4NDPB

Crystal structure molybdenum storage protein with fully mo-loaded cavity
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
268
structure length
268
Chain Sequence
b'NSTAELEELLMQRSLTDPQLQAAAAAAADFRILPDATVIKIGGQSVIDRGRAAVYPLVDEIVAARKNHKLLIGTGAGTRARHLYSIAAGLGLPAGVLAQLGSSVADQNAAMLGQLLAKHGIPVVGGAGLSAVPLSLAEVNAVVFSGMPPYKLWMRPAAEGVIPPYRTDAGCFLLAEQFGCKQMIFVKDEDGLYTANPKTSKDATFIPRISVDEMKAKGLHDSILEFPVLDLLQSAQHVREVQVVNGLVPGNLTRALAGEHVGTIITAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdenum storage protein subunit beta
publication title Structural diversity of polyoxomolybdate clusters along the three-fold axis of the molybdenum storage protein.
pubmed doi rcsb
molecule tags Metal binding protein
total genus 92
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2013-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 4ndpB00
2WE4A 4Q1TA 2JJ4A 2BNFA 4I49A 1OHAA 4JZ9A 3S6GA 2J0XA 3ZZIA 3C1MA 3QUOA 4F6TB 3D40A 4NDRB 4NDOB 3D2MA 2BUFA 1OH9A 4F6TA 2WE5A 3K4YA 3ZZFA 4JZ8A 4NDOA 2BNDA 4JZ7A 3U6UA 2RD5A 1GS5A 1GSJA 4AXSA 3C20A 4NDPB 2R8VA 2BMUA 2AP9A 2V5HA 4A7XA 3ZZGA 1OHBA 4NDPA 3D41A 2OGXA 2BRXA 3B8GA 3LL5A 1E19A 4AB7A 3TVIA 2IJ9A 2CDQA 3LL9A 3EK6A 2BRIA 3QURA 3C1NA 2R98A 2J5VA 2JJXA 3QVFA 2OGXB 2W21A 2WXBA 3D2PA 3WWMA 3QVHA 2VA1A 2JI5A 3LKKA 3AB2A 2E9YA 4NDQA 3K52A 2BNEA 2AKOA 3L86A 3S6KA 3S6HA 3T7BA 2BTYA 3ZZHA 1Z9DA 2X2WA 2J0WA 4KZTA 3QUNA 3AB4A 4OLCA 3NWYA 3L76A 2A1FA 1YBDA 2J4LA 2J5TA 3WWNA 4NDQB 3K4OA 3AAWA 3EK5A 4A7WA 2J4KA 2HMFA 4NDRA 2J4JA 3K56A 4USJA 2V4YA 3KZFA 1B7BA
chains in the Genus database with same CATH superfamily
2WE4A 4Q1TA 2JJ4A 2BNFA 4I49A 1OHAA 4JZ9A 3S6GA 2J0XA 3ZZIA 3C1MA 3QUOA 4F6TB 3D40A 4NDRB 4NDOB 3D2MA 2BUFA 1OH9A 4F6TA 2WE5A 3K4YA 3ZZFA 4JZ8A 4NDOA 2BNDA 4JZ7A 3U6UA 2RD5A 1GS5A 1GSJA 4AXSA 3C20A 4NDPB 2R8VA 2BMUA 2AP9A 2V5HA 4A7XA 3ZZGA 1OHBA 4NDPA 3D41A 2OGXA 2BRXA 3B8GA 3LL5A 1E19A 4AB7A 3TVIA 2IJ9A 2CDQA 3LL9A 3EK6A 2BRIA 3QURA 3C1NA 2R98A 2J5VA 2JJXA 3QVFA 2OGXB 2W21A 2WXBA 3D2PA 3WWMA 3QVHA 2VA1A 2JI5A 3LKKA 3AB2A 2E9YA 4NDQA 3K52A 2BNEA 2AKOA 3L86A 3S6KA 3S6HA 3T7BA 2BTYA 3ZZHA 1Z9DA 2X2WA 2J0WA 4KZTA 3QUNA 3AB4A 4OLCA 3NWYA 3L76A 2A1FA 1YBDA 2J4LA 2J5TA 3WWNA 4NDQB 3K4OA 3AAWA 3EK5A 4A7WA 2J4KA 2HMFA 4NDRA 2J4JA 3K56A 4USJA 2V4YA 3KZFA 1B7BA
chains in the Genus database with same CATH topology
2WE4A 4Q1TA 2JJ4A 2BNFA 4I49A 1OHAA 4JZ9A 3S6GA 2J0XA 3ZZIA 3C1MA 3QUOA 4F6TB 3D40A 4NDRB 4NDOB 3D2MA 2BUFA 1OH9A 4F6TA 2WE5A 3K4YA 3ZZFA 4JZ8A 4NDOA 2BNDA 4JZ7A 3U6UA 2RD5A 1GS5A 1GSJA 4AXSA 3C20A 4NDPB 2R8VA 2BMUA 2AP9A 2V5HA 4A7XA 3ZZGA 1OHBA 4NDPA 3D41A 2OGXA 2BRXA 3B8GA 3LL5A 1E19A 4AB7A 3TVIA 2IJ9A 2CDQA 3LL9A 3EK6A 2BRIA 3QURA 3C1NA 2R98A 2J5VA 2JJXA 3QVFA 2OGXB 2W21A 2WXBA 3D2PA 3WWMA 3QVHA 2VA1A 2JI5A 3LKKA 3AB2A 2E9YA 4NDQA 3K52A 2BNEA 2AKOA 3L86A 3S6KA 3S6HA 3T7BA 2BTYA 3ZZHA 1Z9DA 2X2WA 2J0WA 4KZTA 3QUNA 3AB4A 4OLCA 3NWYA 3L76A 2A1FA 1YBDA 2J4LA 2J5TA 3WWNA 4NDQB 3K4OA 3AAWA 3EK5A 4A7WA 2J4KA 2HMFA 4NDRA 2J4JA 3K56A 4USJA 2V4YA 3KZFA 1B7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WE4 A;  4Q1T A;  2JJ4 A;  2BNF A;  4I49 A;  1OHA A;  4JZ9 A;  3S6G A;  2J0X A;  3ZZI A;  3C1M A;  3QUO A;  4F6T B;  3D40 A;  4NDR B;  4NDO B;  3D2M A;  2BUF A;  1OH9 A;  4F6T A;  2WE5 A;  3K4Y A;  3ZZF A;  4JZ8 A;  4NDO A;  2BND A;  4JZ7 A;  3U6U A;  2RD5 A;  1GS5 A;  1GSJ A;  4AXS A;  3C20 A;  4NDP B;  2R8V A;  2BMU A;  2AP9 A;  2V5H A;  4A7X A;  3ZZG A;  1OHB A;  4NDP A;  3D41 A;  2OGX A;  2BRX A;  3B8G A;  3LL5 A;  1E19 A;  4AB7 A;  3TVI A;  2IJ9 A;  2CDQ A;  3LL9 A;  3EK6 A;  2BRI A;  3QUR A;  3C1N A;  2R98 A;  2J5V A;  2JJX A;  3QVF A;  2OGX B;  2W21 A;  2WXB A;  3D2P A;  3WWM A;  3QVH A;  2VA1 A;  2JI5 A;  3LKK A;  3AB2 A;  2E9Y A;  4NDQ A;  3K52 A;  2BNE A;  2AKO A;  3L86 A;  3S6K A;  3S6H A;  3T7B A;  2BTY A;  3ZZH A;  1Z9D A;  2X2W A;  2J0W A;  4KZT A;  3QUN A;  3AB4 A;  4OLC A;  3NWY A;  3L76 A;  2A1F A;  1YBD A;  2J4L A;  2J5T A;  3WWN A;  4NDQ B;  3K4O A;  3AAW A;  3EK5 A;  4A7W A;  2J4K A;  2HMF A;  4NDR A;  2J4J A;  3K56 A;  4USJ A;  2V4Y A;  3KZF A;  1B7B A; 
#chains in the Genus database with same CATH topology
 2WE4 A;  4Q1T A;  2JJ4 A;  2BNF A;  4I49 A;  1OHA A;  4JZ9 A;  3S6G A;  2J0X A;  3ZZI A;  3C1M A;  3QUO A;  4F6T B;  3D40 A;  4NDR B;  4NDO B;  3D2M A;  2BUF A;  1OH9 A;  4F6T A;  2WE5 A;  3K4Y A;  3ZZF A;  4JZ8 A;  4NDO A;  2BND A;  4JZ7 A;  3U6U A;  2RD5 A;  1GS5 A;  1GSJ A;  4AXS A;  3C20 A;  4NDP B;  2R8V A;  2BMU A;  2AP9 A;  2V5H A;  4A7X A;  3ZZG A;  1OHB A;  4NDP A;  3D41 A;  2OGX A;  2BRX A;  3B8G A;  3LL5 A;  1E19 A;  4AB7 A;  3TVI A;  2IJ9 A;  2CDQ A;  3LL9 A;  3EK6 A;  2BRI A;  3QUR A;  3C1N A;  2R98 A;  2J5V A;  2JJX A;  3QVF A;  2OGX B;  2W21 A;  2WXB A;  3D2P A;  3WWM A;  3QVH A;  2VA1 A;  2JI5 A;  3LKK A;  3AB2 A;  2E9Y A;  4NDQ A;  3K52 A;  2BNE A;  2AKO A;  3L86 A;  3S6K A;  3S6H A;  3T7B A;  2BTY A;  3ZZH A;  1Z9D A;  2X2W A;  2J0W A;  4KZT A;  3QUN A;  3AB4 A;  4OLC A;  3NWY A;  3L76 A;  2A1F A;  1YBD A;  2J4L A;  2J5T A;  3WWN A;  4NDQ B;  3K4O A;  3AAW A;  3EK5 A;  4A7W A;  2J4K A;  2HMF A;  4NDR A;  2J4J A;  3K56 A;  4USJ A;  2V4Y A;  3KZF A;  1B7B A; 
#chains in the Genus database with same CATH homology
 2WE4 A;  4Q1T A;  2JJ4 A;  2BNF A;  4I49 A;  1OHA A;  4JZ9 A;  3S6G A;  2J0X A;  3ZZI A;  3C1M A;  3QUO A;  4F6T B;  3D40 A;  4NDR B;  4NDO B;  3D2M A;  2BUF A;  1OH9 A;  4F6T A;  2WE5 A;  3K4Y A;  3ZZF A;  4JZ8 A;  4NDO A;  2BND A;  4JZ7 A;  3U6U A;  2RD5 A;  1GS5 A;  1GSJ A;  4AXS A;  3C20 A;  4NDP B;  2R8V A;  2BMU A;  2AP9 A;  2V5H A;  4A7X A;  3ZZG A;  1OHB A;  4NDP A;  3D41 A;  2OGX A;  2BRX A;  3B8G A;  3LL5 A;  1E19 A;  4AB7 A;  3TVI A;  2IJ9 A;  2CDQ A;  3LL9 A;  3EK6 A;  2BRI A;  3QUR A;  3C1N A;  2R98 A;  2J5V A;  2JJX A;  3QVF A;  2OGX B;  2W21 A;  2WXB A;  3D2P A;  3WWM A;  3QVH A;  2VA1 A;  2JI5 A;  3LKK A;  3AB2 A;  2E9Y A;  4NDQ A;  3K52 A;  2BNE A;  2AKO A;  3L86 A;  3S6K A;  3S6H A;  3T7B A;  2BTY A;  3ZZH A;  1Z9D A;  2X2W A;  2J0W A;  4KZT A;  3QUN A;  3AB4 A;  4OLC A;  3NWY A;  3L76 A;  2A1F A;  1YBD A;  2J4L A;  2J5T A;  3WWN A;  4NDQ B;  3K4O A;  3AAW A;  3EK5 A;  4A7W A;  2J4K A;  2HMF A;  4NDR A;  2J4J A;  3K56 A;  4USJ A;  2V4Y A;  3KZF A;  1B7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...