaded cavity
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
268
structure length
268
Chain Sequence
NSTAELEELLMQRSLTDPQLQAAAAAAADFRILPDATVIKIGGQSVIDRGRAAVYPLVDEIVAARKNHKLLIGTGAGTRARHLYSIAAGLGLPAGVLAQLGSSVADQNAAMLGQLLAKHGIPVVGGAGLSAVPLSLAEVNAVVFSGMPPYKLWMRPAAEGVIPPYRTDAGCFLLAEQFGCKQMIFVKDEDGLYTANPKTSKDATFIPRISVDEMKAKGLHDSILEFPVLDLLQSAQHVREVQVVNGLVPGNLTRALAGEHVGTIITAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural diversity of polyoxomolybdate clusters along the three-fold axis of the molybdenum storage protein.
pubmed doi rcsb
molecule tags Metal binding protein
molecule keywords Molybdenum storage protein subunit beta
total genus 95
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2013-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 4ndoB00
2OGXA 2J0XA 2RD5A 3LKKA 2BRIA 2BUFA 4F6TA 4OLCA 4Q1TA 2WE4A 2IJ9A 4NDRB 3WWNA 2J4KA 4F6TB 2CDQA 3NWYA 2JJXA 2J0WA 3C1NA 3L76A 3AB2A 2X2WA 2AKOA 3ZZHA 4JZ8A 2A1FA 3C1MA 4AB7A 4NDOA 1OHAA 3LL5A 3QVFA 1B7BA 3K4YA 2BRXA 2BMUA 1YBDA 4I49A 2AP9A 2E9YA 4NDOB 3K56A 3TVIA 4NDPA 2JI5A 2R8VA 3D2PA 3ZZFA 3D40A 3QUOA 2WE5A 2BTYA 4NDQB 4JZ9A 2R98A 1OHBA 4NDPB 3QVHA 3S6KA 1GSJA 3C20A 3QURA 3U6UA 1E19A 1OH9A 2J4JA 3WWMA 3EK6A 2HMFA 4JZ7A 2BNDA 3K4OA 3L86A 2J4LA 2WXBA 3D41A 4NDQA 3EK5A 3S6HA 3ZZGA 2V4YA 2BNFA 3QUNA 2J5VA 3K52A 4A7XA 1GS5A 2W21A 3B8GA 4USJA 3LL9A 2OGXB 2JJ4A 3AAWA 2BNEA 2V5HA 3T7BA 2VA1A 3ZZIA 4AXSA 4KZTA 3D2MA 3KZFA 2J5TA 4NDRA 4A7WA 3S6GA 3AB4A 1Z9DA
chains in the Genus database with same CATH superfamily
2OGXA 2J0XA 2RD5A 3LKKA 2BRIA 2BUFA 4F6TA 4OLCA 4Q1TA 2WE4A 2IJ9A 4NDRB 3WWNA 2J4KA 4F6TB 2CDQA 3NWYA 2JJXA 2J0WA 3C1NA 3L76A 3AB2A 2X2WA 2AKOA 3ZZHA 4JZ8A 2A1FA 3C1MA 4AB7A 4NDOA 1OHAA 3LL5A 3QVFA 1B7BA 3K4YA 2BRXA 2BMUA 1YBDA 4I49A 2AP9A 2E9YA 4NDOB 3K56A 3TVIA 4NDPA 2JI5A 2R8VA 3D2PA 3ZZFA 3D40A 3QUOA 2WE5A 2BTYA 4NDQB 4JZ9A 2R98A 1OHBA 4NDPB 3QVHA 3S6KA 1GSJA 3C20A 3QURA 3U6UA 1E19A 1OH9A 2J4JA 3WWMA 3EK6A 2HMFA 4JZ7A 2BNDA 3K4OA 3L86A 2J4LA 2WXBA 3D41A 4NDQA 3EK5A 3S6HA 3ZZGA 2V4YA 2BNFA 3QUNA 2J5VA 3K52A 4A7XA 1GS5A 2W21A 3B8GA 4USJA 3LL9A 2OGXB 2JJ4A 3AAWA 2BNEA 2V5HA 3T7BA 2VA1A 3ZZIA 4AXSA 4KZTA 3D2MA 3KZFA 2J5TA 4NDRA 4A7WA 3S6GA 3AB4A 1Z9DA
chains in the Genus database with same CATH topology
2OGXA 2J0XA 2RD5A 3LKKA 2BRIA 2BUFA 4F6TA 4OLCA 4Q1TA 2WE4A 2IJ9A 4NDRB 3WWNA 2J4KA 4F6TB 2CDQA 3NWYA 2JJXA 2J0WA 3C1NA 3L76A 3AB2A 2X2WA 2AKOA 3ZZHA 4JZ8A 2A1FA 3C1MA 4AB7A 4NDOA 1OHAA 3LL5A 3QVFA 1B7BA 3K4YA 2BRXA 2BMUA 1YBDA 4I49A 2AP9A 2E9YA 4NDOB 3K56A 3TVIA 4NDPA 2JI5A 2R8VA 3D2PA 3ZZFA 3D40A 3QUOA 2WE5A 2BTYA 4NDQB 4JZ9A 2R98A 1OHBA 4NDPB 3QVHA 3S6KA 1GSJA 3C20A 3QURA 3U6UA 1E19A 1OH9A 2J4JA 3WWMA 3EK6A 2HMFA 4JZ7A 2BNDA 3K4OA 3L86A 2J4LA 2WXBA 3D41A 4NDQA 3EK5A 3S6HA 3ZZGA 2V4YA 2BNFA 3QUNA 2J5VA 3K52A 4A7XA 1GS5A 2W21A 3B8GA 4USJA 3LL9A 2OGXB 2JJ4A 3AAWA 2BNEA 2V5HA 3T7BA 2VA1A 3ZZIA 4AXSA 4KZTA 3D2MA 3KZFA 2J5TA 4NDRA 4A7WA 3S6GA 3AB4A 1Z9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OGX A;  2J0X A;  2RD5 A;  3LKK A;  2BRI A;  2BUF A;  4F6T A;  4OLC A;  4Q1T A;  2WE4 A;  2IJ9 A;  4NDR B;  3WWN A;  2J4K A;  4F6T B;  2CDQ A;  3NWY A;  2JJX A;  2J0W A;  3C1N A;  3L76 A;  3AB2 A;  2X2W A;  2AKO A;  3ZZH A;  4JZ8 A;  2A1F A;  3C1M A;  4AB7 A;  4NDO A;  1OHA A;  3LL5 A;  3QVF A;  1B7B A;  3K4Y A;  2BRX A;  2BMU A;  1YBD A;  4I49 A;  2AP9 A;  2E9Y A;  4NDO B;  3K56 A;  3TVI A;  4NDP A;  2JI5 A;  2R8V A;  3D2P A;  3ZZF A;  3D40 A;  3QUO A;  2WE5 A;  2BTY A;  4NDQ B;  4JZ9 A;  2R98 A;  1OHB A;  4NDP B;  3QVH A;  3S6K A;  1GSJ A;  3C20 A;  3QUR A;  3U6U A;  1E19 A;  1OH9 A;  2J4J A;  3WWM A;  3EK6 A;  2HMF A;  4JZ7 A;  2BND A;  3K4O A;  3L86 A;  2J4L A;  2WXB A;  3D41 A;  4NDQ A;  3EK5 A;  3S6H A;  3ZZG A;  2V4Y A;  2BNF A;  3QUN A;  2J5V A;  3K52 A;  4A7X A;  1GS5 A;  2W21 A;  3B8G A;  4USJ A;  3LL9 A;  2OGX B;  2JJ4 A;  3AAW A;  2BNE A;  2V5H A;  3T7B A;  2VA1 A;  3ZZI A;  4AXS A;  4KZT A;  3D2M A;  3KZF A;  2J5T A;  4NDR A;  4A7W A;  3S6G A;  3AB4 A;  1Z9D A; 
#chains in the Genus database with same CATH topology
 2OGX A;  2J0X A;  2RD5 A;  3LKK A;  2BRI A;  2BUF A;  4F6T A;  4OLC A;  4Q1T A;  2WE4 A;  2IJ9 A;  4NDR B;  3WWN A;  2J4K A;  4F6T B;  2CDQ A;  3NWY A;  2JJX A;  2J0W A;  3C1N A;  3L76 A;  3AB2 A;  2X2W A;  2AKO A;  3ZZH A;  4JZ8 A;  2A1F A;  3C1M A;  4AB7 A;  4NDO A;  1OHA A;  3LL5 A;  3QVF A;  1B7B A;  3K4Y A;  2BRX A;  2BMU A;  1YBD A;  4I49 A;  2AP9 A;  2E9Y A;  4NDO B;  3K56 A;  3TVI A;  4NDP A;  2JI5 A;  2R8V A;  3D2P A;  3ZZF A;  3D40 A;  3QUO A;  2WE5 A;  2BTY A;  4NDQ B;  4JZ9 A;  2R98 A;  1OHB A;  4NDP B;  3QVH A;  3S6K A;  1GSJ A;  3C20 A;  3QUR A;  3U6U A;  1E19 A;  1OH9 A;  2J4J A;  3WWM A;  3EK6 A;  2HMF A;  4JZ7 A;  2BND A;  3K4O A;  3L86 A;  2J4L A;  2WXB A;  3D41 A;  4NDQ A;  3EK5 A;  3S6H A;  3ZZG A;  2V4Y A;  2BNF A;  3QUN A;  2J5V A;  3K52 A;  4A7X A;  1GS5 A;  2W21 A;  3B8G A;  4USJ A;  3LL9 A;  2OGX B;  2JJ4 A;  3AAW A;  2BNE A;  2V5H A;  3T7B A;  2VA1 A;  3ZZI A;  4AXS A;  4KZT A;  3D2M A;  3KZF A;  2J5T A;  4NDR A;  4A7W A;  3S6G A;  3AB4 A;  1Z9D A; 
#chains in the Genus database with same CATH homology
 2OGX A;  2J0X A;  2RD5 A;  3LKK A;  2BRI A;  2BUF A;  4F6T A;  4OLC A;  4Q1T A;  2WE4 A;  2IJ9 A;  4NDR B;  3WWN A;  2J4K A;  4F6T B;  2CDQ A;  3NWY A;  2JJX A;  2J0W A;  3C1N A;  3L76 A;  3AB2 A;  2X2W A;  2AKO A;  3ZZH A;  4JZ8 A;  2A1F A;  3C1M A;  4AB7 A;  4NDO A;  1OHA A;  3LL5 A;  3QVF A;  1B7B A;  3K4Y A;  2BRX A;  2BMU A;  1YBD A;  4I49 A;  2AP9 A;  2E9Y A;  4NDO B;  3K56 A;  3TVI A;  4NDP A;  2JI5 A;  2R8V A;  3D2P A;  3ZZF A;  3D40 A;  3QUO A;  2WE5 A;  2BTY A;  4NDQ B;  4JZ9 A;  2R98 A;  1OHB A;  4NDP B;  3QVH A;  3S6K A;  1GSJ A;  3C20 A;  3QUR A;  3U6U A;  1E19 A;  1OH9 A;  2J4J A;  3WWM A;  3EK6 A;  2HMF A;  4JZ7 A;  2BND A;  3K4O A;  3L86 A;  2J4L A;  2WXB A;  3D41 A;  4NDQ A;  3EK5 A;  3S6H A;  3ZZG A;  2V4Y A;  2BNF A;  3QUN A;  2J5V A;  3K52 A;  4A7X A;  1GS5 A;  2W21 A;  3B8G A;  4USJ A;  3LL9 A;  2OGX B;  2JJ4 A;  3AAW A;  2BNE A;  2V5H A;  3T7B A;  2VA1 A;  3ZZI A;  4AXS A;  4KZT A;  3D2M A;  3KZF A;  2J5T A;  4NDR A;  4A7W A;  3S6G A;  3AB4 A;  1Z9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...