4NDPB

Crystal structure molybdenum storage protein with fully mo-loaded cavity
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
268
structure length
268
Chain Sequence
NSTAELEELLMQRSLTDPQLQAAAAAAADFRILPDATVIKIGGQSVIDRGRAAVYPLVDEIVAARKNHKLLIGTGAGTRARHLYSIAAGLGLPAGVLAQLGSSVADQNAAMLGQLLAKHGIPVVGGAGLSAVPLSLAEVNAVVFSGMPPYKLWMRPAAEGVIPPYRTDAGCFLLAEQFGCKQMIFVKDEDGLYTANPKTSKDATFIPRISVDEMKAKGLHDSILEFPVLDLLQSAQHVREVQVVNGLVPGNLTRALAGEHVGTIITAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural diversity of polyoxomolybdate clusters along the three-fold axis of the molybdenum storage protein.
pubmed doi rcsb
molecule tags Metal binding protein
molecule keywords Molybdenum storage protein subunit beta
total genus 92
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2013-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 4ndpB00
4F6TB 4JZ9A 2WXBA 3K52A 1E19A 3ZZFA 2V5HA 2BTYA 3WWNA 2V4YA 3U6UA 2VA1A 4KZTA 2J4KA 1YBDA 3S6KA 2R98A 4A7WA 1OH9A 3AAWA 3NWYA 4JZ7A 2J0WA 2W21A 2BMUA 4NDPB 1GS5A 1Z9DA 3C1MA 3D2PA 4A7XA 3ZZGA 3C20A 3ZZHA 3T7BA 4AB7A 4NDRA 2BUFA 3LL5A 2HMFA 4NDPA 2AKOA 3QURA 4NDQB 3K4YA 4F6TA 1B7BA 3KZFA 3QVFA 3D2MA 2JJ4A 2J5TA 2BNEA 1OHBA 4USJA 4NDOA 3C1NA 2JJXA 3TVIA 3EK6A 3K4OA 3QUOA 3LL9A 2BNDA 2A1FA 1OHAA 3LKKA 3D41A 3B8GA 3D40A 2OGXB 2X2WA 1GSJA 2BRXA 3AB4A 2BNFA 2J4JA 4NDRB 2AP9A 3L86A 2R8VA 4JZ8A 2RD5A 3QUNA 3WWMA 2J0XA 4NDQA 2J4LA 4AXSA 3ZZIA 4NDOB 2J5VA 2E9YA 2JI5A 2OGXA 2WE4A 2CDQA 2IJ9A 4Q1TA 3AB2A 4OLCA 3S6GA 3EK5A 3K56A 3L76A 4I49A 2BRIA 3S6HA 3QVHA 2WE5A
chains in the Genus database with same CATH superfamily
4F6TB 4JZ9A 2WXBA 3K52A 1E19A 3ZZFA 2V5HA 2BTYA 3WWNA 2V4YA 3U6UA 2VA1A 4KZTA 2J4KA 1YBDA 3S6KA 2R98A 4A7WA 1OH9A 3AAWA 3NWYA 4JZ7A 2J0WA 2W21A 2BMUA 4NDPB 1GS5A 1Z9DA 3C1MA 3D2PA 4A7XA 3ZZGA 3C20A 3ZZHA 3T7BA 4AB7A 4NDRA 2BUFA 3LL5A 2HMFA 4NDPA 2AKOA 3QURA 4NDQB 3K4YA 4F6TA 1B7BA 3KZFA 3QVFA 3D2MA 2JJ4A 2J5TA 2BNEA 1OHBA 4USJA 4NDOA 3C1NA 2JJXA 3TVIA 3EK6A 3K4OA 3QUOA 3LL9A 2BNDA 2A1FA 1OHAA 3LKKA 3D41A 3B8GA 3D40A 2OGXB 2X2WA 1GSJA 2BRXA 3AB4A 2BNFA 2J4JA 4NDRB 2AP9A 3L86A 2R8VA 4JZ8A 2RD5A 3QUNA 3WWMA 2J0XA 4NDQA 2J4LA 4AXSA 3ZZIA 4NDOB 2J5VA 2E9YA 2JI5A 2OGXA 2WE4A 2CDQA 2IJ9A 4Q1TA 3AB2A 4OLCA 3S6GA 3EK5A 3K56A 3L76A 4I49A 2BRIA 3S6HA 3QVHA 2WE5A
chains in the Genus database with same CATH topology
4F6TB 4JZ9A 2WXBA 3K52A 1E19A 3ZZFA 2V5HA 2BTYA 3WWNA 2V4YA 3U6UA 2VA1A 4KZTA 2J4KA 1YBDA 3S6KA 2R98A 4A7WA 1OH9A 3AAWA 3NWYA 4JZ7A 2J0WA 2W21A 2BMUA 4NDPB 1GS5A 1Z9DA 3C1MA 3D2PA 4A7XA 3ZZGA 3C20A 3ZZHA 3T7BA 4AB7A 4NDRA 2BUFA 3LL5A 2HMFA 4NDPA 2AKOA 3QURA 4NDQB 3K4YA 4F6TA 1B7BA 3KZFA 3QVFA 3D2MA 2JJ4A 2J5TA 2BNEA 1OHBA 4USJA 4NDOA 3C1NA 2JJXA 3TVIA 3EK6A 3K4OA 3QUOA 3LL9A 2BNDA 2A1FA 1OHAA 3LKKA 3D41A 3B8GA 3D40A 2OGXB 2X2WA 1GSJA 2BRXA 3AB4A 2BNFA 2J4JA 4NDRB 2AP9A 3L86A 2R8VA 4JZ8A 2RD5A 3QUNA 3WWMA 2J0XA 4NDQA 2J4LA 4AXSA 3ZZIA 4NDOB 2J5VA 2E9YA 2JI5A 2OGXA 2WE4A 2CDQA 2IJ9A 4Q1TA 3AB2A 4OLCA 3S6GA 3EK5A 3K56A 3L76A 4I49A 2BRIA 3S6HA 3QVHA 2WE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F6T B;  4JZ9 A;  2WXB A;  3K52 A;  1E19 A;  3ZZF A;  2V5H A;  2BTY A;  3WWN A;  2V4Y A;  3U6U A;  2VA1 A;  4KZT A;  2J4K A;  1YBD A;  3S6K A;  2R98 A;  4A7W A;  1OH9 A;  3AAW A;  3NWY A;  4JZ7 A;  2J0W A;  2W21 A;  2BMU A;  4NDP B;  1GS5 A;  1Z9D A;  3C1M A;  3D2P A;  4A7X A;  3ZZG A;  3C20 A;  3ZZH A;  3T7B A;  4AB7 A;  4NDR A;  2BUF A;  3LL5 A;  2HMF A;  4NDP A;  2AKO A;  3QUR A;  4NDQ B;  3K4Y A;  4F6T A;  1B7B A;  3KZF A;  3QVF A;  3D2M A;  2JJ4 A;  2J5T A;  2BNE A;  1OHB A;  4USJ A;  4NDO A;  3C1N A;  2JJX A;  3TVI A;  3EK6 A;  3K4O A;  3QUO A;  3LL9 A;  2BND A;  2A1F A;  1OHA A;  3LKK A;  3D41 A;  3B8G A;  3D40 A;  2OGX B;  2X2W A;  1GSJ A;  2BRX A;  3AB4 A;  2BNF A;  2J4J A;  4NDR B;  2AP9 A;  3L86 A;  2R8V A;  4JZ8 A;  2RD5 A;  3QUN A;  3WWM A;  2J0X A;  4NDQ A;  2J4L A;  4AXS A;  3ZZI A;  4NDO B;  2J5V A;  2E9Y A;  2JI5 A;  2OGX A;  2WE4 A;  2CDQ A;  2IJ9 A;  4Q1T A;  3AB2 A;  4OLC A;  3S6G A;  3EK5 A;  3K56 A;  3L76 A;  4I49 A;  2BRI A;  3S6H A;  3QVH A;  2WE5 A; 
#chains in the Genus database with same CATH topology
 4F6T B;  4JZ9 A;  2WXB A;  3K52 A;  1E19 A;  3ZZF A;  2V5H A;  2BTY A;  3WWN A;  2V4Y A;  3U6U A;  2VA1 A;  4KZT A;  2J4K A;  1YBD A;  3S6K A;  2R98 A;  4A7W A;  1OH9 A;  3AAW A;  3NWY A;  4JZ7 A;  2J0W A;  2W21 A;  2BMU A;  4NDP B;  1GS5 A;  1Z9D A;  3C1M A;  3D2P A;  4A7X A;  3ZZG A;  3C20 A;  3ZZH A;  3T7B A;  4AB7 A;  4NDR A;  2BUF A;  3LL5 A;  2HMF A;  4NDP A;  2AKO A;  3QUR A;  4NDQ B;  3K4Y A;  4F6T A;  1B7B A;  3KZF A;  3QVF A;  3D2M A;  2JJ4 A;  2J5T A;  2BNE A;  1OHB A;  4USJ A;  4NDO A;  3C1N A;  2JJX A;  3TVI A;  3EK6 A;  3K4O A;  3QUO A;  3LL9 A;  2BND A;  2A1F A;  1OHA A;  3LKK A;  3D41 A;  3B8G A;  3D40 A;  2OGX B;  2X2W A;  1GSJ A;  2BRX A;  3AB4 A;  2BNF A;  2J4J A;  4NDR B;  2AP9 A;  3L86 A;  2R8V A;  4JZ8 A;  2RD5 A;  3QUN A;  3WWM A;  2J0X A;  4NDQ A;  2J4L A;  4AXS A;  3ZZI A;  4NDO B;  2J5V A;  2E9Y A;  2JI5 A;  2OGX A;  2WE4 A;  2CDQ A;  2IJ9 A;  4Q1T A;  3AB2 A;  4OLC A;  3S6G A;  3EK5 A;  3K56 A;  3L76 A;  4I49 A;  2BRI A;  3S6H A;  3QVH A;  2WE5 A; 
#chains in the Genus database with same CATH homology
 4F6T B;  4JZ9 A;  2WXB A;  3K52 A;  1E19 A;  3ZZF A;  2V5H A;  2BTY A;  3WWN A;  2V4Y A;  3U6U A;  2VA1 A;  4KZT A;  2J4K A;  1YBD A;  3S6K A;  2R98 A;  4A7W A;  1OH9 A;  3AAW A;  3NWY A;  4JZ7 A;  2J0W A;  2W21 A;  2BMU A;  4NDP B;  1GS5 A;  1Z9D A;  3C1M A;  3D2P A;  4A7X A;  3ZZG A;  3C20 A;  3ZZH A;  3T7B A;  4AB7 A;  4NDR A;  2BUF A;  3LL5 A;  2HMF A;  4NDP A;  2AKO A;  3QUR A;  4NDQ B;  3K4Y A;  4F6T A;  1B7B A;  3KZF A;  3QVF A;  3D2M A;  2JJ4 A;  2J5T A;  2BNE A;  1OHB A;  4USJ A;  4NDO A;  3C1N A;  2JJX A;  3TVI A;  3EK6 A;  3K4O A;  3QUO A;  3LL9 A;  2BND A;  2A1F A;  1OHA A;  3LKK A;  3D41 A;  3B8G A;  3D40 A;  2OGX B;  2X2W A;  1GSJ A;  2BRX A;  3AB4 A;  2BNF A;  2J4J A;  4NDR B;  2AP9 A;  3L86 A;  2R8V A;  4JZ8 A;  2RD5 A;  3QUN A;  3WWM A;  2J0X A;  4NDQ A;  2J4L A;  4AXS A;  3ZZI A;  4NDO B;  2J5V A;  2E9Y A;  2JI5 A;  2OGX A;  2WE4 A;  2CDQ A;  2IJ9 A;  4Q1T A;  3AB2 A;  4OLC A;  3S6G A;  3EK5 A;  3K56 A;  3L76 A;  4I49 A;  2BRI A;  3S6H A;  3QVH A;  2WE5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...