4NDPB

Crystal structure molybdenum storage protein with fully mo-loaded cavity
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
268
structure length
268
Chain Sequence
NSTAELEELLMQRSLTDPQLQAAAAAAADFRILPDATVIKIGGQSVIDRGRAAVYPLVDEIVAARKNHKLLIGTGAGTRARHLYSIAAGLGLPAGVLAQLGSSVADQNAAMLGQLLAKHGIPVVGGAGLSAVPLSLAEVNAVVFSGMPPYKLWMRPAAEGVIPPYRTDAGCFLLAEQFGCKQMIFVKDEDGLYTANPKTSKDATFIPRISVDEMKAKGLHDSILEFPVLDLLQSAQHVREVQVVNGLVPGNLTRALAGEHVGTIITAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural diversity of polyoxomolybdate clusters along the three-fold axis of the molybdenum storage protein.
pubmed doi rcsb
molecule keywords Molybdenum storage protein subunit beta
molecule tags Metal binding protein
total genus 92
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2013-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 4ndpB00
2WXBA 1OHBA 3L76A 4USJA 3D2PA 2X2WA 4AB7A 4A7XA 3S6GA 3QVFA 4NDRB 3LL5A 3QUOA 3EK5A 2WE5A 4JZ8A 3QVHA 4NDPA 4A7WA 4KZTA 2E9YA 2IJ9A 3S6KA 3C20A 3K4OA 3KZFA 4AXSA 2R8VA 2AKOA 2J5TA 3LKKA 3ZZGA 2J4JA 3LL9A 2J0WA 3AB4A 4NDPB 3B8GA 2BMUA 2WE4A 2J0XA 3WWMA 2JJXA 2BNFA 2BRIA 2OGXA 3TVIA 3S6HA 2BNEA 4F6TA 3C1MA 2HMFA 3ZZHA 2BTYA 3D2MA 2OGXB 4NDOA 3AAWA 2J4LA 4F6TB 2RD5A 3AB2A 1E19A 3D40A 4NDQA 2A1FA 1GS5A 3K56A 3ZZFA 4NDOB 4OLCA 2J4KA 3ZZIA 4Q1TA 2V5HA 4JZ9A 2BUFA 2CDQA 3D41A 2R98A 2JJ4A 4NDQB 3T7BA 2J5VA 3U6UA 3K52A 3WWNA 2V4YA 3NWYA 1GSJA 2AP9A 3QURA 3C1NA 3QUNA 3EK6A 1YBDA 2W21A 2VA1A 1OH9A 2BNDA 3K4YA 2BRXA 2JI5A 4JZ7A 1Z9DA 1B7BA 4NDRA 4I49A 1OHAA 3L86A
chains in the Genus database with same CATH superfamily
2WXBA 1OHBA 3L76A 4USJA 3D2PA 2X2WA 4AB7A 4A7XA 3S6GA 3QVFA 4NDRB 3LL5A 3QUOA 3EK5A 2WE5A 4JZ8A 3QVHA 4NDPA 4A7WA 4KZTA 2E9YA 2IJ9A 3S6KA 3C20A 3K4OA 3KZFA 4AXSA 2R8VA 2AKOA 2J5TA 3LKKA 3ZZGA 2J4JA 3LL9A 2J0WA 3AB4A 4NDPB 3B8GA 2BMUA 2WE4A 2J0XA 3WWMA 2JJXA 2BNFA 2BRIA 2OGXA 3TVIA 3S6HA 2BNEA 4F6TA 3C1MA 2HMFA 3ZZHA 2BTYA 3D2MA 2OGXB 4NDOA 3AAWA 2J4LA 4F6TB 2RD5A 3AB2A 1E19A 3D40A 4NDQA 2A1FA 1GS5A 3K56A 3ZZFA 4NDOB 4OLCA 2J4KA 3ZZIA 4Q1TA 2V5HA 4JZ9A 2BUFA 2CDQA 3D41A 2R98A 2JJ4A 4NDQB 3T7BA 2J5VA 3U6UA 3K52A 3WWNA 2V4YA 3NWYA 1GSJA 2AP9A 3QURA 3C1NA 3QUNA 3EK6A 1YBDA 2W21A 2VA1A 1OH9A 2BNDA 3K4YA 2BRXA 2JI5A 4JZ7A 1Z9DA 1B7BA 4NDRA 4I49A 1OHAA 3L86A
chains in the Genus database with same CATH topology
2WXBA 1OHBA 3L76A 4USJA 3D2PA 2X2WA 4AB7A 4A7XA 3S6GA 3QVFA 4NDRB 3LL5A 3QUOA 3EK5A 2WE5A 4JZ8A 3QVHA 4NDPA 4A7WA 4KZTA 2E9YA 2IJ9A 3S6KA 3C20A 3K4OA 3KZFA 4AXSA 2R8VA 2AKOA 2J5TA 3LKKA 3ZZGA 2J4JA 3LL9A 2J0WA 3AB4A 4NDPB 3B8GA 2BMUA 2WE4A 2J0XA 3WWMA 2JJXA 2BNFA 2BRIA 2OGXA 3TVIA 3S6HA 2BNEA 4F6TA 3C1MA 2HMFA 3ZZHA 2BTYA 3D2MA 2OGXB 4NDOA 3AAWA 2J4LA 4F6TB 2RD5A 3AB2A 1E19A 3D40A 4NDQA 2A1FA 1GS5A 3K56A 3ZZFA 4NDOB 4OLCA 2J4KA 3ZZIA 4Q1TA 2V5HA 4JZ9A 2BUFA 2CDQA 3D41A 2R98A 2JJ4A 4NDQB 3T7BA 2J5VA 3U6UA 3K52A 3WWNA 2V4YA 3NWYA 1GSJA 2AP9A 3QURA 3C1NA 3QUNA 3EK6A 1YBDA 2W21A 2VA1A 1OH9A 2BNDA 3K4YA 2BRXA 2JI5A 4JZ7A 1Z9DA 1B7BA 4NDRA 4I49A 1OHAA 3L86A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WXB A;  1OHB A;  3L76 A;  4USJ A;  3D2P A;  2X2W A;  4AB7 A;  4A7X A;  3S6G A;  3QVF A;  4NDR B;  3LL5 A;  3QUO A;  3EK5 A;  2WE5 A;  4JZ8 A;  3QVH A;  4NDP A;  4A7W A;  4KZT A;  2E9Y A;  2IJ9 A;  3S6K A;  3C20 A;  3K4O A;  3KZF A;  4AXS A;  2R8V A;  2AKO A;  2J5T A;  3LKK A;  3ZZG A;  2J4J A;  3LL9 A;  2J0W A;  3AB4 A;  4NDP B;  3B8G A;  2BMU A;  2WE4 A;  2J0X A;  3WWM A;  2JJX A;  2BNF A;  2BRI A;  2OGX A;  3TVI A;  3S6H A;  2BNE A;  4F6T A;  3C1M A;  2HMF A;  3ZZH A;  2BTY A;  3D2M A;  2OGX B;  4NDO A;  3AAW A;  2J4L A;  4F6T B;  2RD5 A;  3AB2 A;  1E19 A;  3D40 A;  4NDQ A;  2A1F A;  1GS5 A;  3K56 A;  3ZZF A;  4NDO B;  4OLC A;  2J4K A;  3ZZI A;  4Q1T A;  2V5H A;  4JZ9 A;  2BUF A;  2CDQ A;  3D41 A;  2R98 A;  2JJ4 A;  4NDQ B;  3T7B A;  2J5V A;  3U6U A;  3K52 A;  3WWN A;  2V4Y A;  3NWY A;  1GSJ A;  2AP9 A;  3QUR A;  3C1N A;  3QUN A;  3EK6 A;  1YBD A;  2W21 A;  2VA1 A;  1OH9 A;  2BND A;  3K4Y A;  2BRX A;  2JI5 A;  4JZ7 A;  1Z9D A;  1B7B A;  4NDR A;  4I49 A;  1OHA A;  3L86 A; 
#chains in the Genus database with same CATH topology
 2WXB A;  1OHB A;  3L76 A;  4USJ A;  3D2P A;  2X2W A;  4AB7 A;  4A7X A;  3S6G A;  3QVF A;  4NDR B;  3LL5 A;  3QUO A;  3EK5 A;  2WE5 A;  4JZ8 A;  3QVH A;  4NDP A;  4A7W A;  4KZT A;  2E9Y A;  2IJ9 A;  3S6K A;  3C20 A;  3K4O A;  3KZF A;  4AXS A;  2R8V A;  2AKO A;  2J5T A;  3LKK A;  3ZZG A;  2J4J A;  3LL9 A;  2J0W A;  3AB4 A;  4NDP B;  3B8G A;  2BMU A;  2WE4 A;  2J0X A;  3WWM A;  2JJX A;  2BNF A;  2BRI A;  2OGX A;  3TVI A;  3S6H A;  2BNE A;  4F6T A;  3C1M A;  2HMF A;  3ZZH A;  2BTY A;  3D2M A;  2OGX B;  4NDO A;  3AAW A;  2J4L A;  4F6T B;  2RD5 A;  3AB2 A;  1E19 A;  3D40 A;  4NDQ A;  2A1F A;  1GS5 A;  3K56 A;  3ZZF A;  4NDO B;  4OLC A;  2J4K A;  3ZZI A;  4Q1T A;  2V5H A;  4JZ9 A;  2BUF A;  2CDQ A;  3D41 A;  2R98 A;  2JJ4 A;  4NDQ B;  3T7B A;  2J5V A;  3U6U A;  3K52 A;  3WWN A;  2V4Y A;  3NWY A;  1GSJ A;  2AP9 A;  3QUR A;  3C1N A;  3QUN A;  3EK6 A;  1YBD A;  2W21 A;  2VA1 A;  1OH9 A;  2BND A;  3K4Y A;  2BRX A;  2JI5 A;  4JZ7 A;  1Z9D A;  1B7B A;  4NDR A;  4I49 A;  1OHA A;  3L86 A; 
#chains in the Genus database with same CATH homology
 2WXB A;  1OHB A;  3L76 A;  4USJ A;  3D2P A;  2X2W A;  4AB7 A;  4A7X A;  3S6G A;  3QVF A;  4NDR B;  3LL5 A;  3QUO A;  3EK5 A;  2WE5 A;  4JZ8 A;  3QVH A;  4NDP A;  4A7W A;  4KZT A;  2E9Y A;  2IJ9 A;  3S6K A;  3C20 A;  3K4O A;  3KZF A;  4AXS A;  2R8V A;  2AKO A;  2J5T A;  3LKK A;  3ZZG A;  2J4J A;  3LL9 A;  2J0W A;  3AB4 A;  4NDP B;  3B8G A;  2BMU A;  2WE4 A;  2J0X A;  3WWM A;  2JJX A;  2BNF A;  2BRI A;  2OGX A;  3TVI A;  3S6H A;  2BNE A;  4F6T A;  3C1M A;  2HMF A;  3ZZH A;  2BTY A;  3D2M A;  2OGX B;  4NDO A;  3AAW A;  2J4L A;  4F6T B;  2RD5 A;  3AB2 A;  1E19 A;  3D40 A;  4NDQ A;  2A1F A;  1GS5 A;  3K56 A;  3ZZF A;  4NDO B;  4OLC A;  2J4K A;  3ZZI A;  4Q1T A;  2V5H A;  4JZ9 A;  2BUF A;  2CDQ A;  3D41 A;  2R98 A;  2JJ4 A;  4NDQ B;  3T7B A;  2J5V A;  3U6U A;  3K52 A;  3WWN A;  2V4Y A;  3NWY A;  1GSJ A;  2AP9 A;  3QUR A;  3C1N A;  3QUN A;  3EK6 A;  1YBD A;  2W21 A;  2VA1 A;  1OH9 A;  2BND A;  3K4Y A;  2BRX A;  2JI5 A;  4JZ7 A;  1Z9D A;  1B7B A;  4NDR A;  4I49 A;  1OHA A;  3L86 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...