4NDPB

Crystal structure molybdenum storage protein with fully mo-loaded cavity
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
268
structure length
268
Chain Sequence
NSTAELEELLMQRSLTDPQLQAAAAAAADFRILPDATVIKIGGQSVIDRGRAAVYPLVDEIVAARKNHKLLIGTGAGTRARHLYSIAAGLGLPAGVLAQLGSSVADQNAAMLGQLLAKHGIPVVGGAGLSAVPLSLAEVNAVVFSGMPPYKLWMRPAAEGVIPPYRTDAGCFLLAEQFGCKQMIFVKDEDGLYTANPKTSKDATFIPRISVDEMKAKGLHDSILEFPVLDLLQSAQHVREVQVVNGLVPGNLTRALAGEHVGTIITAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural diversity of polyoxomolybdate clusters along the three-fold axis of the molybdenum storage protein.
pubmed doi rcsb
molecule tags Metal binding protein
molecule keywords Molybdenum storage protein subunit beta
total genus 92
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2013-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 4ndpB00
4NDRA 3S6GA 4AB7A 3LKKA 3QUOA 4NDQB 2W21A 4I49A 2VA1A 1GSJA 2E9YA 2AP9A 4A7XA 3L86A 3S6HA 1OHAA 2WXBA 4JZ9A 2JJXA 2JJ4A 1YBDA 3WWMA 3KZFA 3C1NA 2R8VA 3QUNA 3B8GA 2OGXA 3K56A 2HMFA 2J4KA 1B7BA 3C20A 3WWNA 3K4YA 3D2PA 2J0XA 2BTYA 2J5VA 4Q1TA 3K52A 3L76A 2WE4A 3U6UA 4USJA 2BRIA 2J5TA 3ZZHA 2BNEA 3D41A 2JI5A 2J4LA 2X2WA 3ZZGA 1E19A 2A1FA 2RD5A 4A7WA 3AAWA 3K4OA 3EK5A 2BUFA 4AXSA 3AB4A 3NWYA 3S6KA 3LL9A 2AKOA 3QVFA 1Z9DA 2BNDA 3AB2A 2CDQA 4NDRB 2OGXB 4OLCA 3EK6A 3ZZIA 3ZZFA 2V4YA 2WE5A 1OHBA 2R98A 2BNFA 2BMUA 3LL5A 3QVHA 4NDOB 3C1MA 4F6TB 3T7BA 2J0WA 4F6TA 3D2MA 2V5HA 1GS5A 4NDPB 3TVIA 3QURA 4JZ7A 1OH9A 4KZTA 2IJ9A 2J4JA 3D40A 4NDQA 4JZ8A 4NDPA 2BRXA 4NDOA
chains in the Genus database with same CATH superfamily
4NDRA 3S6GA 4AB7A 3LKKA 3QUOA 4NDQB 2W21A 4I49A 2VA1A 1GSJA 2E9YA 2AP9A 4A7XA 3L86A 3S6HA 1OHAA 2WXBA 4JZ9A 2JJXA 2JJ4A 1YBDA 3WWMA 3KZFA 3C1NA 2R8VA 3QUNA 3B8GA 2OGXA 3K56A 2HMFA 2J4KA 1B7BA 3C20A 3WWNA 3K4YA 3D2PA 2J0XA 2BTYA 2J5VA 4Q1TA 3K52A 3L76A 2WE4A 3U6UA 4USJA 2BRIA 2J5TA 3ZZHA 2BNEA 3D41A 2JI5A 2J4LA 2X2WA 3ZZGA 1E19A 2A1FA 2RD5A 4A7WA 3AAWA 3K4OA 3EK5A 2BUFA 4AXSA 3AB4A 3NWYA 3S6KA 3LL9A 2AKOA 3QVFA 1Z9DA 2BNDA 3AB2A 2CDQA 4NDRB 2OGXB 4OLCA 3EK6A 3ZZIA 3ZZFA 2V4YA 2WE5A 1OHBA 2R98A 2BNFA 2BMUA 3LL5A 3QVHA 4NDOB 3C1MA 4F6TB 3T7BA 2J0WA 4F6TA 3D2MA 2V5HA 1GS5A 4NDPB 3TVIA 3QURA 4JZ7A 1OH9A 4KZTA 2IJ9A 2J4JA 3D40A 4NDQA 4JZ8A 4NDPA 2BRXA 4NDOA
chains in the Genus database with same CATH topology
4NDRA 3S6GA 4AB7A 3LKKA 3QUOA 4NDQB 2W21A 4I49A 2VA1A 1GSJA 2E9YA 2AP9A 4A7XA 3L86A 3S6HA 1OHAA 2WXBA 4JZ9A 2JJXA 2JJ4A 1YBDA 3WWMA 3KZFA 3C1NA 2R8VA 3QUNA 3B8GA 2OGXA 3K56A 2HMFA 2J4KA 1B7BA 3C20A 3WWNA 3K4YA 3D2PA 2J0XA 2BTYA 2J5VA 4Q1TA 3K52A 3L76A 2WE4A 3U6UA 4USJA 2BRIA 2J5TA 3ZZHA 2BNEA 3D41A 2JI5A 2J4LA 2X2WA 3ZZGA 1E19A 2A1FA 2RD5A 4A7WA 3AAWA 3K4OA 3EK5A 2BUFA 4AXSA 3AB4A 3NWYA 3S6KA 3LL9A 2AKOA 3QVFA 1Z9DA 2BNDA 3AB2A 2CDQA 4NDRB 2OGXB 4OLCA 3EK6A 3ZZIA 3ZZFA 2V4YA 2WE5A 1OHBA 2R98A 2BNFA 2BMUA 3LL5A 3QVHA 4NDOB 3C1MA 4F6TB 3T7BA 2J0WA 4F6TA 3D2MA 2V5HA 1GS5A 4NDPB 3TVIA 3QURA 4JZ7A 1OH9A 4KZTA 2IJ9A 2J4JA 3D40A 4NDQA 4JZ8A 4NDPA 2BRXA 4NDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NDR A;  3S6G A;  4AB7 A;  3LKK A;  3QUO A;  4NDQ B;  2W21 A;  4I49 A;  2VA1 A;  1GSJ A;  2E9Y A;  2AP9 A;  4A7X A;  3L86 A;  3S6H A;  1OHA A;  2WXB A;  4JZ9 A;  2JJX A;  2JJ4 A;  1YBD A;  3WWM A;  3KZF A;  3C1N A;  2R8V A;  3QUN A;  3B8G A;  2OGX A;  3K56 A;  2HMF A;  2J4K A;  1B7B A;  3C20 A;  3WWN A;  3K4Y A;  3D2P A;  2J0X A;  2BTY A;  2J5V A;  4Q1T A;  3K52 A;  3L76 A;  2WE4 A;  3U6U A;  4USJ A;  2BRI A;  2J5T A;  3ZZH A;  2BNE A;  3D41 A;  2JI5 A;  2J4L A;  2X2W A;  3ZZG A;  1E19 A;  2A1F A;  2RD5 A;  4A7W A;  3AAW A;  3K4O A;  3EK5 A;  2BUF A;  4AXS A;  3AB4 A;  3NWY A;  3S6K A;  3LL9 A;  2AKO A;  3QVF A;  1Z9D A;  2BND A;  3AB2 A;  2CDQ A;  4NDR B;  2OGX B;  4OLC A;  3EK6 A;  3ZZI A;  3ZZF A;  2V4Y A;  2WE5 A;  1OHB A;  2R98 A;  2BNF A;  2BMU A;  3LL5 A;  3QVH A;  4NDO B;  3C1M A;  4F6T B;  3T7B A;  2J0W A;  4F6T A;  3D2M A;  2V5H A;  1GS5 A;  4NDP B;  3TVI A;  3QUR A;  4JZ7 A;  1OH9 A;  4KZT A;  2IJ9 A;  2J4J A;  3D40 A;  4NDQ A;  4JZ8 A;  4NDP A;  2BRX A;  4NDO A; 
#chains in the Genus database with same CATH topology
 4NDR A;  3S6G A;  4AB7 A;  3LKK A;  3QUO A;  4NDQ B;  2W21 A;  4I49 A;  2VA1 A;  1GSJ A;  2E9Y A;  2AP9 A;  4A7X A;  3L86 A;  3S6H A;  1OHA A;  2WXB A;  4JZ9 A;  2JJX A;  2JJ4 A;  1YBD A;  3WWM A;  3KZF A;  3C1N A;  2R8V A;  3QUN A;  3B8G A;  2OGX A;  3K56 A;  2HMF A;  2J4K A;  1B7B A;  3C20 A;  3WWN A;  3K4Y A;  3D2P A;  2J0X A;  2BTY A;  2J5V A;  4Q1T A;  3K52 A;  3L76 A;  2WE4 A;  3U6U A;  4USJ A;  2BRI A;  2J5T A;  3ZZH A;  2BNE A;  3D41 A;  2JI5 A;  2J4L A;  2X2W A;  3ZZG A;  1E19 A;  2A1F A;  2RD5 A;  4A7W A;  3AAW A;  3K4O A;  3EK5 A;  2BUF A;  4AXS A;  3AB4 A;  3NWY A;  3S6K A;  3LL9 A;  2AKO A;  3QVF A;  1Z9D A;  2BND A;  3AB2 A;  2CDQ A;  4NDR B;  2OGX B;  4OLC A;  3EK6 A;  3ZZI A;  3ZZF A;  2V4Y A;  2WE5 A;  1OHB A;  2R98 A;  2BNF A;  2BMU A;  3LL5 A;  3QVH A;  4NDO B;  3C1M A;  4F6T B;  3T7B A;  2J0W A;  4F6T A;  3D2M A;  2V5H A;  1GS5 A;  4NDP B;  3TVI A;  3QUR A;  4JZ7 A;  1OH9 A;  4KZT A;  2IJ9 A;  2J4J A;  3D40 A;  4NDQ A;  4JZ8 A;  4NDP A;  2BRX A;  4NDO A; 
#chains in the Genus database with same CATH homology
 4NDR A;  3S6G A;  4AB7 A;  3LKK A;  3QUO A;  4NDQ B;  2W21 A;  4I49 A;  2VA1 A;  1GSJ A;  2E9Y A;  2AP9 A;  4A7X A;  3L86 A;  3S6H A;  1OHA A;  2WXB A;  4JZ9 A;  2JJX A;  2JJ4 A;  1YBD A;  3WWM A;  3KZF A;  3C1N A;  2R8V A;  3QUN A;  3B8G A;  2OGX A;  3K56 A;  2HMF A;  2J4K A;  1B7B A;  3C20 A;  3WWN A;  3K4Y A;  3D2P A;  2J0X A;  2BTY A;  2J5V A;  4Q1T A;  3K52 A;  3L76 A;  2WE4 A;  3U6U A;  4USJ A;  2BRI A;  2J5T A;  3ZZH A;  2BNE A;  3D41 A;  2JI5 A;  2J4L A;  2X2W A;  3ZZG A;  1E19 A;  2A1F A;  2RD5 A;  4A7W A;  3AAW A;  3K4O A;  3EK5 A;  2BUF A;  4AXS A;  3AB4 A;  3NWY A;  3S6K A;  3LL9 A;  2AKO A;  3QVF A;  1Z9D A;  2BND A;  3AB2 A;  2CDQ A;  4NDR B;  2OGX B;  4OLC A;  3EK6 A;  3ZZI A;  3ZZF A;  2V4Y A;  2WE5 A;  1OHB A;  2R98 A;  2BNF A;  2BMU A;  3LL5 A;  3QVH A;  4NDO B;  3C1M A;  4F6T B;  3T7B A;  2J0W A;  4F6T A;  3D2M A;  2V5H A;  1GS5 A;  4NDP B;  3TVI A;  3QUR A;  4JZ7 A;  1OH9 A;  4KZT A;  2IJ9 A;  2J4J A;  3D40 A;  4NDQ A;  4JZ8 A;  4NDP A;  2BRX A;  4NDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...