4NE3B

Human mhf1-mhf2 complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
74
structure length
74
Chain Sequence
b'SGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Centromere protein S
publication title The MHF complex senses branched DNA by binding a pair of crossover DNA duplexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 25
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2013-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09415 CENP-X CENP-S associating Centromere protein X
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.286.100 Mainly Alpha Orthogonal Bundle GTP Cyclohydrolase I; Chain A, domain 1 GTP Cyclohydrolase I; Chain A, domain 1 4ne3B02
4DRBJ 4NE5B 4DRAE 4NE3B 4E45B 4E44B 3B0BC 4NE6B
chains in the Genus database with same CATH superfamily
2PN0A 3BMBA 1GTPA 1IS8A 1N3RA 2WSEK 2LNZA 2WSFK 2WSFG 4E45B 2WSEG 3VEJA 2KR1A 1WPLA 1WM9A 4NE5B 1N3TA 1EL6A 3LW5K 1WUQA 4NE3B 4R8QA 1TFEA 3LW5G 5DMZA 1N3SA 4QPMA 1A8RA 4DRBJ 1FB1A 4DRAE 1FBXA 1WURA 3B0BC 4Q7JA 2LO0A 2WSCK 2WSCG 4DU6A 1EFUB 1A9CA 1AIPC 4E44B 4NE6B 1IS7A 2P11A 4JA3A 2O01G
chains in the Genus database with same CATH topology
2PN0A 3BMBA 1GTPA 1IS8A 1N3RA 2LNZA 4E45B 3VEJA 2KR1A 1WPLA 1WM9A 4NE5B 1N3TA 1EL6A 1WUQA 4NE3B 4R8QA 1TFEA 5DMZA 1N3SA 4QPMA 1A8RA 4DRBJ 1FB1A 4DRAE 1FBXA 1WURA 3B0BC 4Q7JA 2LO0A 4DU6A 1EFUB 1A9CA 1AIPC 4E44B 4NE6B 1IS7A 2P11A 4JA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRB J;  4NE5 B;  4DRA E;  4NE3 B;  4E45 B;  4E44 B;  3B0B C;  4NE6 B; 
#chains in the Genus database with same CATH topology
 2PN0 A;  3BMB A;  1GTP A;  1IS8 A;  1N3R A;  2WSE K;  2LNZ A;  2WSF K;  2WSF G;  4E45 B;  2WSE G;  3VEJ A;  2KR1 A;  1WPL A;  1WM9 A;  4NE5 B;  1N3T A;  1EL6 A;  3LW5 K;  1WUQ A;  4NE3 B;  4R8Q A;  1TFE A;  3LW5 G;  5DMZ A;  1N3S A;  4QPM A;  1A8R A;  4DRB J;  1FB1 A;  4DRA E;  1FBX A;  1WUR A;  3B0B C;  4Q7J A;  2LO0 A;  2WSC K;  2WSC G;  4DU6 A;  1EFU B;  1A9C A;  1AIP C;  4E44 B;  4NE6 B;  1IS7 A;  2P11 A;  4JA3 A;  2O01 G; 
#chains in the Genus database with same CATH homology
 2PN0 A;  3BMB A;  1GTP A;  1IS8 A;  1N3R A;  2LNZ A;  4E45 B;  3VEJ A;  2KR1 A;  1WPL A;  1WM9 A;  4NE5 B;  1N3T A;  1EL6 A;  1WUQ A;  4NE3 B;  4R8Q A;  1TFE A;  5DMZ A;  1N3S A;  4QPM A;  1A8R A;  4DRB J;  1FB1 A;  4DRA E;  1FBX A;  1WUR A;  3B0B C;  4Q7J A;  2LO0 A;  4DU6 A;  1EFU B;  1A9C A;  1AIP C;  4E44 B;  4NE6 B;  1IS7 A;  2P11 A;  4JA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...