4NDOB

Crystal structure molybdenum storage protein with fully mo-loaded cavity
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
268
structure length
268
Chain Sequence
NSTAELEELLMQRSLTDPQLQAAAAAAADFRILPDATVIKIGGQSVIDRGRAAVYPLVDEIVAARKNHKLLIGTGAGTRARHLYSIAAGLGLPAGVLAQLGSSVADQNAAMLGQLLAKHGIPVVGGAGLSAVPLSLAEVNAVVFSGMPPYKLWMRPAAEGVIPPYRTDAGCFLLAEQFGCKQMIFVKDEDGLYTANPKTSKDATFIPRISVDEMKAKGLHDSILEFPVLDLLQSAQHVREVQVVNGLVPGNLTRALAGEHVGTIITAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdenum storage protein subunit beta
publication title Structural diversity of polyoxomolybdate clusters along the three-fold axis of the molybdenum storage protein.
pubmed doi rcsb
molecule tags Metal binding protein
total genus 95
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2013-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 4ndoB00
3QUNA 2W21A 3K52A 2BNFA 3NWYA 4KZTA 3S6GA 3L76A 4NDOB 4A7XA 4NDRA 2BRIA 3WWMA 1E19A 4F6TB 2J0WA 2R8VA 2RD5A 4I49A 2J4LA 3ZZFA 1OHAA 4NDQA 2BRXA 2OGXB 4A7WA 3S6HA 1GSJA 3AAWA 2R98A 2X2WA 3ZZHA 2A1FA 4NDRB 3WWNA 2J0XA 3EK6A 3ZZIA 3QUOA 3D2MA 3C20A 1GS5A 4NDPA 2VA1A 4USJA 2J5VA 3D40A 3QVHA 2IJ9A 3T7BA 4NDQB 3S6KA 3LKKA 3TVIA 3K4OA 2J5TA 2BUFA 4Q1TA 3EK5A 4JZ7A 2JJXA 2WE5A 1B7BA 1OH9A 2J4JA 3C1MA 3AB4A 1OHBA 4NDPB 3LL5A 3D2PA 3K4YA 4F6TA 3LL9A 3ZZGA 4JZ8A 3L86A 4AXSA 2E9YA 2WE4A 2JI5A 2AKOA 2OGXA 2AP9A 4JZ9A 2V5HA 2CDQA 2WXBA 3B8GA 2HMFA 4NDOA 2BNDA 4AB7A 2JJ4A 3C1NA 3U6UA 4OLCA 3QURA 3QVFA 3AB2A 3D41A 2BMUA 1Z9DA 3KZFA 3K56A 2V4YA 1YBDA 2BTYA 2BNEA 2J4KA
chains in the Genus database with same CATH superfamily
3QUNA 2W21A 3K52A 2BNFA 3NWYA 4KZTA 3S6GA 3L76A 4NDOB 4A7XA 4NDRA 2BRIA 3WWMA 1E19A 4F6TB 2J0WA 2R8VA 2RD5A 4I49A 2J4LA 3ZZFA 1OHAA 4NDQA 2BRXA 2OGXB 4A7WA 3S6HA 1GSJA 3AAWA 2R98A 2X2WA 3ZZHA 2A1FA 4NDRB 3WWNA 2J0XA 3EK6A 3ZZIA 3QUOA 3D2MA 3C20A 1GS5A 4NDPA 2VA1A 4USJA 2J5VA 3D40A 3QVHA 2IJ9A 3T7BA 4NDQB 3S6KA 3LKKA 3TVIA 3K4OA 2J5TA 2BUFA 4Q1TA 3EK5A 4JZ7A 2JJXA 2WE5A 1B7BA 1OH9A 2J4JA 3C1MA 3AB4A 1OHBA 4NDPB 3LL5A 3D2PA 3K4YA 4F6TA 3LL9A 3ZZGA 4JZ8A 3L86A 4AXSA 2E9YA 2WE4A 2JI5A 2AKOA 2OGXA 2AP9A 4JZ9A 2V5HA 2CDQA 2WXBA 3B8GA 2HMFA 4NDOA 2BNDA 4AB7A 2JJ4A 3C1NA 3U6UA 4OLCA 3QURA 3QVFA 3AB2A 3D41A 2BMUA 1Z9DA 3KZFA 3K56A 2V4YA 1YBDA 2BTYA 2BNEA 2J4KA
chains in the Genus database with same CATH topology
3QUNA 2W21A 3K52A 2BNFA 3NWYA 4KZTA 3S6GA 3L76A 4NDOB 4A7XA 4NDRA 2BRIA 3WWMA 1E19A 4F6TB 2J0WA 2R8VA 2RD5A 4I49A 2J4LA 3ZZFA 1OHAA 4NDQA 2BRXA 2OGXB 4A7WA 3S6HA 1GSJA 3AAWA 2R98A 2X2WA 3ZZHA 2A1FA 4NDRB 3WWNA 2J0XA 3EK6A 3ZZIA 3QUOA 3D2MA 3C20A 1GS5A 4NDPA 2VA1A 4USJA 2J5VA 3D40A 3QVHA 2IJ9A 3T7BA 4NDQB 3S6KA 3LKKA 3TVIA 3K4OA 2J5TA 2BUFA 4Q1TA 3EK5A 4JZ7A 2JJXA 2WE5A 1B7BA 1OH9A 2J4JA 3C1MA 3AB4A 1OHBA 4NDPB 3LL5A 3D2PA 3K4YA 4F6TA 3LL9A 3ZZGA 4JZ8A 3L86A 4AXSA 2E9YA 2WE4A 2JI5A 2AKOA 2OGXA 2AP9A 4JZ9A 2V5HA 2CDQA 2WXBA 3B8GA 2HMFA 4NDOA 2BNDA 4AB7A 2JJ4A 3C1NA 3U6UA 4OLCA 3QURA 3QVFA 3AB2A 3D41A 2BMUA 1Z9DA 3KZFA 3K56A 2V4YA 1YBDA 2BTYA 2BNEA 2J4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QUN A;  2W21 A;  3K52 A;  2BNF A;  3NWY A;  4KZT A;  3S6G A;  3L76 A;  4NDO B;  4A7X A;  4NDR A;  2BRI A;  3WWM A;  1E19 A;  4F6T B;  2J0W A;  2R8V A;  2RD5 A;  4I49 A;  2J4L A;  3ZZF A;  1OHA A;  4NDQ A;  2BRX A;  2OGX B;  4A7W A;  3S6H A;  1GSJ A;  3AAW A;  2R98 A;  2X2W A;  3ZZH A;  2A1F A;  4NDR B;  3WWN A;  2J0X A;  3EK6 A;  3ZZI A;  3QUO A;  3D2M A;  3C20 A;  1GS5 A;  4NDP A;  2VA1 A;  4USJ A;  2J5V A;  3D40 A;  3QVH A;  2IJ9 A;  3T7B A;  4NDQ B;  3S6K A;  3LKK A;  3TVI A;  3K4O A;  2J5T A;  2BUF A;  4Q1T A;  3EK5 A;  4JZ7 A;  2JJX A;  2WE5 A;  1B7B A;  1OH9 A;  2J4J A;  3C1M A;  3AB4 A;  1OHB A;  4NDP B;  3LL5 A;  3D2P A;  3K4Y A;  4F6T A;  3LL9 A;  3ZZG A;  4JZ8 A;  3L86 A;  4AXS A;  2E9Y A;  2WE4 A;  2JI5 A;  2AKO A;  2OGX A;  2AP9 A;  4JZ9 A;  2V5H A;  2CDQ A;  2WXB A;  3B8G A;  2HMF A;  4NDO A;  2BND A;  4AB7 A;  2JJ4 A;  3C1N A;  3U6U A;  4OLC A;  3QUR A;  3QVF A;  3AB2 A;  3D41 A;  2BMU A;  1Z9D A;  3KZF A;  3K56 A;  2V4Y A;  1YBD A;  2BTY A;  2BNE A;  2J4K A; 
#chains in the Genus database with same CATH topology
 3QUN A;  2W21 A;  3K52 A;  2BNF A;  3NWY A;  4KZT A;  3S6G A;  3L76 A;  4NDO B;  4A7X A;  4NDR A;  2BRI A;  3WWM A;  1E19 A;  4F6T B;  2J0W A;  2R8V A;  2RD5 A;  4I49 A;  2J4L A;  3ZZF A;  1OHA A;  4NDQ A;  2BRX A;  2OGX B;  4A7W A;  3S6H A;  1GSJ A;  3AAW A;  2R98 A;  2X2W A;  3ZZH A;  2A1F A;  4NDR B;  3WWN A;  2J0X A;  3EK6 A;  3ZZI A;  3QUO A;  3D2M A;  3C20 A;  1GS5 A;  4NDP A;  2VA1 A;  4USJ A;  2J5V A;  3D40 A;  3QVH A;  2IJ9 A;  3T7B A;  4NDQ B;  3S6K A;  3LKK A;  3TVI A;  3K4O A;  2J5T A;  2BUF A;  4Q1T A;  3EK5 A;  4JZ7 A;  2JJX A;  2WE5 A;  1B7B A;  1OH9 A;  2J4J A;  3C1M A;  3AB4 A;  1OHB A;  4NDP B;  3LL5 A;  3D2P A;  3K4Y A;  4F6T A;  3LL9 A;  3ZZG A;  4JZ8 A;  3L86 A;  4AXS A;  2E9Y A;  2WE4 A;  2JI5 A;  2AKO A;  2OGX A;  2AP9 A;  4JZ9 A;  2V5H A;  2CDQ A;  2WXB A;  3B8G A;  2HMF A;  4NDO A;  2BND A;  4AB7 A;  2JJ4 A;  3C1N A;  3U6U A;  4OLC A;  3QUR A;  3QVF A;  3AB2 A;  3D41 A;  2BMU A;  1Z9D A;  3KZF A;  3K56 A;  2V4Y A;  1YBD A;  2BTY A;  2BNE A;  2J4K A; 
#chains in the Genus database with same CATH homology
 3QUN A;  2W21 A;  3K52 A;  2BNF A;  3NWY A;  4KZT A;  3S6G A;  3L76 A;  4NDO B;  4A7X A;  4NDR A;  2BRI A;  3WWM A;  1E19 A;  4F6T B;  2J0W A;  2R8V A;  2RD5 A;  4I49 A;  2J4L A;  3ZZF A;  1OHA A;  4NDQ A;  2BRX A;  2OGX B;  4A7W A;  3S6H A;  1GSJ A;  3AAW A;  2R98 A;  2X2W A;  3ZZH A;  2A1F A;  4NDR B;  3WWN A;  2J0X A;  3EK6 A;  3ZZI A;  3QUO A;  3D2M A;  3C20 A;  1GS5 A;  4NDP A;  2VA1 A;  4USJ A;  2J5V A;  3D40 A;  3QVH A;  2IJ9 A;  3T7B A;  4NDQ B;  3S6K A;  3LKK A;  3TVI A;  3K4O A;  2J5T A;  2BUF A;  4Q1T A;  3EK5 A;  4JZ7 A;  2JJX A;  2WE5 A;  1B7B A;  1OH9 A;  2J4J A;  3C1M A;  3AB4 A;  1OHB A;  4NDP B;  3LL5 A;  3D2P A;  3K4Y A;  4F6T A;  3LL9 A;  3ZZG A;  4JZ8 A;  3L86 A;  4AXS A;  2E9Y A;  2WE4 A;  2JI5 A;  2AKO A;  2OGX A;  2AP9 A;  4JZ9 A;  2V5H A;  2CDQ A;  2WXB A;  3B8G A;  2HMF A;  4NDO A;  2BND A;  4AB7 A;  2JJ4 A;  3C1N A;  3U6U A;  4OLC A;  3QUR A;  3QVF A;  3AB2 A;  3D41 A;  2BMU A;  1Z9D A;  3KZF A;  3K56 A;  2V4Y A;  1YBD A;  2BTY A;  2BNE A;  2J4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...