4NDPB

Crystal structure molybdenum storage protein with fully mo-loaded cavity
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
268
structure length
268
Chain Sequence
NSTAELEELLMQRSLTDPQLQAAAAAAADFRILPDATVIKIGGQSVIDRGRAAVYPLVDEIVAARKNHKLLIGTGAGTRARHLYSIAAGLGLPAGVLAQLGSSVADQNAAMLGQLLAKHGIPVVGGAGLSAVPLSLAEVNAVVFSGMPPYKLWMRPAAEGVIPPYRTDAGCFLLAEQFGCKQMIFVKDEDGLYTANPKTSKDATFIPRISVDEMKAKGLHDSILEFPVLDLLQSAQHVREVQVVNGLVPGNLTRALAGEHVGTIITAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdenum storage protein subunit beta
publication title Structural diversity of polyoxomolybdate clusters along the three-fold axis of the molybdenum storage protein.
pubmed doi rcsb
molecule tags Metal binding protein
total genus 92
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2013-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 4ndpB00
2AKOA 3U6UA 3K56A 2BNFA 3C1MA 4OLCA 3EK5A 1OHAA 4NDPB 2AP9A 2A1FA 3LKKA 3LL9A 2VA1A 3QURA 2BNEA 2JJ4A 3EK6A 2RD5A 2J4JA 2V5HA 1B7BA 3AB2A 3S6GA 3C1NA 2JJXA 3TVIA 3K4OA 2HMFA 3C20A 2W21A 2IJ9A 3AAWA 4NDOB 2J4LA 4NDQB 4JZ9A 4KZTA 3S6KA 4A7WA 4F6TA 3K4YA 3QVHA 1GSJA 2BTYA 3D40A 3ZZHA 1Z9DA 2X2WA 2OGXB 2R98A 3QUOA 2E9YA 4NDRB 3QVFA 2JI5A 3L76A 4JZ8A 3WWNA 4I49A 1OH9A 3ZZIA 2WE4A 3B8GA 2BRIA 3ZZGA 2BNDA 4USJA 3T7BA 3D2PA 1GS5A 4NDPA 2J4KA 2J0XA 3D2MA 3D41A 3NWYA 3KZFA 2J5TA 2J0WA 1OHBA 4JZ7A 2V4YA 2WE5A 3QUNA 2BUFA 2WXBA 4Q1TA 4A7XA 2BMUA 1YBDA 2CDQA 3ZZFA 3AB4A 4AXSA 4F6TB 3LL5A 4NDOA 2BRXA 4NDQA 2J5VA 3K52A 4AB7A 3S6HA 2R8VA 1E19A 2OGXA 3L86A 3WWMA 4NDRA
chains in the Genus database with same CATH superfamily
2AKOA 3U6UA 3K56A 2BNFA 3C1MA 4OLCA 3EK5A 1OHAA 4NDPB 2AP9A 2A1FA 3LKKA 3LL9A 2VA1A 3QURA 2BNEA 2JJ4A 3EK6A 2RD5A 2J4JA 2V5HA 1B7BA 3AB2A 3S6GA 3C1NA 2JJXA 3TVIA 3K4OA 2HMFA 3C20A 2W21A 2IJ9A 3AAWA 4NDOB 2J4LA 4NDQB 4JZ9A 4KZTA 3S6KA 4A7WA 4F6TA 3K4YA 3QVHA 1GSJA 2BTYA 3D40A 3ZZHA 1Z9DA 2X2WA 2OGXB 2R98A 3QUOA 2E9YA 4NDRB 3QVFA 2JI5A 3L76A 4JZ8A 3WWNA 4I49A 1OH9A 3ZZIA 2WE4A 3B8GA 2BRIA 3ZZGA 2BNDA 4USJA 3T7BA 3D2PA 1GS5A 4NDPA 2J4KA 2J0XA 3D2MA 3D41A 3NWYA 3KZFA 2J5TA 2J0WA 1OHBA 4JZ7A 2V4YA 2WE5A 3QUNA 2BUFA 2WXBA 4Q1TA 4A7XA 2BMUA 1YBDA 2CDQA 3ZZFA 3AB4A 4AXSA 4F6TB 3LL5A 4NDOA 2BRXA 4NDQA 2J5VA 3K52A 4AB7A 3S6HA 2R8VA 1E19A 2OGXA 3L86A 3WWMA 4NDRA
chains in the Genus database with same CATH topology
2AKOA 3U6UA 3K56A 2BNFA 3C1MA 4OLCA 3EK5A 1OHAA 4NDPB 2AP9A 2A1FA 3LKKA 3LL9A 2VA1A 3QURA 2BNEA 2JJ4A 3EK6A 2RD5A 2J4JA 2V5HA 1B7BA 3AB2A 3S6GA 3C1NA 2JJXA 3TVIA 3K4OA 2HMFA 3C20A 2W21A 2IJ9A 3AAWA 4NDOB 2J4LA 4NDQB 4JZ9A 4KZTA 3S6KA 4A7WA 4F6TA 3K4YA 3QVHA 1GSJA 2BTYA 3D40A 3ZZHA 1Z9DA 2X2WA 2OGXB 2R98A 3QUOA 2E9YA 4NDRB 3QVFA 2JI5A 3L76A 4JZ8A 3WWNA 4I49A 1OH9A 3ZZIA 2WE4A 3B8GA 2BRIA 3ZZGA 2BNDA 4USJA 3T7BA 3D2PA 1GS5A 4NDPA 2J4KA 2J0XA 3D2MA 3D41A 3NWYA 3KZFA 2J5TA 2J0WA 1OHBA 4JZ7A 2V4YA 2WE5A 3QUNA 2BUFA 2WXBA 4Q1TA 4A7XA 2BMUA 1YBDA 2CDQA 3ZZFA 3AB4A 4AXSA 4F6TB 3LL5A 4NDOA 2BRXA 4NDQA 2J5VA 3K52A 4AB7A 3S6HA 2R8VA 1E19A 2OGXA 3L86A 3WWMA 4NDRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AKO A;  3U6U A;  3K56 A;  2BNF A;  3C1M A;  4OLC A;  3EK5 A;  1OHA A;  4NDP B;  2AP9 A;  2A1F A;  3LKK A;  3LL9 A;  2VA1 A;  3QUR A;  2BNE A;  2JJ4 A;  3EK6 A;  2RD5 A;  2J4J A;  2V5H A;  1B7B A;  3AB2 A;  3S6G A;  3C1N A;  2JJX A;  3TVI A;  3K4O A;  2HMF A;  3C20 A;  2W21 A;  2IJ9 A;  3AAW A;  4NDO B;  2J4L A;  4NDQ B;  4JZ9 A;  4KZT A;  3S6K A;  4A7W A;  4F6T A;  3K4Y A;  3QVH A;  1GSJ A;  2BTY A;  3D40 A;  3ZZH A;  1Z9D A;  2X2W A;  2OGX B;  2R98 A;  3QUO A;  2E9Y A;  4NDR B;  3QVF A;  2JI5 A;  3L76 A;  4JZ8 A;  3WWN A;  4I49 A;  1OH9 A;  3ZZI A;  2WE4 A;  3B8G A;  2BRI A;  3ZZG A;  2BND A;  4USJ A;  3T7B A;  3D2P A;  1GS5 A;  4NDP A;  2J4K A;  2J0X A;  3D2M A;  3D41 A;  3NWY A;  3KZF A;  2J5T A;  2J0W A;  1OHB A;  4JZ7 A;  2V4Y A;  2WE5 A;  3QUN A;  2BUF A;  2WXB A;  4Q1T A;  4A7X A;  2BMU A;  1YBD A;  2CDQ A;  3ZZF A;  3AB4 A;  4AXS A;  4F6T B;  3LL5 A;  4NDO A;  2BRX A;  4NDQ A;  2J5V A;  3K52 A;  4AB7 A;  3S6H A;  2R8V A;  1E19 A;  2OGX A;  3L86 A;  3WWM A;  4NDR A; 
#chains in the Genus database with same CATH topology
 2AKO A;  3U6U A;  3K56 A;  2BNF A;  3C1M A;  4OLC A;  3EK5 A;  1OHA A;  4NDP B;  2AP9 A;  2A1F A;  3LKK A;  3LL9 A;  2VA1 A;  3QUR A;  2BNE A;  2JJ4 A;  3EK6 A;  2RD5 A;  2J4J A;  2V5H A;  1B7B A;  3AB2 A;  3S6G A;  3C1N A;  2JJX A;  3TVI A;  3K4O A;  2HMF A;  3C20 A;  2W21 A;  2IJ9 A;  3AAW A;  4NDO B;  2J4L A;  4NDQ B;  4JZ9 A;  4KZT A;  3S6K A;  4A7W A;  4F6T A;  3K4Y A;  3QVH A;  1GSJ A;  2BTY A;  3D40 A;  3ZZH A;  1Z9D A;  2X2W A;  2OGX B;  2R98 A;  3QUO A;  2E9Y A;  4NDR B;  3QVF A;  2JI5 A;  3L76 A;  4JZ8 A;  3WWN A;  4I49 A;  1OH9 A;  3ZZI A;  2WE4 A;  3B8G A;  2BRI A;  3ZZG A;  2BND A;  4USJ A;  3T7B A;  3D2P A;  1GS5 A;  4NDP A;  2J4K A;  2J0X A;  3D2M A;  3D41 A;  3NWY A;  3KZF A;  2J5T A;  2J0W A;  1OHB A;  4JZ7 A;  2V4Y A;  2WE5 A;  3QUN A;  2BUF A;  2WXB A;  4Q1T A;  4A7X A;  2BMU A;  1YBD A;  2CDQ A;  3ZZF A;  3AB4 A;  4AXS A;  4F6T B;  3LL5 A;  4NDO A;  2BRX A;  4NDQ A;  2J5V A;  3K52 A;  4AB7 A;  3S6H A;  2R8V A;  1E19 A;  2OGX A;  3L86 A;  3WWM A;  4NDR A; 
#chains in the Genus database with same CATH homology
 2AKO A;  3U6U A;  3K56 A;  2BNF A;  3C1M A;  4OLC A;  3EK5 A;  1OHA A;  4NDP B;  2AP9 A;  2A1F A;  3LKK A;  3LL9 A;  2VA1 A;  3QUR A;  2BNE A;  2JJ4 A;  3EK6 A;  2RD5 A;  2J4J A;  2V5H A;  1B7B A;  3AB2 A;  3S6G A;  3C1N A;  2JJX A;  3TVI A;  3K4O A;  2HMF A;  3C20 A;  2W21 A;  2IJ9 A;  3AAW A;  4NDO B;  2J4L A;  4NDQ B;  4JZ9 A;  4KZT A;  3S6K A;  4A7W A;  4F6T A;  3K4Y A;  3QVH A;  1GSJ A;  2BTY A;  3D40 A;  3ZZH A;  1Z9D A;  2X2W A;  2OGX B;  2R98 A;  3QUO A;  2E9Y A;  4NDR B;  3QVF A;  2JI5 A;  3L76 A;  4JZ8 A;  3WWN A;  4I49 A;  1OH9 A;  3ZZI A;  2WE4 A;  3B8G A;  2BRI A;  3ZZG A;  2BND A;  4USJ A;  3T7B A;  3D2P A;  1GS5 A;  4NDP A;  2J4K A;  2J0X A;  3D2M A;  3D41 A;  3NWY A;  3KZF A;  2J5T A;  2J0W A;  1OHB A;  4JZ7 A;  2V4Y A;  2WE5 A;  3QUN A;  2BUF A;  2WXB A;  4Q1T A;  4A7X A;  2BMU A;  1YBD A;  2CDQ A;  3ZZF A;  3AB4 A;  4AXS A;  4F6T B;  3LL5 A;  4NDO A;  2BRX A;  4NDQ A;  2J5V A;  3K52 A;  4AB7 A;  3S6H A;  2R8V A;  1E19 A;  2OGX A;  3L86 A;  3WWM A;  4NDR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...