4NE4A

Crystal structure of abc transporter substrate binding protein prox from agrobacterium tumefaciens cocrystalized with btb
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
281
structure length
281
Chain Sequence
AQVVVSSKIDTEGGVLGNIILAVLNQNKIETTDRIQLGATPVVRKAITAGEIDIYPEYTGNAAFFFSKADDPLWKDAAKGYEEAKTLDYDANKIVWLAPSPANNTWAIALRKDVADKNNLKTLSDFGKYVAGGGTVVLAASSEFVNSAAALPAFQTTYGFTMKPDQLITLSGGDTAATIAAAANQTNNANAAMVYGTDGGIAPSGLVVLEDDKHVQPVYQPAPIIREEVLKKHPNIEELLKPVFEKLDLATLQDLNARVQVGGEQAKTVAMDFLTKNGFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter, substrate binding protein (Proline/glycine/
publication title Crystal structure of ABC transporter substrate binding protein ProX from Agrobacterium tumefaciens cocrystalized with BTB
rcsb
source organism Agrobacterium fabrum
molecule tags Transport protein
total genus 102
structure length 281
sequence length 281
ec nomenclature
pdb deposition date 2013-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4ne4A01
3.40.190.120 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Osmoprotection protein (prox); domain 2 4ne4A02
4TLLB 5I59A 3DM0A 4ZECA 3CG1A 1MXWA 4R75A 1B6HA 4GLIA 5I58B 4R6YA 2RC7A 4PP0A 3MAMA 2E0SA 3H6WA 3CSGA 4RJZA 2E1SA 2I4CA 3PUYE 1EU8A 3K1PA 5I84A 4F3BA 3K4UA 1MDQA 2QL3A 2O7UA 4ISUA 3KGCA 3L6HA 4H0WA 1QULA 3QXMA 4NWDA 5H8NB 4KPTA 3IX1A 1Y9UA 3Q28A 3B7DA 4H5FA 4IGTA 4Q0CA 3EF7A 1Y3NA 1O7TA 3K01A 4IO6A 2OWTA 3RT6B 3UP9A 2VOZA 3MC2A 1ATGA 4Z7EA 1B7HA 2BJJX 5CMCA 3C34A 4YICA 3IAZA 2OJTA 2QMXA 3BFTA 4F2QA 4QSDA 4LP2B 1I6BA 1A8EA 4XIGQ 3C31A 3KSXA 2YLNA 5CBRA 1NNPA 3PMVA 1BIYA 2A5SA 1MY4A 3OENA 3KN8A 1CE2A 2DP8A 2UVGA 2DXYA 5CC2A 1LLSA 2Y7WA 1BKAA 3H4ZA 1LBCA 3IOWA 1DOTA 1JW1A 2AL5A 3QAXA 2QS1A 4LVQA 2CMOA 1OLAA 3UK4A 4ZEBA 5AA4B 5FTIA 1POTA 1B4ZA 3KJTA 3U92A 1SD3A 2G93A 2Y7PA 2ABHA 3ZSFA 3FZVA 3JZJA 2PMSA 1IZ1A 4XKQA 1M5EA 3DP6A 3LSWA 3MVZA 1A55A 3RT8A 3MVXA 3HSTA 2ONKE 1B7UA 2HQ0A 5CMKA 3AXFA 4ZS9A 4YKPA 1FQBA 1MH4A 3TEPA 4QFLA 5JEIA 3T9UA 4NF6A 2HXWA 4X48A 3O6IA 4LUBA 4G8MA 2ZYKA 4ZE8A 5BUUA 3RY3A 2QJEA 3VFJA 4OESA 2O84X 3IOUA 5A5XA 1US4A 4F29A 2XX7A 5ICTA 1IEJA 4M1VA 5AA2D 1OQGA 3MZ1A 1B05A 4I62A 4JBZA 4ZEFA 3K1NA 2WKYA 4E0XA 2PYYA 5H8FA 3HN0A 1GGGA 1A40A 5IKBA 4H1XA 4I8CA 3RGYA 2X7PA 1PB8A 1NH8A 2F78A 3ILTB 1LFIA 1JNFA 3TCHA 1MM6A 1M5FA 2V25A 4DZ1A 2IA4A 1WVJA 3HCQA 4KCDA 3OO8A 5CMMA 4PFUA 4RNSA 4LONB 3RLFE 1P1NA 3OOAA 3FJMA 1B3FA 3M3FA 1Y4CA 3O28A 1Y3QA 3TQLA 4NF5B 1MDP1 4N07A 4WEPA 4R2BA 2PT2A 5K2YA 4ZEIA 3T93B 3O2AA 5ELVA 2OLBA 1GR2A 2QRYA 4ECFA 4KFQA 3U94A 2FA7A 4FORA 1D9VA 1IXGA 3G3FA 4OXVA 5H8HA 5L8DA 2DWAA 1JETA 3U1OA 5I2KA 3QSLA 1P1WA 3PV0E 2ZMBA 1TFAA 5AE4A 3TCFA 3MUQA 1US5A 2DE4A 4JSOA 2DWJA 2YPNA 5CRYA 3KN3A 1A99A 4KYSA 5H8SA 4N13A 2PBWA 3G3IA 4QFKA 1FQEA 5FHNA 5H8QA 1IITA 1B3HA 2QPQA 5L9MA 2XXYA 3K6XA 3VE1B 4H67A 3T9HB 2V93A 2DE3A 4AB5A 3C32A 3K6VA 1LAFE 1OIBA 3UA8A 1WDNA 1LAHE 4F3PA 4PETA 2D3IA 1SQYA 2XX9A 4R6KA 4GF8A 4M4GA 1XOCA 4JXIA 1LGBC 5IAIA 4EF1A 3U8QA 1URDA 2XXRA 3RNNA 1DPPA 5TPAB 5DVIA 1VE4A 1BTJA 4OTEA 3G3JA 5KDTA 3T9XB 3FXQA 3VDFA 1MQJA 2G29A 4QSCA 3OEMA 4DXBA 3S9NC 3M3LA 2M8CA 3FVNA 1QKAA 1DTZA 1PBPA 2X26A 2ZYMA 1D4NA 1B46A 4OMBA 1Y3PA 3S9MC 4AQ4A 1Z7NE 4KHZE 3S2VA 5I59B 3LUYA 4PFTA 2RC9A 3SKPA 5ITOA 3P7IA 3EQ1A 2GRVA 3D4CA 3K6UA 3ONMA 4I9DA 3Q27A 4JWYA 2F34A 4ND9A 4WEDA 2FNCA 3HO7A 3PGFA 2I3WA 3CIJA 5EYFA 3CFXA 3CVGA 2F5XA 2I6EA 3PPQA 1URGA 2A5TA 3IB2A 3MPKA 3VXCA 4H5GA 4MLVA 3T9VA 3THIA 2I0CA 1SDXA 2Q2AA 4QF9A 4F39A 4DLDA 2F36A 4KD5A 3TZAA 5B70A 2Y7RA 2ZNSA 2OCUA 3MP6A 2QSXA 2RCAA 4YAHX 4KCCA 1N76A 3T22A 3K1MA 1LAGE 1SW2A 3SEYA 1ZJLA 1B40A 4WKMA 4ELPA 1B4HA 3TAJA 3GBBA 5HPQA 4U4SA 5LOMA 1B1XA 1N0TA 2QMWA 4YKJA 1ZKBA 1LSTA 5L9OA 1MXUA 3PUVE 4QFNA 5M2VA 3QUFA 3V83A 4BDOA 1B5IA 2NXOA 1B2HA 1B58A 3RN8A 1XC1A 3HHFA 4UACA 1LFGA 1UIVA 1ELJA 1N3XA 5AA3A 1R9LA 4U21A 4THIA 2QS4A 1Y20A 2NUVA 3VLWA 4BLAA 3PPOA 3FIRA 3IOTA 4QFOA 3VVDA 1JVXA 4N6PA 3LSFB 3PUZE 5I2NA 5F7VA 4QSEA 4PQJA 4PFYA 3I5OA 3EHUA 4YKKA 4POXA 4G77A 4GWOA 2UYFA 2H99A 3SESA 5AA2A 1B0HA 1L5TA 3MZBA 4BDMA 4U1ZA 5I57A 4U23A 3UIFA 3M8UA 1PC3A 4JWXA 4G2ZA 4NF6B 3HV1A 5DEXA 5DVJA 2Z8FA 4GD5A 2H9BA 1A8FA 3MP8A 1EZOA 1SW4A 1UTHA 5A5XB 1H45A 4R9FA 4F1VA 1H76A 1N3WA 1LB8A 3N6TA 2KLFA 4G8NA 1NMUA 3RQTA 1DMBA 1VFDA 4X1BA 2XXHA 5H8FB 4RPOA 1GVCA 4R9GA 4KR5A 2LAOA 5EHSA 2DWIA 4YMBA 3R26A 4P11A 3H6UA 4RY1A 1S9TA 1FQDA 4OEVA 4MBPA 3C36A 4G4PA 3KZGA 3EHSA 2UVHA 3GXAA 3IR1A 4RPNA 2F97A 4BDNA 3OO9A 5KZTA 5L9SA 2HFBA 1PBQA 4QFPA 3N5LA 1GV8A 5K2XA 3OD7A 3S4UA 1NKXA 3K02A 4XKRA 5JK4A 1J1NA 4XKNA 3KBRA 3B6WA 4GVOA 3GZGA 5H8HB 1T0KA 5I2KB 1OMPA 1M5DA 1QJMA 3H03A 2UVIA 4BDRA 1P1QA 1YCJA 4Q30B 5HM4B 1POY1 2GH9A 1RKMA 3LSXA 1MG1A 2I4BA 3F11A 1UTBB 2I3VA 4JDFA 3K6WA 3WAFA 3MBPA 1IXHA 2OWSA 3PMXA 3CR9A 5H8QB 4IO5A 4DE8A 2F7CA 2F7AA 1HSJA 2HAVA 1S50A 4QRZA 2ANJA 3TKDA 5JTYA 4BDQA 1UIUA 4HTGA 3LR1A 3TTRA 4RA1A 2ZXTA 1IUDA 4U2RA 2O6AA 3JV9A 3LSLA 4DXCA 4EDPA 2H25A 2Q9TA 3PMWA 2O1LA 1TWYA 3TODA 4EQ9A 4OENA 3QYTA 1URSA 3RTWB 3MJNA 5KDTB 3BFUA 3T96B 5ITPA 2I49A 1VSOA 2O7IA 3CRBA 2O68A 3RTFB 2VD2A 4GOTA 2YJPA 4ELQA 4K3FA 5ISUA 3PD9A 4OETA 3O6GA 2HZLA 4IY5A 4RXLA 1LB9A 2HCAA 2NVUB 1ZIUA 4FEDA 3SDFA 3KFMA 1Q35A 4F22A 4C1TA 4OFJA 2I58A 3QIMA 4OWDA 2ONSA 4H8IA 1Y4TA 3W9VA 3TTKA 3W15C 1YAEA 1XT8A 1B5HA 1B7ZA 1N84A 4R72A 2F6GA 1JQFA 3ECRA 3CFLA 3FVOA 4E0WA 3VVEA 2QS2A 1JVYA 1ZLQA 3E3KA 3LBSA 4GRKA 2D21A 2A5TB 3SEVA 4MF3A 1FCKA 3K0VA 2DVCA 1A7LA 2V3QA 3B6TA 2B3BA 4ZZEA 1PB7A 4YB6A 3R7XA 2GHAA 4LZ5A 2DXRA 3ILUB 3FV1A 3HHGA 2F6PA 1N7XA 3O66A 1JEVA 2PX1A 1MXYA 4NMYA 3H6VA 3TPAA 1QW0A 4I1DA 1MY2A 2XXUA 1Z7ME 5DYHA 2XHDA 2XX8A 4Q5TA 2Q2CA 3MWBA 1OVBA 3KSJA 3BBRA 1DPEA 3OO6A 4DCYA 4POWA 4G8HA 4JSDA 3FXUA 3HPIA 4U4XA 4ZEKA 1MRPA 1FTMA 4ESXA 3PU5A 1SI1A 1UQWA 1OLCA 3OO7A 2ESNA 3ZKKA 1B3EA 1MPBA 1B0LA 3FD3A 4LQ2A 1PDAA 5I2NB 2OK2A 1USYE 3FJ7A 2DS9A 3TQWA 3ODBA 4IO7A 3SETA 1PB9A 3H3GA 4O3BA 5AA2B 4FECA 4ZEDA 3C4MA 5I57B 3VLVA 4OFOA 2ZNUA 4F18A 5DEXB 3PPNA 2H4IA 1IIWA 1MQDA 1UTHB 4IGRA 1AOVA 1MY0A 3EHTA 4U22A 5AA1A 3I6VA 2THIA 1NH7A 4EF2A 2RF1A 5EHMA 3S9LC 1P99A 3VXBA 2GFEA 4F3SA 1DSNA 1VFEA 4Z0IA 4DXUA 4X9TA 2V84A 4GIZA 1LAXA 1MXXA 5CMBA 4FATA 1M5BA 3KG2A 1LCTA 4YB7A 1LBBA 1B52A 3OEKA 4HW8A 1HSEA 2UXAA 2R9JA 1B1HA 4C1UA 4OZ9A 2VHAA 3H6TA 3PUWE 4IO2A 3DP8A 1EZPA 2DVZA 3E13X 4R2FA 3KEIA 4NF4A 3LC8A 5FHMA 3FVKA 3TCGA 4PFWA 4ONYA 2PVUA 1RYOA 4P0GA 2HAUA 1JEUA 2XD3A 4NTLA 2P0SA 2I0BA 4GFRA 3TFLA 2QS3A 3D4GA 4MFIA 4NF8A 2AYSA 5TP9A 3MPLA 3TUSA 1MQIA 3VV5A 3TTMA 2CZLA 3H06B 1KWHA 1FTJA 1M5CA 3DLNA 4RK2A 2AL4A 3V89B 2D5WA 1YPNA 3E4RA 4DCXA 1SW5A 5ICQA 1FTLA 2Z22A 5JTYB 1ZBMA 4XTCQ 2RKMA 3KJ7A 4O3CA 4G68C 4JWOA 2Y7IA 3DELB 4FIMA 3O9PA 4OVJA 3TTLA 3DP4A 1NNTA 2DQVA 3IL1B 3SEUA 3OSQA 1MXVA 3PPPA 4GQOA 2W7YA 2REGA 3MZ9A 4MLQA 3SERA 1II5A 1FQFA 5KCJA 3O6HA 2FYIA 1MH3A 3KOSA 2RCBA 4IO3A 1MXZA 2Z8EA 4YZZA 3KOTA 2B65A 4EUOA 2AIXA 1I6AA 1SYIA 3A09A 3N94A 1B9JA 2Q8JA 5I56A 1LCFA 4ELRA 1FQCA 1OQHA 1H3DA 1XVYA 2F7BA 2O1MA 2X7QA 4R6HA 4F2OA 1XHYA 1JW5A 4JB7A 3U72A 4FEBA 1GTKA 1R6ZA 3G3KA 2ALUA 4ESWA 1TT1A 1MQGA 4H6DA 3UN6A 2NOOA 4G68A 5CI5A 3OELA 1XS5A 3MW0A 3TYHA 2REJA 2OBGA 1R9QA 4Q8RA 4UA8A 1FQAA 3V5AA 4WXJA 2Z8DA 3IK6B 4P0IA 4NWCA 2VP1A 2DWHA 3PPRA 3GLBA 4LZ8A 1NFTA 5I58A 2O51A 3N6UA 3I3VA 3A3CA 4C0RA 2P1SA 1MPDA 2XXTA 4L17A 1QKBA 4ZZAA 4HCYA 2ZYOA 4LQ5A 3VVFA 3IOVA 3L6GA 4GXSB 1XVXA 3IORA 3ZKLA 2Z23A 1NL5A 3BKIB 5H8NA 4GXAA 1FW0A 3A3UA 1Q1KA 3GBAA 1EZ9A 4EXKA 1SW1A 3ZS6A 3H7MA 4MH5A 3EPEA 4OYVA 1DTGA 1AIVA 4X1DA 3Q29A 1B3GA 4HS7A 4NEDA 4YMAA 1S7YA 3K2DA 1F9BA 3G3GA 4FJPA 2H5YA 5J1DA 3T66A 3U93A 4EQ7A 4RYAA 3S9EA 3CI8A 4LATA 4H65A 2B3FA 1D3KA 4LA9A 1SI0A 2RC8A 4KYEA 3C9HA 1ZTYA 4XKPA 2Y7KA 1QUJA 4F19A 2XXVA 3FVGA 3IO4A 3RPWA 1BP5A 4FAJA 3O97A 3V8XB 2UYEA 1TXFA 5AA4A 3CG3A 1R1NA 2O69A 4NE4A 4H8JA 1B5JA 1CB6A 2VGQA 3M3KA 1EH3A 3MVYA 1WODA 3TDJA 1Y1MA 3VLUA 1IXIA 1NNFA 4RK9A 4F31B 1QVSA 1N04A 2V3TA 1I6QA 3G7WA 3KN7A 1MY3A 1UTBA 2XXQA 1YTVA 2I48A 3MP1A 3Q26A 4YB5A 2XXXA 3QK6A 2ZYNA 1A54A 5CBSA 4KQPA 1P1UA 4YU0A 1IXCA 2XXPA 2Q88A 4AB6A 5FTHA 3QUJA 4DIGA 3IJXB 1O63A 1AH5A 2IEEA 4KYDA 2XXWA 4HCWA 3B6QA 2NWJA 5FHOA 1RYXA 1O64A 4ZDMA 5DVFA 2HEUA 4GL8A 2P2AA 4F1UA 2VD3A 3OSRA 1MPCA 1ZMGA 1B3LA 2XXIA 3C33A 3OXNA 4R73A 4NF4B 4F1YA 1I69A 3UGWA 1QUIA 3FJGA 5BWJA 3JYRA 4ZE9A 2GHBA 2DSFA 5DTBA 4O3AA 2Q89A 3TTNA 4NF8B 1SYHA 1VR5A 4IO4A 1FTOA 3EN3A 3FUZA 3FATA 4OEUA 5DT6A 1TFDA 5TP9B 4XXUA 2HZKA 1IQ7A 3IB1A 3IB0A 2V3UA 4LZ7A 1H44A 1D9YA 4KI0E 5CM6A 2UVJA 5HBCA 3Q25A 3CFZA 4OERA 4NF5A 3K00A 3CSBA 2DE2A 2F35A 4OFLA 1P1OA 3G3HA 1Y1ZA 2XD2A 3FASA 2DOJA 3MQ9A 5F1QA 1ZU0A 2F8DA 4FE8A 1NNKA 3W9WA 3SEWA 3N26A 3O29A 2R6GE 1OVTA 1HSLA 2PT1A 1QUKA 1JW4A 4OQOA 1MM7A 1LFHA 3PD8A 4IY6A 4BDLA 4QHQA 1AMFA 1MY1A 2RINA 2ZNTA 2H98A 4TQUQ 4EXLA 3SEXA 5KCJB 4EQBA 4TLMB 2ONRA 5TU0A 3C35A 1B51A 1SVXB 3TMGA 1USYH 3PUXE 3UORA 1BLFA 3IJOB 2OZZA 5I56B 4YKIA 1AL3A 4U1OA 3USDA 3TELA 5B7DA 3OMBA 2Y84A 5TPAA 1MQHA 4OHNA 2R71A 1MS7A 4R74A 3IO6A 3FXRA 4IB2A 4ELOA 2DYXA 3WAEA 1ANFA 3R6UA 4GL0A 1N7WA 3E9XA 1H43A 4G68B 3MVWA 1SBPA 3RUMA 1PEBA 4DDDA 3FV2A 4TOZA 4PE5B 3FGSA 1B32A 1FTKA 4F3GA
chains in the Genus database with same CATH superfamily
4TLLB 5I59A 3DM0A 4ZECA 5I3SA 3CG1A 3FXBA 1MXWA 4R75A 1B6HA 4MEVA 4GLIA 5I58B 4R6YA 2RC7A 3LUZA 4PP0A 3MAMA 2E0SA 3H6WA 2ZZXA 3CSGA 4RJZA 2E1SA 2F3BA 2I4CA 3PUYE 4GBVA 1EU8A 3K1PA 5I84A 4F3BA 3K4UA 1MDQA 2QL3A 2O7UA 4ISUA 3KGCA 5J16A 3L6HA 4H0WA 1QULA 4OA4A 3QXMA 4NWDA 5H8NB 4KPTA 3IX1A 1Y9UA 3Q28A 3B7DA 4H5FA 4IGTA 4Q0CA 4I3YA 3EF7A 1Y3NA 1O7TA 5IGAA 3K01A 1FSAA 4IO6A 2OWTA 3RT6B 3UP9A 1YXIA 2VOZA 3MC2A 1ATGA 4Z7EA 1B7HA 4QBAA 2BJJX 3RPLA 5IM2A 5CMCA 4MIJA 3C34A 4YICA 3IAZA 4PFBA 2OJTA 2QMXA 3BFTA 4F2QA 2FBPA 4QSDA 4LP2B 1I6BA 1A8EA 4XIGQ 3C31A 3KSXA 2YLNA 5IZ3A 5CBRA 1NNPA 3PMVA 1BIYA 2A5SA 2HPGA 1MY4A 4PDDA 3OENA 3KN8A 4O94A 1CE2A 2DP8A 2UVGA 2DXYA 5CC2A 1LLSA 2Y7WA 1BKAA 3H4ZA 1LBCA 2HHMA 3IOWA 1DOTA 1JW1A 2AL5A 3QAXA 2QS1A 4LVQA 2CMOA 1OLAA 3UK4A 4ZEBA 3T1BA 5AA4B 5FTIA 1POTA 1B4ZA 3KJTA 3U92A 1SD3A 2G93A 5ET6A 2Y7PA 2ABHA 4GX3A 3ZSFA 3FZVA 4IR8A 3JZJA 2PMSA 1IZ1A 4XKQA 1M5EA 3DP6A 2PCRA 1RDXA 3LSWA 3MVZA 1A55A 3RT8A 3MVXA 4PF6A 3HSTA 2ONKE 5LTCA 1B7UA 2HQ0A 5CMKA 3U65A 3AXFA 4PDHA 4ZS9A 4YKPA 1FQBA 1MH4A 3D1RA 3TEPA 4QFLA 5T3JA 5JEIA 3T9UA 4NF6A 2HXWA 4X48A 3O6IA 4LUBA 4G8MA 2ZYKA 4ZE8A 5BUUA 3RY3A 2QJEA 3VFJA 4OESA 2O84X 3IOUA 3QMFA 5A5XA 1US4A 4F29A 2XX7A 5ICTA 1IEJA 4M1VA 5AA2D 5EQ9A 1OQGA 3MZ1A 4NF0A 1B05A 4I62A 4JBZA 4ZEFA 4UABA 3K1NA 2WKYA 4E0XA 2PYYA 5H8FA 3HN0A 1GGGA 3NOHA 1A40A 5IKBA 5EQ8A 3MSTA 4H1XA 3IFAA 4I8CA 3RGYA 1NI9A 2X7PA 1PB8A 1NH8A 2F78A 3ILTB 1LFIA 1JNFA 3TCHA 1MM6A 1M5FA 2V25A 4DZ1A 2IA4A 1WVJA 3HCQA 4KCDA 3OO8A 4XF5A 5CMMA 4PFUA 1NV1A 4RNSA 4LONB 4NHBA 3RLFE 1P1NA 3OOAA 3FJMA 1B3FA 3M3FA 4MMPA 1Y4CA 3O28A 1Y3QA 3TQLA 2WYPA 1FPEA 4NF5B 1MDP1 4N07A 4WEPA 4R2BA 2PT2A 5K2YA 4ZEIA 3T93B 3O2AA 5ELVA 2OLBA 1GR2A 2PFZA 2QRYA 4ECFA 4KFQA 4PGNA 3U94A 4AS5A 2FA7A 4FORA 1D9VA 1IXGA 3G3FA 4OXVA 5H8HA 5L8DA 2DWAA 1JETA 4PE3A 3U1OA 5I2KA 3QSLA 1P1WA 3PV0E 2ZMBA 1TFAA 5AE4A 3TCFA 3MUQA 1US5A 2DE4A 4JSOA 2DWJA 4N8YA 2YPNA 5CRYA 3KN3A 1A99A 2Q8MA 4KYSA 5H8SA 4N13A 2PBWA 3G3IA 4QFKA 4NX1A 1IMEA 1FQEA 5FHNA 5H8QA 1IITA 1B3HA 2QPQA 5L9MA 2XXYA 3K6XA 3VE1B 4H67A 3T9HB 2V93A 2QFLA 2DE3A 4AB5A 3C32A 3K6VA 1LAFE 1OIBA 3UA8A 1WDNA 1LAHE 2FHYA 4F3PA 4PETA 4OVSA 2D3IA 5IZ1A 1SQYA 2XX9A 4R6KA 5ET8A 5ET7A 4GF8A 4M4GA 1XOCA 4JXIA 1G0IA 1LGBC 5IAIA 4EF1A 3U8QA 1FBFA 1SPIA 1URDA 2XXRA 3RNNA 4NQ8A 1DPPA 5TPAB 2Y5LA 1FPDA 5DVIA 1VE4A 1BTJA 4OTEA 3G3JA 5KDTA 3T9XB 3FXQA 3VDFA 4HE2A 1MQJA 2G29A 4QSCA 1FRPA 3OEMA 4DXBA 2XA5A 3S9NC 3MYUA 3M3LA 2M8CA 3FVNA 1QKAA 1DTZA 1PBPA 2X26A 1VDWA 2ZYMA 1D4NA 1B46A 4OMBA 4MHFA 1Y3PA 3S9MC 2MKZA 4AQ4A 1Z7NE 4KHZE 3S2VA 4PBQA 4PGPA 5I59B 2HXRA 4H45A 3LUYA 4PFTA 2ZZVA 2RC9A 3SKPA 5ITOA 3P7IA 3EQ1A 2GRVA 3D4CA 2VPOA 2WX9A 3K6UA 3ONMA 3LV0A 2QVUA 4I9DA 1FPJA 3Q27A 4JWYA 2F34A 4ND9A 4WEDA 2FNCA 3HO7A 3PGFA 2I3WA 3CIJA 5EYFA 3CFXA 3CVGA 2F5XA 4NN3A 2I6EA 3PPQA 4NAPA 1URGA 1NUWA 2A5TA 3IB2A 3MPKA 3VXCA 4H5GA 4MLVA 3T9VA 3THIA 2I0CA 1SDXA 2Q2AA 4QF9A 3B50A 4F39A 4DLDA 2F36A 4KD5A 3TZAA 5B70A 2Y7RA 3RPLB 2ZNSA 2OCUA 3MP6A 4PBHA 2QSXA 2RCAA 4YAHX 4NGUA 4KCCA 1N76A 3T22A 3K1MA 1LAGE 1SW2A 3SEYA 1ZJLA 4AS4A 1B40A 1CNQA 4WKMA 4ELPA 1B4HA 3TAJA 5EYGA 3GBBA 5IZ3B 5HPQA 4U4SA 5LOMA 1B1XA 1N0TA 2QMWA 4YKJA 1ZKBA 1FPIA 4P1EA 1LSTA 5L9OA 1MXUA 3PTYA 3PUVE 4QFNA 5M2VA 3QUFA 3V83A 4BDOA 1RDYA 1B5IA 2NXOA 1B2HA 1B58A 3RN8A 1XC1A 3HHFA 4UACA 1LFGA 1UIVA 1ELJA 1N3XA 5AA3A 1R9LA 4U21A 4THIA 2QS4A 1Y20A 2P3VA 2NUVA 3VLWA 4BLAA 3PPOA 3FIRA 3IOTA 3SZPA 4QFOA 3VVDA 1JVXA 1FTAA 4N6PA 3LSFB 3PUZE 5I2NA 5F7VA 4QSEA 4O7IA 2CZIA 2XWKA 4PQJA 4PFYA 3I5OA 4PAKA 3EHUA 4YKKA 4POXA 1DBZA 4G77A 4GWOA 2UYFA 2H99A 3SESA 5AA2A 1B0HA 1L5TA 3MZBA 4BDMA 4U1ZA 5I57A 4U23A 3UIFA 3M8UA 1PC3A 1FBEA 4JWXA 4G2ZA 4NF6B 3HV1A 5DEXA 5DVJA 2Z8FA 4GD5A 2H9BA 3B8BA 1A8FA 3MP8A 1EZOA 1SW4A 1NV3A 1UTHA 4P9KA 5A5XB 1H45A 2XWIA 3E78A 4R9FA 4F1VA 1H76A 1FPBA 1N3WA 1LEVA 1LB8A 3N6TA 2KLFA 4G8NA 1NMUA 3RQTA 1DMBA 1VFDA 4X1BA 2XXHA 5H8FB 4RPOA 1GVCA 1KA1A 4R9GA 4KR5A 2LAOA 5EHSA 2DWIA 1NV4A 4HXVA 4YMBA 3R26A 4P11A 1FPLA 3H6UA 1JP4A 4RY1A 1S9TA 4JVIA 1FQDA 4OEVA 4MBPA 3C36A 4G4PA 3KZGA 3EHSA 2UVHA 3GXAA 1NUYA 3IR1A 4RPNA 2F97A 4BDNA 3OO9A 5KZTA 4OVQA 5L9SA 4OVPA 2HFBA 1PBQA 4QFPA 4LN5A 3N5LA 1GV8A 5K2XA 4PCDA 3OD7A 3S4UA 1NKXA 5FBPA 3K02A 2XWOA 4XKRA 5JK4A 1J1NA 4XKNA 2F3DA 3KBRA 3B6WA 4GVOA 3GZGA 4X04A 2Y5KA 5H8HB 1T0KA 2OWZA 5I2KB 4MX6A 1OMPA 1M5DA 1QJMA 3H03A 2UVIA 4BDRA 1P1QA 2QVRA 1YCJA 4Q30B 5HM4B 1POY1 2GH9A 1RKMA 4QXDA 3LSXA 1MG1A 2I4BA 3FBPA 3F11A 1UTBB 4N6DA 2I3VA 4JDFA 3K6WA 3WAFA 3MBPA 1IXHA 2OWSA 3PMXA 1EYIA 3CR9A 5H8QB 4IO5A 4DE8A 2F7CA 5LDZA 2F7AA 1HSJA 2HAVA 1S50A 4QRZA 2ANJA 3TKDA 4O7MA 5JTYA 1LBVA 4BDQA 1UIUA 4HTGA 3LR1A 3TTRA 4RA1A 2ZXTA 1IUDA 4U2RA 2O6AA 3JV9A 3LSLA 4DXCA 4EDPA 2H25A 2Q9TA 3PMWA 2O1LA 1TWYA 1K9ZA 3TODA 4EQ9A 4OENA 3QYTA 1URSA 1NV5A 4XEQA 3RTWB 3MJNA 2XXKA 5KDTB 1FPFA 3BFUA 3KC1A 1BK4A 3T96B 5ITPA 1NUXA 2I49A 1VSOA 2O7IA 3CRBA 2O68A 3RTFB 2VD2A 4GOTA 4PC9A 2YJPA 4ELQA 4K3FA 3CHGA 5ISUA 3PD9A 1FPGA 3O6GA 4OETA 2HZLA 3T0JA 4IY5A 4RXLA 1LB9A 2HCAA 2NVUB 4JVCA 1ZIUA 2CEXA 4FEDA 3SDFA 3KFMA 1Q35A 4F22A 4C1TA 3ISPA 4OFJA 2I58A 3QIMA 4OWDA 2ONSA 2B4LA 4H8IA 1Y4TA 3W9VA 1LBZA 3TTKA 3W15C 1YAEA 1XT8A 4N91A 1B5HA 1B7ZA 1N84A 4R72A 4DI4B 2F6GA 1JQFA 3ECRA 3CFLA 3FVOA 4E0WA 3VVEA 1IMDA 3A29A 2QS2A 1JVYA 1ZLQA 3E3KA 3LBSA 4GRKA 2D21A 2A5TB 1YZ0A 3SEVA 2CZHA 4MF3A 1FCKA 3K0VA 2DVCA 1Q9DA 1A7LA 2V3QA 3B6TA 2B3BA 4ZZEA 1PB7A 4YB6A 3R7XA 2GHAA 4LZ5A 1NV6A 2DXRA 3ILUB 3FV1A 3HHGA 4PFIA 2F6PA 1N7XA 3O66A 3BIGA 1JEVA 2PX1A 4N17A 1MXYA 4NMYA 3H6VA 3TPAA 1QW0A 4I1DA 1MY2A 2XXUA 4MAGA 2WBDA 1Z7ME 2VPNA 4PFRA 5DYHA 2XHDA 2XX8A 1FJ9A 4Q5TA 2Q2CA 3MWBA 1OVBA 3KSJA 3BBRA 1DPEA 3OO6A 4DCYA 4POWA 4G8HA 4JSDA 3FXUA 5ESYA 1EYKA 3HPIA 4U4XA 4ZEKA 4P47A 1MRPA 1FTMA 1FBDA 4ESXA 3PU5A 1SI1A 2CEYA 1UQWA 1OLCA 3OO7A 2ESNA 3ZKKA 1B3EA 1MPBA 1B0LA 3FD3A 4LQ2A 1PDAA 5I2NB 2OK2A 1USYE 3FJ7A 2DS9A 1XI6A 3TQWA 3ODBA 4IO7A 3SETA 1PB9A 2BJIA 3H3GA 4O3BA 5AA2B 4FECA 2KQZA 4ZEDA 3C4MA 5I57B 3VLVA 4OFOA 2ZNUA 4I40A 5I7IA 4F18A 5DEXB 3PPNA 2H4IA 1IIWA 1MQDA 1UTHB 4N15A 4IGRA 3HFUA 1AOVA 1MY0A 3EHTA 4U22A 5AA1A 3I6VA 4GWWA 2THIA 1NH7A 4EF2A 2RF1A 1FBHA 2PFYA 5EHMA 4G61A 3S9LC 1P99A 3VXBA 2GFEA 2JJKA 4P8BA 4F3SA 1DSNA 1VFEA 4Z0IA 4DXUA 4X9TA 2V84A 4GIZA 1LAXA 1MXXA 5CMBA 4FATA 1M5BA 3KG2A 1LCTA 1KA0A 2WEFA 4YB7A 1LBBA 2ZZWA 1B52A 3OEKA 4HW8A 1HSEA 2UXAA 2R9JA 1B1HA 4C1UA 4OZ9A 2VHAA 3H6TA 3PUWE 4IO2A 3DP8A 1EZPA 2DVZA 4FBPA 4GWZA 3E13X 4R2FA 3KEIA 4NF4A 3LC8A 5FHMA 3FVKA 3TCGA 4PFWA 4ONYA 2PVUA 1RYOA 4P0GA 2HAUA 4GBWA 1JEUA 3E79A 4X8RA 2XD3A 4NTLA 2KR0A 2P0SA 2I0BA 4GFRA 3TFLA 2QS3A 3D4GA 4MFIA 5IZZA 4NF8A 4N6KA 2AYSA 5TP9A 3MPLA 3TUSA 1MQIA 3VV5A 3TTMA 2CZLA 3H06B 1KWHA 1FTJA 1M5CA 3DLNA 4RK2A 2AL4A 2WYKA 2FIXA 3V89B 1LBXA 2D5WA 4MNPA 4MNCA 1YPNA 5A5LA 4MJOA 3E4RA 4DCXA 1SW5A 5ICQA 4OVRA 1FTLA 2Z22A 5JTYB 1ZBMA 4XTCQ 2RKMA 3KJ7A 4O3CA 4G68C 4JWOA 2Y7IA 3DELB 4FIMA 3BIHA 3O9PA 4OVJA 4XFEA 3TTLA 3DP4A 1NNTA 2OX3A 2DQVA 3IL1B 3SEUA 3OSQA 1MXVA 3PPPA 4GQOA 2FVZA 2W7YA 2REGA 3MZ9A 4GWYA 4MLQA 3SERA 1II5A 1FQFA 5KCJA 4N81A 3O6HA 2FYIA 1NV0A 1MH3A 3KOSA 2RCBA 4IO3A 5EQAA 1MXZA 2Z8EA 4YZZA 3KOTA 2B65A 1KZ8A 2AIXA 1I6AA 4EUOA 1SYIA 3A09A 3N94A 1B9JA 2Q8JA 5I56A 1FBPA 1NV7A 1LCFA 4ELRA 1FQCA 1OQHA 2L5VA 1H3DA 2CZKA 1XVYA 2F7BA 2O1MA 2X7QA 1IMFA 2R8TA 4R6HA 4F2OA 1XHYA 1JW5A 4JB7A 1DK4A 3U72A 4FEBA 1GTKA 1R6ZA 3G3KA 2ALUA 4KXPA 5EQ7A 4ESWA 1TT1A 1G0HA 1K9YA 1MQGA 4H6DA 3UN6A 2NOOA 4G68A 5CI5A 3OELA 1XS5A 3MW0A 3TYHA 2REJA 2OBGA 1R9QA 4Q8RA 4UA8A 1FQAA 3V5AA 4WXJA 2Z8DA 3IK6B 4P0IA 4NWCA 2VP1A 2DWHA 3PPRA 4PF8A 3GLBA 4LZ8A 2WBBA 4DI3D 1NFTA 5I58A 2O51A 4GX4A 3KC0A 3N6UA 3I3VA 3A3CA 4C0RA 2P1SA 1MPDA 2XXTA 4NG7A 4L17A 1QKBA 4ZZAA 4HCYA 2ZYOA 4LQ5A 3VVFA 3IOVA 3L6GA 4GXSB 1XVXA 3IORA 3ZKLA 2Q74A 2Z23A 4I3EA 1NL5A 3BKIB 5H8NA 4GXAA 1FW0A 3A3UA 1Q1KA 3ROJA 1YYZA 3GBAA 1EZ9A 4EXKA 1SW1A 3ZS6A 1IMCA 3H7MA 4MH5A 3EPEA 4OYVA 1DTGA 1AIVA 4X1DA 3Q29A 1LBWA 4GWXA 1B3GA 4HS7A 4NEDA 4YMAA 1S7YA 3K2DA 1F9BA 3G3GA 4FJPA 2H5YA 5J1DA 3T66A 3U93A 4EQ7A 4RYAA 3S9EA 3CI8A 4LATA 4H65A 2B3FA 1D3KA 4LA9A 1SI0A 2RC8A 2B4MA 2QVVA 2XWVA 4KYEA 4GX6A 3C9HA 5ET5A 1ZTYA 4XKPA 2Y7KA 4O8MA 1QUJA 4F19A 3IFCA 2XXVA 3FVGA 3IO4A 1EYJA 4HE1A 3RPWA 1BP5A 4FAJA 3O97A 3V8XB 4P3LA 2UYEA 1TXFA 5AA4A 1INPA 3CG3A 2GQ1A 1R1NA 2O69A 4NE4A 4H8JA 1B5JA 1CB6A 2VGQA 3M3KA 1EH3A 3MVYA 1WODA 3TDJA 1Y1MA 1IMBA 3VLUA 1IXIA 1NNFA 4RK9A 4F31B 5I5PA 1QVSA 1N04A 2V3TA 1I6QA 3G7WA 3KN7A 1MY3A 1AWBA 1NUZA 1UTBA 2XXQA 1FBGA 1YTVA 2I48A 3MP1A 3Q26A 4YB5A 4MNIA 2XXXA 3QK6A 2ZYNA 1A54A 5CBSA 4PAIA 4KQPA 1P1UA 4YU0A 1IXCA 4MCOA 2XXPA 2Q88A 4AB6A 5FTHA 3QUJA 4DIGA 3IJXB 1O63A 1AH5A 2IEEA 4KYDA 2XXWA 4HCWA 3B6QA 2NWJA 5FHOA 1RYXA 1O64A 3EKIA 4ZDMA 5DVFA 2HEUA 4GL8A 5F24A 2P2AA 4F1UA 2V4CA 2VD3A 3OSRA 1MPCA 1ZMGA 1B3LA 2XXIA 3C33A 3OXNA 4OANA 4R73A 4NF4B 4F1YA 1I69A 3UGWA 4OVTA 1D9QA 1QUIA 3FJGA 5BWJA 3JYRA 4ZE9A 2GHBA 2DSFA 5DTBA 4O3AA 2Q89A 3TTNA 4NF8B 1RDZA 1SYHA 4P56A 1VR5A 1FJ6A 4IO4A 1FTOA 2P3NA 3EN3A 3FUZA 3FATA 4OEUA 5DT6A 1TFDA 5TP9B 4XXUA 2HZKA 1IQ7A 3IB1A 3IB0A 4HE0A 2V3UA 4LZ7A 1H44A 1D9YA 4KI0E 5CM6A 2UVJA 5EYHA 5HBCA 3Q25A 3CFZA 4OERA 4NF5A 2DDKA 3K00A 3CSBA 2DE2A 1DCUA 2F35A 4OFLA 1P1OA 3G3HA 1Y1ZA 2XD2A 3FASA 2DOJA 3MQ9A 5F1QA 1ZU0A 2F8DA 4FE8A 4N8GA 1NNKA 3W9WA 3SEWA 3N26A 3O29A 2R6GE 1OVTA 1HSLA 2PT1A 1QUKA 1JW4A 4OQOA 1MM7A 1LBYA 1LFHA 3PD8A 4IY6A 4BDLA 4QHQA 1AMFA 1MY1A 2RINA 2ZNTA 4H46A 2H98A 4TQUQ 4EXLA 3SEXA 5KCJB 2VT5A 4EQBA 4GWSA 4TLMB 2ONRA 5TU0A 3C35A 1B51A 1SVXB 3TMGA 1USYH 3PUXE 3UORA 1BLFA 3IJOB 2OZZA 5I56B 4YKIA 2FIEA 1AL3A 4U1OA 3USDA 1IMAA 3TELA 5B7DA 3OMBA 2Y84A 4PTKA 5TPAA 3GYYA 1MQHA 4OHNA 4N4UA 1FBCA 4PAFA 2R71A 1MS7A 4R74A 3IO6A 3FXRA 4IB2A 4ELOA 3KBZA 5DW8A 2DYXA 3WAEA 1FPKA 1ANFA 3R6UA 4GL0A 4GWUA 1N7WA 3E9XA 1H43A 1NV2A 1QGXA 4G68B 3MVWA 1SBPA 4P1LA 3RUMA 1PEBA 4JVDA 4DDDA 3FV2A 4TOZA 4PE5B 3FGSA 1B32A 3RYDA 1FTKA 4F3GA
chains in the Genus database with same CATH topology
4TLLB 5I59A 3DM0A 4ZECA 3CG1A 1MXWA 4R75A 1B6HA 4GLIA 5I58B 4R6YA 2RC7A 4PP0A 3MAMA 2E0SA 3H6WA 3CSGA 4RJZA 2E1SA 2I4CA 3PUYE 1EU8A 3K1PA 5I84A 4F3BA 3K4UA 1MDQA 2QL3A 2O7UA 4ISUA 3KGCA 3L6HA 4H0WA 1QULA 3QXMA 4NWDA 5H8NB 4KPTA 3IX1A 1Y9UA 3Q28A 3B7DA 4H5FA 4IGTA 4Q0CA 3EF7A 1Y3NA 1O7TA 3K01A 4IO6A 2OWTA 3RT6B 3UP9A 2VOZA 3MC2A 1ATGA 4Z7EA 1B7HA 2BJJX 5CMCA 3C34A 4YICA 3IAZA 2OJTA 2QMXA 3BFTA 4F2QA 4QSDA 4LP2B 1I6BA 1A8EA 4XIGQ 3C31A 3KSXA 2YLNA 5CBRA 1NNPA 3PMVA 1BIYA 2A5SA 1MY4A 3OENA 3KN8A 1CE2A 2DP8A 2UVGA 2DXYA 5CC2A 1LLSA 2Y7WA 1BKAA 3H4ZA 1LBCA 3IOWA 1DOTA 1JW1A 2AL5A 3QAXA 2QS1A 4LVQA 2CMOA 1OLAA 3UK4A 4ZEBA 5AA4B 5FTIA 1POTA 1B4ZA 3KJTA 3U92A 1SD3A 2G93A 2Y7PA 2ABHA 3ZSFA 3FZVA 3JZJA 2PMSA 1IZ1A 4XKQA 1M5EA 3DP6A 3LSWA 3MVZA 1A55A 3RT8A 3MVXA 3HSTA 2ONKE 1B7UA 2HQ0A 5CMKA 3AXFA 4ZS9A 4YKPA 1FQBA 1MH4A 3TEPA 4QFLA 5JEIA 3T9UA 4NF6A 2HXWA 4X48A 3O6IA 4LUBA 4G8MA 2ZYKA 4ZE8A 5BUUA 3RY3A 2QJEA 3VFJA 4OESA 2O84X 3IOUA 5A5XA 1US4A 4F29A 2XX7A 5ICTA 1IEJA 4M1VA 5AA2D 1OQGA 3MZ1A 1B05A 4I62A 4JBZA 4ZEFA 3K1NA 2WKYA 4E0XA 2PYYA 5H8FA 3HN0A 1GGGA 1A40A 5IKBA 4H1XA 4I8CA 3RGYA 2X7PA 1PB8A 1NH8A 2F78A 3ILTB 1LFIA 1JNFA 3TCHA 1MM6A 1M5FA 2V25A 4DZ1A 2IA4A 1WVJA 3HCQA 4KCDA 3OO8A 5CMMA 4PFUA 4RNSA 4LONB 3RLFE 1P1NA 3OOAA 3FJMA 1B3FA 3M3FA 1Y4CA 3O28A 1Y3QA 3TQLA 4NF5B 1MDP1 4N07A 4WEPA 4R2BA 2PT2A 5K2YA 4ZEIA 3T93B 3O2AA 5ELVA 2OLBA 1GR2A 2QRYA 4ECFA 4KFQA 3U94A 2FA7A 4FORA 1D9VA 1IXGA 3G3FA 4OXVA 5H8HA 5L8DA 2DWAA 1JETA 3U1OA 5I2KA 3QSLA 1P1WA 3PV0E 2ZMBA 1TFAA 5AE4A 3TCFA 3MUQA 1US5A 2DE4A 4JSOA 2DWJA 2YPNA 5CRYA 3KN3A 1A99A 4KYSA 5H8SA 4N13A 2PBWA 3G3IA 4QFKA 1FQEA 5FHNA 5H8QA 1IITA 1B3HA 2QPQA 5L9MA 2XXYA 3K6XA 3VE1B 4H67A 3T9HB 2V93A 2DE3A 4AB5A 3C32A 3K6VA 1LAFE 1OIBA 3UA8A 1WDNA 1LAHE 4F3PA 4PETA 2D3IA 1SQYA 2XX9A 4R6KA 4GF8A 4M4GA 1XOCA 4JXIA 1LGBC 5IAIA 4EF1A 3U8QA 1URDA 2XXRA 3RNNA 1DPPA 5TPAB 5DVIA 1VE4A 1BTJA 4OTEA 3G3JA 5KDTA 3T9XB 3FXQA 3VDFA 1MQJA 2G29A 4QSCA 3OEMA 4DXBA 3S9NC 3M3LA 2M8CA 3FVNA 1QKAA 1DTZA 1PBPA 2X26A 2ZYMA 1D4NA 1B46A 4OMBA 1Y3PA 3S9MC 4AQ4A 1Z7NE 4KHZE 3S2VA 5I59B 3LUYA 4PFTA 2RC9A 3SKPA 5ITOA 3P7IA 3EQ1A 2GRVA 3D4CA 3K6UA 3ONMA 4I9DA 3Q27A 4JWYA 2F34A 4ND9A 4WEDA 2FNCA 3HO7A 3PGFA 2I3WA 3CIJA 5EYFA 3CFXA 3CVGA 2F5XA 2I6EA 3PPQA 1URGA 2A5TA 3IB2A 3MPKA 3VXCA 4H5GA 4MLVA 3T9VA 3THIA 2I0CA 1SDXA 2Q2AA 4QF9A 4F39A 4DLDA 2F36A 4KD5A 3TZAA 5B70A 2Y7RA 2ZNSA 2OCUA 3MP6A 2QSXA 2RCAA 4YAHX 4KCCA 1N76A 3T22A 3K1MA 1LAGE 1SW2A 3SEYA 1ZJLA 1B40A 4WKMA 4ELPA 1B4HA 3TAJA 3GBBA 5HPQA 4U4SA 5LOMA 1B1XA 1N0TA 2QMWA 4YKJA 1ZKBA 1LSTA 5L9OA 1MXUA 3PUVE 4QFNA 5M2VA 3QUFA 3V83A 4BDOA 1B5IA 2NXOA 1B2HA 1B58A 3RN8A 1XC1A 3HHFA 4UACA 1LFGA 1UIVA 1ELJA 1N3XA 5AA3A 1R9LA 4U21A 4THIA 2QS4A 1Y20A 2NUVA 3VLWA 4BLAA 3PPOA 3FIRA 3IOTA 4QFOA 3VVDA 1JVXA 4N6PA 3LSFB 3PUZE 5I2NA 5F7VA 4QSEA 4PQJA 4PFYA 3I5OA 3EHUA 4YKKA 4POXA 4G77A 4GWOA 2UYFA 2H99A 3SESA 5AA2A 1B0HA 1L5TA 3MZBA 4BDMA 4U1ZA 5I57A 4U23A 3UIFA 3M8UA 1PC3A 4JWXA 4G2ZA 4NF6B 3HV1A 5DEXA 5DVJA 2Z8FA 4GD5A 2H9BA 1A8FA 3MP8A 1EZOA 1SW4A 1UTHA 5A5XB 1H45A 4R9FA 4F1VA 1H76A 1N3WA 1LB8A 3N6TA 2KLFA 4G8NA 1NMUA 3RQTA 1DMBA 1VFDA 4X1BA 2XXHA 5H8FB 4RPOA 1GVCA 4R9GA 4KR5A 2LAOA 5EHSA 2DWIA 4YMBA 3R26A 4P11A 3H6UA 4RY1A 1S9TA 1FQDA 4OEVA 4MBPA 3C36A 4G4PA 3KZGA 3EHSA 2UVHA 3GXAA 3IR1A 4RPNA 2F97A 4BDNA 3OO9A 5KZTA 5L9SA 2HFBA 1PBQA 4QFPA 3N5LA 1GV8A 5K2XA 3OD7A 3S4UA 1NKXA 3K02A 4XKRA 5JK4A 1J1NA 4XKNA 3KBRA 3B6WA 4GVOA 3GZGA 5H8HB 1T0KA 5I2KB 1OMPA 1M5DA 1QJMA 3H03A 2UVIA 4BDRA 1P1QA 1YCJA 4Q30B 5HM4B 1POY1 2GH9A 1RKMA 3LSXA 1MG1A 2I4BA 3F11A 1UTBB 2I3VA 4JDFA 3K6WA 3WAFA 3MBPA 1IXHA 2OWSA 3PMXA 3CR9A 5H8QB 4IO5A 4DE8A 2F7CA 2F7AA 1HSJA 2HAVA 1S50A 4QRZA 2ANJA 3TKDA 5JTYA 4BDQA 1UIUA 4HTGA 3LR1A 3TTRA 4RA1A 2ZXTA 1IUDA 4U2RA 2O6AA 3JV9A 3LSLA 4DXCA 4EDPA 2H25A 2Q9TA 3PMWA 2O1LA 1TWYA 3TODA 4EQ9A 4OENA 3QYTA 1URSA 3RTWB 3MJNA 5KDTB 3BFUA 3T96B 5ITPA 2I49A 1VSOA 2O7IA 3CRBA 2O68A 3RTFB 2VD2A 4GOTA 2YJPA 4ELQA 4K3FA 5ISUA 3PD9A 4OETA 3O6GA 2HZLA 4IY5A 4RXLA 1LB9A 2HCAA 2NVUB 1ZIUA 4FEDA 3SDFA 3KFMA 1Q35A 4F22A 4C1TA 4OFJA 2I58A 3QIMA 4OWDA 2ONSA 4H8IA 1Y4TA 3W9VA 3TTKA 3W15C 1YAEA 1XT8A 1B5HA 1B7ZA 1N84A 4R72A 2F6GA 1JQFA 3ECRA 3CFLA 3FVOA 4E0WA 3VVEA 2QS2A 1JVYA 1ZLQA 3E3KA 3LBSA 4GRKA 2D21A 2A5TB 3SEVA 4MF3A 1FCKA 3K0VA 2DVCA 1A7LA 2V3QA 3B6TA 2B3BA 4ZZEA 1PB7A 4YB6A 3R7XA 2GHAA 4LZ5A 2DXRA 3ILUB 3FV1A 3HHGA 2F6PA 1N7XA 3O66A 1JEVA 2PX1A 1MXYA 4NMYA 3H6VA 3TPAA 1QW0A 4I1DA 1MY2A 2XXUA 1Z7ME 5DYHA 2XHDA 2XX8A 4Q5TA 2Q2CA 3MWBA 1OVBA 3KSJA 3BBRA 1DPEA 3OO6A 4DCYA 4POWA 4G8HA 4JSDA 3FXUA 3HPIA 4U4XA 4ZEKA 1MRPA 1FTMA 4ESXA 3PU5A 1SI1A 1UQWA 1OLCA 3OO7A 2ESNA 3ZKKA 1B3EA 1MPBA 1B0LA 3FD3A 4LQ2A 1PDAA 5I2NB 2OK2A 1USYE 3FJ7A 2DS9A 3TQWA 3ODBA 4IO7A 3SETA 1PB9A 3H3GA 4O3BA 5AA2B 4FECA 4ZEDA 3C4MA 5I57B 3VLVA 4OFOA 2ZNUA 4F18A 5DEXB 3PPNA 2H4IA 1IIWA 1MQDA 1UTHB 4IGRA 1AOVA 1MY0A 3EHTA 4U22A 5AA1A 3I6VA 2THIA 1NH7A 4EF2A 2RF1A 5EHMA 3S9LC 1P99A 3VXBA 2GFEA 4F3SA 1DSNA 1VFEA 4Z0IA 4DXUA 4X9TA 2V84A 4GIZA 1LAXA 1MXXA 5CMBA 4FATA 1M5BA 3KG2A 1LCTA 4YB7A 1LBBA 1B52A 3OEKA 4HW8A 1HSEA 2UXAA 2R9JA 1B1HA 4C1UA 4OZ9A 2VHAA 3H6TA 3PUWE 4IO2A 3DP8A 1EZPA 2DVZA 3E13X 4R2FA 3KEIA 4NF4A 3LC8A 5FHMA 3FVKA 3TCGA 4PFWA 4ONYA 2PVUA 1RYOA 4P0GA 2HAUA 1JEUA 2XD3A 4NTLA 2P0SA 2I0BA 4GFRA 3TFLA 2QS3A 3D4GA 4MFIA 4NF8A 2AYSA 5TP9A 3MPLA 3TUSA 1MQIA 3VV5A 3TTMA 2CZLA 3H06B 1KWHA 1FTJA 1M5CA 3DLNA 4RK2A 2AL4A 3V89B 2D5WA 1YPNA 3E4RA 4DCXA 1SW5A 5ICQA 1FTLA 2Z22A 5JTYB 1ZBMA 4XTCQ 2RKMA 3KJ7A 4O3CA 4G68C 4JWOA 2Y7IA 3DELB 4FIMA 3O9PA 4OVJA 3TTLA 3DP4A 1NNTA 2DQVA 3IL1B 3SEUA 3OSQA 1MXVA 3PPPA 4GQOA 2W7YA 2REGA 3MZ9A 4MLQA 3SERA 1II5A 1FQFA 5KCJA 3O6HA 2FYIA 1MH3A 3KOSA 2RCBA 4IO3A 1MXZA 2Z8EA 4YZZA 3KOTA 2B65A 4EUOA 2AIXA 1I6AA 1SYIA 3A09A 3N94A 1B9JA 2Q8JA 5I56A 1LCFA 4ELRA 1FQCA 1OQHA 1H3DA 1XVYA 2F7BA 2O1MA 2X7QA 4R6HA 4F2OA 1XHYA 1JW5A 4JB7A 3U72A 4FEBA 1GTKA 1R6ZA 3G3KA 2ALUA 4ESWA 1TT1A 1MQGA 4H6DA 3UN6A 2NOOA 4G68A 5CI5A 3OELA 1XS5A 3MW0A 3TYHA 2REJA 2OBGA 1R9QA 4Q8RA 4UA8A 1FQAA 3V5AA 4WXJA 2Z8DA 3IK6B 4P0IA 4NWCA 2VP1A 2DWHA 3PPRA 3GLBA 4LZ8A 1NFTA 5I58A 2O51A 3N6UA 3I3VA 3A3CA 4C0RA 2P1SA 1MPDA 2XXTA 4L17A 1QKBA 4ZZAA 4HCYA 2ZYOA 4LQ5A 3VVFA 3IOVA 3L6GA 4GXSB 1XVXA 3IORA 3ZKLA 2Z23A 1NL5A 3BKIB 5H8NA 4GXAA 1FW0A 3A3UA 1Q1KA 3GBAA 1EZ9A 4EXKA 1SW1A 3ZS6A 3H7MA 4MH5A 3EPEA 4OYVA 1DTGA 1AIVA 4X1DA 3Q29A 1B3GA 4HS7A 4NEDA 4YMAA 1S7YA 3K2DA 1F9BA 3G3GA 4FJPA 2H5YA 5J1DA 3T66A 3U93A 4EQ7A 4RYAA 3S9EA 3CI8A 4LATA 4H65A 2B3FA 1D3KA 4LA9A 1SI0A 2RC8A 4KYEA 3C9HA 1ZTYA 4XKPA 2Y7KA 1QUJA 4F19A 2XXVA 3FVGA 3IO4A 3RPWA 1BP5A 4FAJA 3O97A 3V8XB 2UYEA 1TXFA 5AA4A 3CG3A 1R1NA 2O69A 4NE4A 4H8JA 1B5JA 1CB6A 2VGQA 3M3KA 1EH3A 3MVYA 1WODA 3TDJA 1Y1MA 3VLUA 1IXIA 1NNFA 4RK9A 4F31B 1QVSA 1N04A 2V3TA 1I6QA 3G7WA 3KN7A 1MY3A 1UTBA 2XXQA 1YTVA 2I48A 3MP1A 3Q26A 4YB5A 2XXXA 3QK6A 2ZYNA 1A54A 5CBSA 4KQPA 1P1UA 4YU0A 1IXCA 2XXPA 2Q88A 4AB6A 5FTHA 3QUJA 4DIGA 3IJXB 1O63A 1AH5A 2IEEA 4KYDA 2XXWA 4HCWA 3B6QA 2NWJA 5FHOA 1RYXA 1O64A 4ZDMA 5DVFA 2HEUA 4GL8A 2P2AA 4F1UA 2VD3A 3OSRA 1MPCA 1ZMGA 1B3LA 2XXIA 3C33A 3OXNA 4R73A 4NF4B 4F1YA 1I69A 3UGWA 1QUIA 3FJGA 5BWJA 3JYRA 4ZE9A 2GHBA 2DSFA 5DTBA 4O3AA 2Q89A 3TTNA 4NF8B 1SYHA 1VR5A 4IO4A 1FTOA 3EN3A 3FUZA 3FATA 4OEUA 5DT6A 1TFDA 5TP9B 4XXUA 2HZKA 1IQ7A 3IB1A 3IB0A 2V3UA 4LZ7A 1H44A 1D9YA 4KI0E 5CM6A 2UVJA 5HBCA 3Q25A 3CFZA 4OERA 4NF5A 3K00A 3CSBA 2DE2A 2F35A 4OFLA 1P1OA 3G3HA 1Y1ZA 2XD2A 3FASA 2DOJA 3MQ9A 5F1QA 1ZU0A 2F8DA 4FE8A 1NNKA 3W9WA 3SEWA 3N26A 3O29A 2R6GE 1OVTA 1HSLA 2PT1A 1QUKA 1JW4A 4OQOA 1MM7A 1LFHA 3PD8A 4IY6A 4BDLA 4QHQA 1AMFA 1MY1A 2RINA 2ZNTA 2H98A 4TQUQ 4EXLA 3SEXA 5KCJB 4EQBA 4TLMB 2ONRA 5TU0A 3C35A 1B51A 1SVXB 3TMGA 1USYH 3PUXE 3UORA 1BLFA 3IJOB 2OZZA 5I56B 4YKIA 1AL3A 4U1OA 3USDA 3TELA 5B7DA 3OMBA 2Y84A 5TPAA 1MQHA 4OHNA 2R71A 1MS7A 4R74A 3IO6A 3FXRA 4IB2A 4ELOA 2DYXA 3WAEA 1ANFA 3R6UA 4GL0A 1N7WA 3E9XA 1H43A 4G68B 3MVWA 1SBPA 3RUMA 1PEBA 4DDDA 3FV2A 4TOZA 4PE5B 3FGSA 1B32A 1FTKA 4F3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TLL B;  5I59 A;  3DM0 A;  4ZEC A;  3CG1 A;  1MXW A;  4R75 A;  1B6H A;  4GLI A;  5I58 B;  4R6Y A;  2RC7 A;  4PP0 A;  3MAM A;  2E0S A;  3H6W A;  3CSG A;  4RJZ A;  2E1S A;  2I4C A;  3PUY E;  1EU8 A;  3K1P A;  5I84 A;  4F3B A;  3K4U A;  1MDQ A;  2QL3 A;  2O7U A;  4ISU A;  3KGC A;  3L6H A;  4H0W A;  1QUL A;  3QXM A;  4NWD A;  5H8N B;  4KPT A;  3IX1 A;  1Y9U A;  3Q28 A;  3B7D A;  4H5F A;  4IGT A;  4Q0C A;  3EF7 A;  1Y3N A;  1O7T A;  3K01 A;  4IO6 A;  2OWT A;  3RT6 B;  3UP9 A;  2VOZ A;  3MC2 A;  1ATG A;  4Z7E A;  1B7H A;  2BJJ X;  5CMC A;  3C34 A;  4YIC A;  3IAZ A;  2OJT A;  2QMX A;  3BFT A;  4F2Q A;  4QSD A;  4LP2 B;  1I6B A;  1A8E A;  4XIG Q;  3C31 A;  3KSX A;  2YLN A;  5CBR A;  1NNP A;  3PMV A;  1BIY A;  2A5S A;  1MY4 A;  3OEN A;  3KN8 A;  1CE2 A;  2DP8 A;  2UVG A;  2DXY A;  5CC2 A;  1LLS A;  2Y7W A;  1BKA A;  3H4Z A;  1LBC A;  3IOW A;  1DOT A;  1JW1 A;  2AL5 A;  3QAX A;  2QS1 A;  4LVQ A;  2CMO A;  1OLA A;  3UK4 A;  4ZEB A;  5AA4 B;  5FTI A;  1POT A;  1B4Z A;  3KJT A;  3U92 A;  1SD3 A;  2G93 A;  2Y7P A;  2ABH A;  3ZSF A;  3FZV A;  3JZJ A;  2PMS A;  1IZ1 A;  4XKQ A;  1M5E A;  3DP6 A;  3LSW A;  3MVZ A;  1A55 A;  3RT8 A;  3MVX A;  3HST A;  2ONK E;  1B7U A;  2HQ0 A;  5CMK A;  3AXF A;  4ZS9 A;  4YKP A;  1FQB A;  1MH4 A;  3TEP A;  4QFL A;  5JEI A;  3T9U A;  4NF6 A;  2HXW A;  4X48 A;  3O6I A;  4LUB A;  4G8M A;  2ZYK A;  4ZE8 A;  5BUU A;  3RY3 A;  2QJE A;  3VFJ A;  4OES A;  2O84 X;  3IOU A;  5A5X A;  1US4 A;  4F29 A;  2XX7 A;  5ICT A;  1IEJ A;  4M1V A;  5AA2 D;  1OQG A;  3MZ1 A;  1B05 A;  4I62 A;  4JBZ A;  4ZEF A;  3K1N A;  2WKY A;  4E0X A;  2PYY A;  5H8F A;  3HN0 A;  1GGG A;  1A40 A;  5IKB A;  4H1X A;  4I8C A;  3RGY A;  2X7P A;  1PB8 A;  1NH8 A;  2F78 A;  3ILT B;  1LFI A;  1JNF A;  3TCH A;  1MM6 A;  1M5F A;  2V25 A;  4DZ1 A;  2IA4 A;  1WVJ A;  3HCQ A;  4KCD A;  3OO8 A;  5CMM A;  4PFU A;  4RNS A;  4LON B;  3RLF E;  1P1N A;  3OOA A;  3FJM A;  1B3F A;  3M3F A;  1Y4C A;  3O28 A;  1Y3Q A;  3TQL A;  4NF5 B;  1MDP 1;  4N07 A;  4WEP A;  4R2B A;  2PT2 A;  5K2Y A;  4ZEI A;  3T93 B;  3O2A A;  5ELV A;  2OLB A;  1GR2 A;  2QRY A;  4ECF A;  4KFQ A;  3U94 A;  2FA7 A;  4FOR A;  1D9V A;  1IXG A;  3G3F A;  4OXV A;  5H8H A;  5L8D A;  2DWA A;  1JET A;  3U1O A;  5I2K A;  3QSL A;  1P1W A;  3PV0 E;  2ZMB A;  1TFA A;  5AE4 A;  3TCF A;  3MUQ A;  1US5 A;  2DE4 A;  4JSO A;  2DWJ A;  2YPN A;  5CRY A;  3KN3 A;  1A99 A;  4KYS A;  5H8S A;  4N13 A;  2PBW A;  3G3I A;  4QFK A;  1FQE A;  5FHN A;  5H8Q A;  1IIT A;  1B3H A;  2QPQ A;  5L9M A;  2XXY A;  3K6X A;  3VE1 B;  4H67 A;  3T9H B;  2V93 A;  2DE3 A;  4AB5 A;  3C32 A;  3K6V A;  1LAF E;  1OIB A;  3UA8 A;  1WDN A;  1LAH E;  4F3P A;  4PET A;  2D3I A;  1SQY A;  2XX9 A;  4R6K A;  4GF8 A;  4M4G A;  1XOC A;  4JXI A;  1LGB C;  5IAI A;  4EF1 A;  3U8Q A;  1URD A;  2XXR A;  3RNN A;  1DPP A;  5TPA B;  5DVI A;  1VE4 A;  1BTJ A;  4OTE A;  3G3J A;  5KDT A;  3T9X B;  3FXQ A;  3VDF A;  1MQJ A;  2G29 A;  4QSC A;  3OEM A;  4DXB A;  3S9N C;  3M3L A;  2M8C A;  3FVN A;  1QKA A;  1DTZ A;  1PBP A;  2X26 A;  2ZYM A;  1D4N A;  1B46 A;  4OMB A;  1Y3P A;  3S9M C;  4AQ4 A;  1Z7N E;  4KHZ E;  3S2V A;  5I59 B;  3LUY A;  4PFT A;  2RC9 A;  3SKP A;  5ITO A;  3P7I A;  3EQ1 A;  2GRV A;  3D4C A;  3K6U A;  3ONM A;  4I9D A;  3Q27 A;  4JWY A;  2F34 A;  4ND9 A;  4WED A;  2FNC A;  3HO7 A;  3PGF A;  2I3W A;  3CIJ A;  5EYF A;  3CFX A;  3CVG A;  2F5X A;  2I6E A;  3PPQ A;  1URG A;  2A5T A;  3IB2 A;  3MPK A;  3VXC A;  4H5G A;  4MLV A;  3T9V A;  3THI A;  2I0C A;  1SDX A;  2Q2A A;  4QF9 A;  4F39 A;  4DLD A;  2F36 A;  4KD5 A;  3TZA A;  5B70 A;  2Y7R A;  2ZNS A;  2OCU A;  3MP6 A;  2QSX A;  2RCA A;  4YAH X;  4KCC A;  1N76 A;  3T22 A;  3K1M A;  1LAG E;  1SW2 A;  3SEY A;  1ZJL A;  1B40 A;  4WKM A;  4ELP A;  1B4H A;  3TAJ A;  3GBB A;  5HPQ A;  4U4S A;  5LOM A;  1B1X A;  1N0T A;  2QMW A;  4YKJ A;  1ZKB A;  1LST A;  5L9O A;  1MXU A;  3PUV E;  4QFN A;  5M2V A;  3QUF A;  3V83 A;  4BDO A;  1B5I A;  2NXO A;  1B2H A;  1B58 A;  3RN8 A;  1XC1 A;  3HHF A;  4UAC A;  1LFG A;  1UIV A;  1ELJ A;  1N3X A;  5AA3 A;  1R9L A;  4U21 A;  4THI A;  2QS4 A;  1Y20 A;  2NUV A;  3VLW A;  4BLA A;  3PPO A;  3FIR A;  3IOT A;  4QFO A;  3VVD A;  1JVX A;  4N6P A;  3LSF B;  3PUZ E;  5I2N A;  5F7V A;  4QSE A;  4PQJ A;  4PFY A;  3I5O A;  3EHU A;  4YKK A;  4POX A;  4G77 A;  4GWO A;  2UYF A;  2H99 A;  3SES A;  5AA2 A;  1B0H A;  1L5T A;  3MZB A;  4BDM A;  4U1Z A;  5I57 A;  4U23 A;  3UIF A;  3M8U A;  1PC3 A;  4JWX A;  4G2Z A;  4NF6 B;  3HV1 A;  5DEX A;  5DVJ A;  2Z8F A;  4GD5 A;  2H9B A;  1A8F A;  3MP8 A;  1EZO A;  1SW4 A;  1UTH A;  5A5X B;  1H45 A;  4R9F A;  4F1V A;  1H76 A;  1N3W A;  1LB8 A;  3N6T A;  2KLF A;  4G8N A;  1NMU A;  3RQT A;  1DMB A;  1VFD A;  4X1B A;  2XXH A;  5H8F B;  4RPO A;  1GVC A;  4R9G A;  4KR5 A;  2LAO A;  5EHS A;  2DWI A;  4YMB A;  3R26 A;  4P11 A;  3H6U A;  4RY1 A;  1S9T A;  1FQD A;  4OEV A;  4MBP A;  3C36 A;  4G4P A;  3KZG A;  3EHS A;  2UVH A;  3GXA A;  3IR1 A;  4RPN A;  2F97 A;  4BDN A;  3OO9 A;  5KZT A;  5L9S A;  2HFB A;  1PBQ A;  4QFP A;  3N5L A;  1GV8 A;  5K2X A;  3OD7 A;  3S4U A;  1NKX A;  3K02 A;  4XKR A;  5JK4 A;  1J1N A;  4XKN A;  3KBR A;  3B6W A;  4GVO A;  3GZG A;  5H8H B;  1T0K A;  5I2K B;  1OMP A;  1M5D A;  1QJM A;  3H03 A;  2UVI A;  4BDR A;  1P1Q A;  1YCJ A;  4Q30 B;  5HM4 B;  1POY 1;  2GH9 A;  1RKM A;  3LSX A;  1MG1 A;  2I4B A;  3F11 A;  1UTB B;  2I3V A;  4JDF A;  3K6W A;  3WAF A;  3MBP A;  1IXH A;  2OWS A;  3PMX A;  3CR9 A;  5H8Q B;  4IO5 A;  4DE8 A;  2F7C A;  2F7A A;  1HSJ A;  2HAV A;  1S50 A;  4QRZ A;  2ANJ A;  3TKD A;  5JTY A;  4BDQ A;  1UIU A;  4HTG A;  3LR1 A;  3TTR A;  4RA1 A;  2ZXT A;  1IUD A;  4U2R A;  2O6A A;  3JV9 A;  3LSL A;  4DXC A;  4EDP A;  2H25 A;  2Q9T A;  3PMW A;  2O1L A;  1TWY A;  3TOD A;  4EQ9 A;  4OEN A;  3QYT A;  1URS A;  3RTW B;  3MJN A;  5KDT B;  3BFU A;  3T96 B;  5ITP A;  2I49 A;  1VSO A;  2O7I A;  3CRB A;  2O68 A;  3RTF B;  2VD2 A;  4GOT A;  2YJP A;  4ELQ A;  4K3F A;  5ISU A;  3PD9 A;  4OET A;  3O6G A;  2HZL A;  4IY5 A;  4RXL A;  1LB9 A;  2HCA A;  2NVU B;  1ZIU A;  4FED A;  3SDF A;  3KFM A;  1Q35 A;  4F22 A;  4C1T A;  4OFJ A;  2I58 A;  3QIM A;  4OWD A;  2ONS A;  4H8I A;  1Y4T A;  3W9V A;  3TTK A;  3W15 C;  1YAE A;  1XT8 A;  1B5H A;  1B7Z A;  1N84 A;  4R72 A;  2F6G A;  1JQF A;  3ECR A;  3CFL A;  3FVO A;  4E0W A;  3VVE A;  2QS2 A;  1JVY A;  1ZLQ A;  3E3K A;  3LBS A;  4GRK A;  2D21 A;  2A5T B;  3SEV A;  4MF3 A;  1FCK A;  3K0V A;  2DVC A;  1A7L A;  2V3Q A;  3B6T A;  2B3B A;  4ZZE A;  1PB7 A;  4YB6 A;  3R7X A;  2GHA A;  4LZ5 A;  2DXR A;  3ILU B;  3FV1 A;  3HHG A;  2F6P A;  1N7X A;  3O66 A;  1JEV A;  2PX1 A;  1MXY A;  4NMY A;  3H6V A;  3TPA A;  1QW0 A;  4I1D A;  1MY2 A;  2XXU A;  1Z7M E;  5DYH A;  2XHD A;  2XX8 A;  4Q5T A;  2Q2C A;  3MWB A;  1OVB A;  3KSJ A;  3BBR A;  1DPE A;  3OO6 A;  4DCY A;  4POW A;  4G8H A;  4JSD A;  3FXU A;  3HPI A;  4U4X A;  4ZEK A;  1MRP A;  1FTM A;  4ESX A;  3PU5 A;  1SI1 A;  1UQW A;  1OLC A;  3OO7 A;  2ESN A;  3ZKK A;  1B3E A;  1MPB A;  1B0L A;  3FD3 A;  4LQ2 A;  1PDA A;  5I2N B;  2OK2 A;  1USY E;  3FJ7 A;  2DS9 A;  3TQW A;  3ODB A;  4IO7 A;  3SET A;  1PB9 A;  3H3G A;  4O3B A;  5AA2 B;  4FEC A;  4ZED A;  3C4M A;  5I57 B;  3VLV A;  4OFO A;  2ZNU A;  4F18 A;  5DEX B;  3PPN A;  2H4I A;  1IIW A;  1MQD A;  1UTH B;  4IGR A;  1AOV A;  1MY0 A;  3EHT A;  4U22 A;  5AA1 A;  3I6V A;  2THI A;  1NH7 A;  4EF2 A;  2RF1 A;  5EHM A;  3S9L C;  1P99 A;  3VXB A;  2GFE A;  4F3S A;  1DSN A;  1VFE A;  4Z0I A;  4DXU A;  4X9T A;  2V84 A;  4GIZ A;  1LAX A;  1MXX A;  5CMB A;  4FAT A;  1M5B A;  3KG2 A;  1LCT A;  4YB7 A;  1LBB A;  1B52 A;  3OEK A;  4HW8 A;  1HSE A;  2UXA A;  2R9J A;  1B1H A;  4C1U A;  4OZ9 A;  2VHA A;  3H6T A;  3PUW E;  4IO2 A;  3DP8 A;  1EZP A;  2DVZ A;  3E13 X;  4R2F A;  3KEI A;  4NF4 A;  3LC8 A;  5FHM A;  3FVK A;  3TCG A;  4PFW A;  4ONY A;  2PVU A;  1RYO A;  4P0G A;  2HAU A;  1JEU A;  2XD3 A;  4NTL A;  2P0S A;  2I0B A;  4GFR A;  3TFL A;  2QS3 A;  3D4G A;  4MFI A;  4NF8 A;  2AYS A;  5TP9 A;  3MPL A;  3TUS A;  1MQI A;  3VV5 A;  3TTM A;  2CZL A;  3H06 B;  1KWH A;  1FTJ A;  1M5C A;  3DLN A;  4RK2 A;  2AL4 A;  3V89 B;  2D5W A;  1YPN A;  3E4R A;  4DCX A;  1SW5 A;  5ICQ A;  1FTL A;  2Z22 A;  5JTY B;  1ZBM A;  4XTC Q;  2RKM A;  3KJ7 A;  4O3C A;  4G68 C;  4JWO A;  2Y7I A;  3DEL B;  4FIM A;  3O9P A;  4OVJ A;  3TTL A;  3DP4 A;  1NNT A;  2DQV A;  3IL1 B;  3SEU A;  3OSQ A;  1MXV A;  3PPP A;  4GQO A;  2W7Y A;  2REG A;  3MZ9 A;  4MLQ A;  3SER A;  1II5 A;  1FQF A;  5KCJ A;  3O6H A;  2FYI A;  1MH3 A;  3KOS A;  2RCB A;  4IO3 A;  1MXZ A;  2Z8E A;  4YZZ A;  3KOT A;  2B65 A;  4EUO A;  2AIX A;  1I6A A;  1SYI A;  3A09 A;  3N94 A;  1B9J A;  2Q8J A;  5I56 A;  1LCF A;  4ELR A;  1FQC A;  1OQH A;  1H3D A;  1XVY A;  2F7B A;  2O1M A;  2X7Q A;  4R6H A;  4F2O A;  1XHY A;  1JW5 A;  4JB7 A;  3U72 A;  4FEB A;  1GTK A;  1R6Z A;  3G3K A;  2ALU A;  4ESW A;  1TT1 A;  1MQG A;  4H6D A;  3UN6 A;  2NOO A;  4G68 A;  5CI5 A;  3OEL A;  1XS5 A;  3MW0 A;  3TYH A;  2REJ A;  2OBG A;  1R9Q A;  4Q8R A;  4UA8 A;  1FQA A;  3V5A A;  4WXJ A;  2Z8D A;  3IK6 B;  4P0I A;  4NWC A;  2VP1 A;  2DWH A;  3PPR A;  3GLB A;  4LZ8 A;  1NFT A;  5I58 A;  2O51 A;  3N6U A;  3I3V A;  3A3C A;  4C0R A;  2P1S A;  1MPD A;  2XXT A;  4L17 A;  1QKB A;  4ZZA A;  4HCY A;  2ZYO A;  4LQ5 A;  3VVF A;  3IOV A;  3L6G A;  4GXS B;  1XVX A;  3IOR A;  3ZKL A;  2Z23 A;  1NL5 A;  3BKI B;  5H8N A;  4GXA A;  1FW0 A;  3A3U A;  1Q1K A;  3GBA A;  1EZ9 A;  4EXK A;  1SW1 A;  3ZS6 A;  3H7M A;  4MH5 A;  3EPE A;  4OYV A;  1DTG A;  1AIV A;  4X1D A;  3Q29 A;  1B3G A;  4HS7 A;  4NED A;  4YMA A;  1S7Y A;  3K2D A;  1F9B A;  3G3G A;  4FJP A;  2H5Y A;  5J1D A;  3T66 A;  3U93 A;  4EQ7 A;  4RYA A;  3S9E A;  3CI8 A;  4LAT A;  4H65 A;  2B3F A;  1D3K A;  4LA9 A;  1SI0 A;  2RC8 A;  4KYE A;  3C9H A;  1ZTY A;  4XKP A;  2Y7K A;  1QUJ A;  4F19 A;  2XXV A;  3FVG A;  3IO4 A;  3RPW A;  1BP5 A;  4FAJ A;  3O97 A;  3V8X B;  2UYE A;  1TXF A;  5AA4 A;  3CG3 A;  1R1N A;  2O69 A;  4NE4 A;  4H8J A;  1B5J A;  1CB6 A;  2VGQ A;  3M3K A;  1EH3 A;  3MVY A;  1WOD A;  3TDJ A;  1Y1M A;  3VLU A;  1IXI A;  1NNF A;  4RK9 A;  4F31 B;  1QVS A;  1N04 A;  2V3T A;  1I6Q A;  3G7W A;  3KN7 A;  1MY3 A;  1UTB A;  2XXQ A;  1YTV A;  2I48 A;  3MP1 A;  3Q26 A;  4YB5 A;  2XXX A;  3QK6 A;  2ZYN A;  1A54 A;  5CBS A;  4KQP A;  1P1U A;  4YU0 A;  1IXC A;  2XXP A;  2Q88 A;  4AB6 A;  5FTH A;  3QUJ A;  4DIG A;  3IJX B;  1O63 A;  1AH5 A;  2IEE A;  4KYD A;  2XXW A;  4HCW A;  3B6Q A;  2NWJ A;  5FHO A;  1RYX A;  1O64 A;  4ZDM A;  5DVF A;  2HEU A;  4GL8 A;  2P2A A;  4F1U A;  2VD3 A;  3OSR A;  1MPC A;  1ZMG A;  1B3L A;  2XXI A;  3C33 A;  3OXN A;  4R73 A;  4NF4 B;  4F1Y A;  1I69 A;  3UGW A;  1QUI A;  3FJG A;  5BWJ A;  3JYR A;  4ZE9 A;  2GHB A;  2DSF A;  5DTB A;  4O3A A;  2Q89 A;  3TTN A;  4NF8 B;  1SYH A;  1VR5 A;  4IO4 A;  1FTO A;  3EN3 A;  3FUZ A;  3FAT A;  4OEU A;  5DT6 A;  1TFD A;  5TP9 B;  4XXU A;  2HZK A;  1IQ7 A;  3IB1 A;  3IB0 A;  2V3U A;  4LZ7 A;  1H44 A;  1D9Y A;  4KI0 E;  5CM6 A;  2UVJ A;  5HBC A;  3Q25 A;  3CFZ A;  4OER A;  4NF5 A;  3K00 A;  3CSB A;  2DE2 A;  2F35 A;  4OFL A;  1P1O A;  3G3H A;  1Y1Z A;  2XD2 A;  3FAS A;  2DOJ A;  3MQ9 A;  5F1Q A;  1ZU0 A;  2F8D A;  4FE8 A;  1NNK A;  3W9W A;  3SEW A;  3N26 A;  3O29 A;  2R6G E;  1OVT A;  1HSL A;  2PT1 A;  1QUK A;  1JW4 A;  4OQO A;  1MM7 A;  1LFH A;  3PD8 A;  4IY6 A;  4BDL A;  4QHQ A;  1AMF A;  1MY1 A;  2RIN A;  2ZNT A;  2H98 A;  4TQU Q;  4EXL A;  3SEX A;  5KCJ B;  4EQB A;  4TLM B;  2ONR A;  5TU0 A;  3C35 A;  1B51 A;  1SVX B;  3TMG A;  1USY H;  3PUX E;  3UOR A;  1BLF A;  3IJO B;  2OZZ A;  5I56 B;  4YKI A;  1AL3 A;  4U1O A;  3USD A;  3TEL A;  5B7D A;  3OMB A;  2Y84 A;  5TPA A;  1MQH A;  4OHN A;  2R71 A;  1MS7 A;  4R74 A;  3IO6 A;  3FXR A;  4IB2 A;  4ELO A;  2DYX A;  3WAE A;  1ANF A;  3R6U A;  4GL0 A;  1N7W A;  3E9X A;  1H43 A;  4G68 B;  3MVW A;  1SBP A;  3RUM A;  1PEB A;  4DDD A;  3FV2 A;  4TOZ A;  4PE5 B;  3FGS A;  1B32 A;  1FTK A;  4F3G A; 
#chains in the Genus database with same CATH topology
 4TLL B;  5I59 A;  3DM0 A;  4ZEC A;  5I3S A;  3CG1 A;  3FXB A;  1MXW A;  4R75 A;  1B6H A;  4MEV A;  4GLI A;  5I58 B;  4R6Y A;  2RC7 A;  3LUZ A;  4PP0 A;  3MAM A;  2E0S A;  3H6W A;  2ZZX A;  3CSG A;  4RJZ A;  2E1S A;  2F3B A;  2I4C A;  3PUY E;  4GBV A;  1EU8 A;  3K1P A;  5I84 A;  4F3B A;  3K4U A;  1MDQ A;  2QL3 A;  2O7U A;  4ISU A;  3KGC A;  5J16 A;  3L6H A;  4H0W A;  1QUL A;  4OA4 A;  3QXM A;  4NWD A;  5H8N B;  4KPT A;  3IX1 A;  1Y9U A;  3Q28 A;  3B7D A;  4H5F A;  4IGT A;  4Q0C A;  4I3Y A;  3EF7 A;  1Y3N A;  1O7T A;  5IGA A;  3K01 A;  1FSA A;  4IO6 A;  2OWT A;  3RT6 B;  3UP9 A;  1YXI A;  2VOZ A;  3MC2 A;  1ATG A;  4Z7E A;  1B7H A;  4QBA A;  2BJJ X;  3RPL A;  5IM2 A;  5CMC A;  4MIJ A;  3C34 A;  4YIC A;  3IAZ A;  4PFB A;  2OJT A;  2QMX A;  3BFT A;  4F2Q A;  2FBP A;  4QSD A;  4LP2 B;  1I6B A;  1A8E A;  4XIG Q;  3C31 A;  3KSX A;  2YLN A;  5IZ3 A;  5CBR A;  1NNP A;  3PMV A;  1BIY A;  2A5S A;  2HPG A;  1MY4 A;  4PDD A;  3OEN A;  3KN8 A;  4O94 A;  1CE2 A;  2DP8 A;  2UVG A;  2DXY A;  5CC2 A;  1LLS A;  2Y7W A;  1BKA A;  3H4Z A;  1LBC A;  2HHM A;  3IOW A;  1DOT A;  1JW1 A;  2AL5 A;  3QAX A;  2QS1 A;  4LVQ A;  2CMO A;  1OLA A;  3UK4 A;  4ZEB A;  3T1B A;  5AA4 B;  5FTI A;  1POT A;  1B4Z A;  3KJT A;  3U92 A;  1SD3 A;  2G93 A;  5ET6 A;  2Y7P A;  2ABH A;  4GX3 A;  3ZSF A;  3FZV A;  4IR8 A;  3JZJ A;  2PMS A;  1IZ1 A;  4XKQ A;  1M5E A;  3DP6 A;  2PCR A;  1RDX A;  3LSW A;  3MVZ A;  1A55 A;  3RT8 A;  3MVX A;  4PF6 A;  3HST A;  2ONK E;  5LTC A;  1B7U A;  2HQ0 A;  5CMK A;  3U65 A;  3AXF A;  4PDH A;  4ZS9 A;  4YKP A;  1FQB A;  1MH4 A;  3D1R A;  3TEP A;  4QFL A;  5T3J A;  5JEI A;  3T9U A;  4NF6 A;  2HXW A;  4X48 A;  3O6I A;  4LUB A;  4G8M A;  2ZYK A;  4ZE8 A;  5BUU A;  3RY3 A;  2QJE A;  3VFJ A;  4OES A;  2O84 X;  3IOU A;  3QMF A;  5A5X A;  1US4 A;  4F29 A;  2XX7 A;  5ICT A;  1IEJ A;  4M1V A;  5AA2 D;  5EQ9 A;  1OQG A;  3MZ1 A;  4NF0 A;  1B05 A;  4I62 A;  4JBZ A;  4ZEF A;  4UAB A;  3K1N A;  2WKY A;  4E0X A;  2PYY A;  5H8F A;  3HN0 A;  1GGG A;  3NOH A;  1A40 A;  5IKB A;  5EQ8 A;  3MST A;  4H1X A;  3IFA A;  4I8C A;  3RGY A;  1NI9 A;  2X7P A;  1PB8 A;  1NH8 A;  2F78 A;  3ILT B;  1LFI A;  1JNF A;  3TCH A;  1MM6 A;  1M5F A;  2V25 A;  4DZ1 A;  2IA4 A;  1WVJ A;  3HCQ A;  4KCD A;  3OO8 A;  4XF5 A;  5CMM A;  4PFU A;  1NV1 A;  4RNS A;  4LON B;  4NHB A;  3RLF E;  1P1N A;  3OOA A;  3FJM A;  1B3F A;  3M3F A;  4MMP A;  1Y4C A;  3O28 A;  1Y3Q A;  3TQL A;  2WYP A;  1FPE A;  4NF5 B;  1MDP 1;  4N07 A;  4WEP A;  4R2B A;  2PT2 A;  5K2Y A;  4ZEI A;  3T93 B;  3O2A A;  5ELV A;  2OLB A;  1GR2 A;  2PFZ A;  2QRY A;  4ECF A;  4KFQ A;  4PGN A;  3U94 A;  4AS5 A;  2FA7 A;  4FOR A;  1D9V A;  1IXG A;  3G3F A;  4OXV A;  5H8H A;  5L8D A;  2DWA A;  1JET A;  4PE3 A;  3U1O A;  5I2K A;  3QSL A;  1P1W A;  3PV0 E;  2ZMB A;  1TFA A;  5AE4 A;  3TCF A;  3MUQ A;  1US5 A;  2DE4 A;  4JSO A;  2DWJ A;  4N8Y A;  2YPN A;  5CRY A;  3KN3 A;  1A99 A;  2Q8M A;  4KYS A;  5H8S A;  4N13 A;  2PBW A;  3G3I A;  4QFK A;  4NX1 A;  1IME A;  1FQE A;  5FHN A;  5H8Q A;  1IIT A;  1B3H A;  2QPQ A;  5L9M A;  2XXY A;  3K6X A;  3VE1 B;  4H67 A;  3T9H B;  2V93 A;  2QFL A;  2DE3 A;  4AB5 A;  3C32 A;  3K6V A;  1LAF E;  1OIB A;  3UA8 A;  1WDN A;  1LAH E;  2FHY A;  4F3P A;  4PET A;  4OVS A;  2D3I A;  5IZ1 A;  1SQY A;  2XX9 A;  4R6K A;  5ET8 A;  5ET7 A;  4GF8 A;  4M4G A;  1XOC A;  4JXI A;  1G0I A;  1LGB C;  5IAI A;  4EF1 A;  3U8Q A;  1FBF A;  1SPI A;  1URD A;  2XXR A;  3RNN A;  4NQ8 A;  1DPP A;  5TPA B;  2Y5L A;  1FPD A;  5DVI A;  1VE4 A;  1BTJ A;  4OTE A;  3G3J A;  5KDT A;  3T9X B;  3FXQ A;  3VDF A;  4HE2 A;  1MQJ A;  2G29 A;  4QSC A;  1FRP A;  3OEM A;  4DXB A;  2XA5 A;  3S9N C;  3MYU A;  3M3L A;  2M8C A;  3FVN A;  1QKA A;  1DTZ A;  1PBP A;  2X26 A;  1VDW A;  2ZYM A;  1D4N A;  1B46 A;  4OMB A;  4MHF A;  1Y3P A;  3S9M C;  2MKZ A;  4AQ4 A;  1Z7N E;  4KHZ E;  3S2V A;  4PBQ A;  4PGP A;  5I59 B;  2HXR A;  4H45 A;  3LUY A;  4PFT A;  2ZZV A;  2RC9 A;  3SKP A;  5ITO A;  3P7I A;  3EQ1 A;  2GRV A;  3D4C A;  2VPO A;  2WX9 A;  3K6U A;  3ONM A;  3LV0 A;  2QVU A;  4I9D A;  1FPJ A;  3Q27 A;  4JWY A;  2F34 A;  4ND9 A;  4WED A;  2FNC A;  3HO7 A;  3PGF A;  2I3W A;  3CIJ A;  5EYF A;  3CFX A;  3CVG A;  2F5X A;  4NN3 A;  2I6E A;  3PPQ A;  4NAP A;  1URG A;  1NUW A;  2A5T A;  3IB2 A;  3MPK A;  3VXC A;  4H5G A;  4MLV A;  3T9V A;  3THI A;  2I0C A;  1SDX A;  2Q2A A;  4QF9 A;  3B50 A;  4F39 A;  4DLD A;  2F36 A;  4KD5 A;  3TZA A;  5B70 A;  2Y7R A;  3RPL B;  2ZNS A;  2OCU A;  3MP6 A;  4PBH A;  2QSX A;  2RCA A;  4YAH X;  4NGU A;  4KCC A;  1N76 A;  3T22 A;  3K1M A;  1LAG E;  1SW2 A;  3SEY A;  1ZJL A;  4AS4 A;  1B40 A;  1CNQ A;  4WKM A;  4ELP A;  1B4H A;  3TAJ A;  5EYG A;  3GBB A;  5IZ3 B;  5HPQ A;  4U4S A;  5LOM A;  1B1X A;  1N0T A;  2QMW A;  4YKJ A;  1ZKB A;  1FPI A;  4P1E A;  1LST A;  5L9O A;  1MXU A;  3PTY A;  3PUV E;  4QFN A;  5M2V A;  3QUF A;  3V83 A;  4BDO A;  1RDY A;  1B5I A;  2NXO A;  1B2H A;  1B58 A;  3RN8 A;  1XC1 A;  3HHF A;  4UAC A;  1LFG A;  1UIV A;  1ELJ A;  1N3X A;  5AA3 A;  1R9L A;  4U21 A;  4THI A;  2QS4 A;  1Y20 A;  2P3V A;  2NUV A;  3VLW A;  4BLA A;  3PPO A;  3FIR A;  3IOT A;  3SZP A;  4QFO A;  3VVD A;  1JVX A;  1FTA A;  4N6P A;  3LSF B;  3PUZ E;  5I2N A;  5F7V A;  4QSE A;  4O7I A;  2CZI A;  2XWK A;  4PQJ A;  4PFY A;  3I5O A;  4PAK A;  3EHU A;  4YKK A;  4POX A;  1DBZ A;  4G77 A;  4GWO A;  2UYF A;  2H99 A;  3SES A;  5AA2 A;  1B0H A;  1L5T A;  3MZB A;  4BDM A;  4U1Z A;  5I57 A;  4U23 A;  3UIF A;  3M8U A;  1PC3 A;  1FBE A;  4JWX A;  4G2Z A;  4NF6 B;  3HV1 A;  5DEX A;  5DVJ A;  2Z8F A;  4GD5 A;  2H9B A;  3B8B A;  1A8F A;  3MP8 A;  1EZO A;  1SW4 A;  1NV3 A;  1UTH A;  4P9K A;  5A5X B;  1H45 A;  2XWI A;  3E78 A;  4R9F A;  4F1V A;  1H76 A;  1FPB A;  1N3W A;  1LEV A;  1LB8 A;  3N6T A;  2KLF A;  4G8N A;  1NMU A;  3RQT A;  1DMB A;  1VFD A;  4X1B A;  2XXH A;  5H8F B;  4RPO A;  1GVC A;  1KA1 A;  4R9G A;  4KR5 A;  2LAO A;  5EHS A;  2DWI A;  1NV4 A;  4HXV A;  4YMB A;  3R26 A;  4P11 A;  1FPL A;  3H6U A;  1JP4 A;  4RY1 A;  1S9T A;  4JVI A;  1FQD A;  4OEV A;  4MBP A;  3C36 A;  4G4P A;  3KZG A;  3EHS A;  2UVH A;  3GXA A;  1NUY A;  3IR1 A;  4RPN A;  2F97 A;  4BDN A;  3OO9 A;  5KZT A;  4OVQ A;  5L9S A;  4OVP A;  2HFB A;  1PBQ A;  4QFP A;  4LN5 A;  3N5L A;  1GV8 A;  5K2X A;  4PCD A;  3OD7 A;  3S4U A;  1NKX A;  5FBP A;  3K02 A;  2XWO A;  4XKR A;  5JK4 A;  1J1N A;  4XKN A;  2F3D A;  3KBR A;  3B6W A;  4GVO A;  3GZG A;  4X04 A;  2Y5K A;  5H8H B;  1T0K A;  2OWZ A;  5I2K B;  4MX6 A;  1OMP A;  1M5D A;  1QJM A;  3H03 A;  2UVI A;  4BDR A;  1P1Q A;  2QVR A;  1YCJ A;  4Q30 B;  5HM4 B;  1POY 1;  2GH9 A;  1RKM A;  4QXD A;  3LSX A;  1MG1 A;  2I4B A;  3FBP A;  3F11 A;  1UTB B;  4N6D A;  2I3V A;  4JDF A;  3K6W A;  3WAF A;  3MBP A;  1IXH A;  2OWS A;  3PMX A;  1EYI A;  3CR9 A;  5H8Q B;  4IO5 A;  4DE8 A;  2F7C A;  5LDZ A;  2F7A A;  1HSJ A;  2HAV A;  1S50 A;  4QRZ A;  2ANJ A;  3TKD A;  4O7M A;  5JTY A;  1LBV A;  4BDQ A;  1UIU A;  4HTG A;  3LR1 A;  3TTR A;  4RA1 A;  2ZXT A;  1IUD A;  4U2R A;  2O6A A;  3JV9 A;  3LSL A;  4DXC A;  4EDP A;  2H25 A;  2Q9T A;  3PMW A;  2O1L A;  1TWY A;  1K9Z A;  3TOD A;  4EQ9 A;  4OEN A;  3QYT A;  1URS A;  1NV5 A;  4XEQ A;  3RTW B;  3MJN A;  2XXK A;  5KDT B;  1FPF A;  3BFU A;  3KC1 A;  1BK4 A;  3T96 B;  5ITP A;  1NUX A;  2I49 A;  1VSO A;  2O7I A;  3CRB A;  2O68 A;  3RTF B;  2VD2 A;  4GOT A;  4PC9 A;  2YJP A;  4ELQ A;  4K3F A;  3CHG A;  5ISU A;  3PD9 A;  1FPG A;  3O6G A;  4OET A;  2HZL A;  3T0J A;  4IY5 A;  4RXL A;  1LB9 A;  2HCA A;  2NVU B;  4JVC A;  1ZIU A;  2CEX A;  4FED A;  3SDF A;  3KFM A;  1Q35 A;  4F22 A;  4C1T A;  3ISP A;  4OFJ A;  2I58 A;  3QIM A;  4OWD A;  2ONS A;  2B4L A;  4H8I A;  1Y4T A;  3W9V A;  1LBZ A;  3TTK A;  3W15 C;  1YAE A;  1XT8 A;  4N91 A;  1B5H A;  1B7Z A;  1N84 A;  4R72 A;  4DI4 B;  2F6G A;  1JQF A;  3ECR A;  3CFL A;  3FVO A;  4E0W A;  3VVE A;  1IMD A;  3A29 A;  2QS2 A;  1JVY A;  1ZLQ A;  3E3K A;  3LBS A;  4GRK A;  2D21 A;  2A5T B;  1YZ0 A;  3SEV A;  2CZH A;  4MF3 A;  1FCK A;  3K0V A;  2DVC A;  1Q9D A;  1A7L A;  2V3Q A;  3B6T A;  2B3B A;  4ZZE A;  1PB7 A;  4YB6 A;  3R7X A;  2GHA A;  4LZ5 A;  1NV6 A;  2DXR A;  3ILU B;  3FV1 A;  3HHG A;  4PFI A;  2F6P A;  1N7X A;  3O66 A;  3BIG A;  1JEV A;  2PX1 A;  4N17 A;  1MXY A;  4NMY A;  3H6V A;  3TPA A;  1QW0 A;  4I1D A;  1MY2 A;  2XXU A;  4MAG A;  2WBD A;  1Z7M E;  2VPN A;  4PFR A;  5DYH A;  2XHD A;  2XX8 A;  1FJ9 A;  4Q5T A;  2Q2C A;  3MWB A;  1OVB A;  3KSJ A;  3BBR A;  1DPE A;  3OO6 A;  4DCY A;  4POW A;  4G8H A;  4JSD A;  3FXU A;  5ESY A;  1EYK A;  3HPI A;  4U4X A;  4ZEK A;  4P47 A;  1MRP A;  1FTM A;  1FBD A;  4ESX A;  3PU5 A;  1SI1 A;  2CEY A;  1UQW A;  1OLC A;  3OO7 A;  2ESN A;  3ZKK A;  1B3E A;  1MPB A;  1B0L A;  3FD3 A;  4LQ2 A;  1PDA A;  5I2N B;  2OK2 A;  1USY E;  3FJ7 A;  2DS9 A;  1XI6 A;  3TQW A;  3ODB A;  4IO7 A;  3SET A;  1PB9 A;  2BJI A;  3H3G A;  4O3B A;  5AA2 B;  4FEC A;  2KQZ A;  4ZED A;  3C4M A;  5I57 B;  3VLV A;  4OFO A;  2ZNU A;  4I40 A;  5I7I A;  4F18 A;  5DEX B;  3PPN A;  2H4I A;  1IIW A;  1MQD A;  1UTH B;  4N15 A;  4IGR A;  3HFU A;  1AOV A;  1MY0 A;  3EHT A;  4U22 A;  5AA1 A;  3I6V A;  4GWW A;  2THI A;  1NH7 A;  4EF2 A;  2RF1 A;  1FBH A;  2PFY A;  5EHM A;  4G61 A;  3S9L C;  1P99 A;  3VXB A;  2GFE A;  2JJK A;  4P8B A;  4F3S A;  1DSN A;  1VFE A;  4Z0I A;  4DXU A;  4X9T A;  2V84 A;  4GIZ A;  1LAX A;  1MXX A;  5CMB A;  4FAT A;  1M5B A;  3KG2 A;  1LCT A;  1KA0 A;  2WEF A;  4YB7 A;  1LBB A;  2ZZW A;  1B52 A;  3OEK A;  4HW8 A;  1HSE A;  2UXA A;  2R9J A;  1B1H A;  4C1U A;  4OZ9 A;  2VHA A;  3H6T A;  3PUW E;  4IO2 A;  3DP8 A;  1EZP A;  2DVZ A;  4FBP A;  4GWZ A;  3E13 X;  4R2F A;  3KEI A;  4NF4 A;  3LC8 A;  5FHM A;  3FVK A;  3TCG A;  4PFW A;  4ONY A;  2PVU A;  1RYO A;  4P0G A;  2HAU A;  4GBW A;  1JEU A;  3E79 A;  4X8R A;  2XD3 A;  4NTL A;  2KR0 A;  2P0S A;  2I0B A;  4GFR A;  3TFL A;  2QS3 A;  3D4G A;  4MFI A;  5IZZ A;  4NF8 A;  4N6K A;  2AYS A;  5TP9 A;  3MPL A;  3TUS A;  1MQI A;  3VV5 A;  3TTM A;  2CZL A;  3H06 B;  1KWH A;  1FTJ A;  1M5C A;  3DLN A;  4RK2 A;  2AL4 A;  2WYK A;  2FIX A;  3V89 B;  1LBX A;  2D5W A;  4MNP A;  4MNC A;  1YPN A;  5A5L A;  4MJO A;  3E4R A;  4DCX A;  1SW5 A;  5ICQ A;  4OVR A;  1FTL A;  2Z22 A;  5JTY B;  1ZBM A;  4XTC Q;  2RKM A;  3KJ7 A;  4O3C A;  4G68 C;  4JWO A;  2Y7I A;  3DEL B;  4FIM A;  3BIH A;  3O9P A;  4OVJ A;  4XFE A;  3TTL A;  3DP4 A;  1NNT A;  2OX3 A;  2DQV A;  3IL1 B;  3SEU A;  3OSQ A;  1MXV A;  3PPP A;  4GQO A;  2FVZ A;  2W7Y A;  2REG A;  3MZ9 A;  4GWY A;  4MLQ A;  3SER A;  1II5 A;  1FQF A;  5KCJ A;  4N81 A;  3O6H A;  2FYI A;  1NV0 A;  1MH3 A;  3KOS A;  2RCB A;  4IO3 A;  5EQA A;  1MXZ A;  2Z8E A;  4YZZ A;  3KOT A;  2B65 A;  1KZ8 A;  2AIX A;  1I6A A;  4EUO A;  1SYI A;  3A09 A;  3N94 A;  1B9J A;  2Q8J A;  5I56 A;  1FBP A;  1NV7 A;  1LCF A;  4ELR A;  1FQC A;  1OQH A;  2L5V A;  1H3D A;  2CZK A;  1XVY A;  2F7B A;  2O1M A;  2X7Q A;  1IMF A;  2R8T A;  4R6H A;  4F2O A;  1XHY A;  1JW5 A;  4JB7 A;  1DK4 A;  3U72 A;  4FEB A;  1GTK A;  1R6Z A;  3G3K A;  2ALU A;  4KXP A;  5EQ7 A;  4ESW A;  1TT1 A;  1G0H A;  1K9Y A;  1MQG A;  4H6D A;  3UN6 A;  2NOO A;  4G68 A;  5CI5 A;  3OEL A;  1XS5 A;  3MW0 A;  3TYH A;  2REJ A;  2OBG A;  1R9Q A;  4Q8R A;  4UA8 A;  1FQA A;  3V5A A;  4WXJ A;  2Z8D A;  3IK6 B;  4P0I A;  4NWC A;  2VP1 A;  2DWH A;  3PPR A;  4PF8 A;  3GLB A;  4LZ8 A;  2WBB A;  4DI3 D;  1NFT A;  5I58 A;  2O51 A;  4GX4 A;  3KC0 A;  3N6U A;  3I3V A;  3A3C A;  4C0R A;  2P1S A;  1MPD A;  2XXT A;  4NG7 A;  4L17 A;  1QKB A;  4ZZA A;  4HCY A;  2ZYO A;  4LQ5 A;  3VVF A;  3IOV A;  3L6G A;  4GXS B;  1XVX A;  3IOR A;  3ZKL A;  2Q74 A;  2Z23 A;  4I3E A;  1NL5 A;  3BKI B;  5H8N A;  4GXA A;  1FW0 A;  3A3U A;  1Q1K A;  3ROJ A;  1YYZ A;  3GBA A;  1EZ9 A;  4EXK A;  1SW1 A;  3ZS6 A;  1IMC A;  3H7M A;  4MH5 A;  3EPE A;  4OYV A;  1DTG A;  1AIV A;  4X1D A;  3Q29 A;  1LBW A;  4GWX A;  1B3G A;  4HS7 A;  4NED A;  4YMA A;  1S7Y A;  3K2D A;  1F9B A;  3G3G A;  4FJP A;  2H5Y A;  5J1D A;  3T66 A;  3U93 A;  4EQ7 A;  4RYA A;  3S9E A;  3CI8 A;  4LAT A;  4H65 A;  2B3F A;  1D3K A;  4LA9 A;  1SI0 A;  2RC8 A;  2B4M A;  2QVV A;  2XWV A;  4KYE A;  4GX6 A;  3C9H A;  5ET5 A;  1ZTY A;  4XKP A;  2Y7K A;  4O8M A;  1QUJ A;  4F19 A;  3IFC A;  2XXV A;  3FVG A;  3IO4 A;  1EYJ A;  4HE1 A;  3RPW A;  1BP5 A;  4FAJ A;  3O97 A;  3V8X B;  4P3L A;  2UYE A;  1TXF A;  5AA4 A;  1INP A;  3CG3 A;  2GQ1 A;  1R1N A;  2O69 A;  4NE4 A;  4H8J A;  1B5J A;  1CB6 A;  2VGQ A;  3M3K A;  1EH3 A;  3MVY A;  1WOD A;  3TDJ A;  1Y1M A;  1IMB A;  3VLU A;  1IXI A;  1NNF A;  4RK9 A;  4F31 B;  5I5P A;  1QVS A;  1N04 A;  2V3T A;  1I6Q A;  3G7W A;  3KN7 A;  1MY3 A;  1AWB A;  1NUZ A;  1UTB A;  2XXQ A;  1FBG A;  1YTV A;  2I48 A;  3MP1 A;  3Q26 A;  4YB5 A;  4MNI A;  2XXX A;  3QK6 A;  2ZYN A;  1A54 A;  5CBS A;  4PAI A;  4KQP A;  1P1U A;  4YU0 A;  1IXC A;  4MCO A;  2XXP A;  2Q88 A;  4AB6 A;  5FTH A;  3QUJ A;  4DIG A;  3IJX B;  1O63 A;  1AH5 A;  2IEE A;  4KYD A;  2XXW A;  4HCW A;  3B6Q A;  2NWJ A;  5FHO A;  1RYX A;  1O64 A;  3EKI A;  4ZDM A;  5DVF A;  2HEU A;  4GL8 A;  5F24 A;  2P2A A;  4F1U A;  2V4C A;  2VD3 A;  3OSR A;  1MPC A;  1ZMG A;  1B3L A;  2XXI A;  3C33 A;  3OXN A;  4OAN A;  4R73 A;  4NF4 B;  4F1Y A;  1I69 A;  3UGW A;  4OVT A;  1D9Q A;  1QUI A;  3FJG A;  5BWJ A;  3JYR A;  4ZE9 A;  2GHB A;  2DSF A;  5DTB A;  4O3A A;  2Q89 A;  3TTN A;  4NF8 B;  1RDZ A;  1SYH A;  4P56 A;  1VR5 A;  1FJ6 A;  4IO4 A;  1FTO A;  2P3N A;  3EN3 A;  3FUZ A;  3FAT A;  4OEU A;  5DT6 A;  1TFD A;  5TP9 B;  4XXU A;  2HZK A;  1IQ7 A;  3IB1 A;  3IB0 A;  4HE0 A;  2V3U A;  4LZ7 A;  1H44 A;  1D9Y A;  4KI0 E;  5CM6 A;  2UVJ A;  5EYH A;  5HBC A;  3Q25 A;  3CFZ A;  4OER A;  4NF5 A;  2DDK A;  3K00 A;  3CSB A;  2DE2 A;  1DCU A;  2F35 A;  4OFL A;  1P1O A;  3G3H A;  1Y1Z A;  2XD2 A;  3FAS A;  2DOJ A;  3MQ9 A;  5F1Q A;  1ZU0 A;  2F8D A;  4FE8 A;  4N8G A;  1NNK A;  3W9W A;  3SEW A;  3N26 A;  3O29 A;  2R6G E;  1OVT A;  1HSL A;  2PT1 A;  1QUK A;  1JW4 A;  4OQO A;  1MM7 A;  1LBY A;  1LFH A;  3PD8 A;  4IY6 A;  4BDL A;  4QHQ A;  1AMF A;  1MY1 A;  2RIN A;  2ZNT A;  4H46 A;  2H98 A;  4TQU Q;  4EXL A;  3SEX A;  5KCJ B;  2VT5 A;  4EQB A;  4GWS A;  4TLM B;  2ONR A;  5TU0 A;  3C35 A;  1B51 A;  1SVX B;  3TMG A;  1USY H;  3PUX E;  3UOR A;  1BLF A;  3IJO B;  2OZZ A;  5I56 B;  4YKI A;  2FIE A;  1AL3 A;  4U1O A;  3USD A;  1IMA A;  3TEL A;  5B7D A;  3OMB A;  2Y84 A;  4PTK A;  5TPA A;  3GYY A;  1MQH A;  4OHN A;  4N4U A;  1FBC A;  4PAF A;  2R71 A;  1MS7 A;  4R74 A;  3IO6 A;  3FXR A;  4IB2 A;  4ELO A;  3KBZ A;  5DW8 A;  2DYX A;  3WAE A;  1FPK A;  1ANF A;  3R6U A;  4GL0 A;  4GWU A;  1N7W A;  3E9X A;  1H43 A;  1NV2 A;  1QGX A;  4G68 B;  3MVW A;  1SBP A;  4P1L A;  3RUM A;  1PEB A;  4JVD A;  4DDD A;  3FV2 A;  4TOZ A;  4PE5 B;  3FGS A;  1B32 A;  3RYD A;  1FTK A;  4F3G A; 
#chains in the Genus database with same CATH homology
 4TLL B;  5I59 A;  3DM0 A;  4ZEC A;  3CG1 A;  1MXW A;  4R75 A;  1B6H A;  4GLI A;  5I58 B;  4R6Y A;  2RC7 A;  4PP0 A;  3MAM A;  2E0S A;  3H6W A;  3CSG A;  4RJZ A;  2E1S A;  2I4C A;  3PUY E;  1EU8 A;  3K1P A;  5I84 A;  4F3B A;  3K4U A;  1MDQ A;  2QL3 A;  2O7U A;  4ISU A;  3KGC A;  3L6H A;  4H0W A;  1QUL A;  3QXM A;  4NWD A;  5H8N B;  4KPT A;  3IX1 A;  1Y9U A;  3Q28 A;  3B7D A;  4H5F A;  4IGT A;  4Q0C A;  3EF7 A;  1Y3N A;  1O7T A;  3K01 A;  4IO6 A;  2OWT A;  3RT6 B;  3UP9 A;  2VOZ A;  3MC2 A;  1ATG A;  4Z7E A;  1B7H A;  2BJJ X;  5CMC A;  3C34 A;  4YIC A;  3IAZ A;  2OJT A;  2QMX A;  3BFT A;  4F2Q A;  4QSD A;  4LP2 B;  1I6B A;  1A8E A;  4XIG Q;  3C31 A;  3KSX A;  2YLN A;  5CBR A;  1NNP A;  3PMV A;  1BIY A;  2A5S A;  1MY4 A;  3OEN A;  3KN8 A;  1CE2 A;  2DP8 A;  2UVG A;  2DXY A;  5CC2 A;  1LLS A;  2Y7W A;  1BKA A;  3H4Z A;  1LBC A;  3IOW A;  1DOT A;  1JW1 A;  2AL5 A;  3QAX A;  2QS1 A;  4LVQ A;  2CMO A;  1OLA A;  3UK4 A;  4ZEB A;  5AA4 B;  5FTI A;  1POT A;  1B4Z A;  3KJT A;  3U92 A;  1SD3 A;  2G93 A;  2Y7P A;  2ABH A;  3ZSF A;  3FZV A;  3JZJ A;  2PMS A;  1IZ1 A;  4XKQ A;  1M5E A;  3DP6 A;  3LSW A;  3MVZ A;  1A55 A;  3RT8 A;  3MVX A;  3HST A;  2ONK E;  1B7U A;  2HQ0 A;  5CMK A;  3AXF A;  4ZS9 A;  4YKP A;  1FQB A;  1MH4 A;  3TEP A;  4QFL A;  5JEI A;  3T9U A;  4NF6 A;  2HXW A;  4X48 A;  3O6I A;  4LUB A;  4G8M A;  2ZYK A;  4ZE8 A;  5BUU A;  3RY3 A;  2QJE A;  3VFJ A;  4OES A;  2O84 X;  3IOU A;  5A5X A;  1US4 A;  4F29 A;  2XX7 A;  5ICT A;  1IEJ A;  4M1V A;  5AA2 D;  1OQG A;  3MZ1 A;  1B05 A;  4I62 A;  4JBZ A;  4ZEF A;  3K1N A;  2WKY A;  4E0X A;  2PYY A;  5H8F A;  3HN0 A;  1GGG A;  1A40 A;  5IKB A;  4H1X A;  4I8C A;  3RGY A;  2X7P A;  1PB8 A;  1NH8 A;  2F78 A;  3ILT B;  1LFI A;  1JNF A;  3TCH A;  1MM6 A;  1M5F A;  2V25 A;  4DZ1 A;  2IA4 A;  1WVJ A;  3HCQ A;  4KCD A;  3OO8 A;  5CMM A;  4PFU A;  4RNS A;  4LON B;  3RLF E;  1P1N A;  3OOA A;  3FJM A;  1B3F A;  3M3F A;  1Y4C A;  3O28 A;  1Y3Q A;  3TQL A;  4NF5 B;  1MDP 1;  4N07 A;  4WEP A;  4R2B A;  2PT2 A;  5K2Y A;  4ZEI A;  3T93 B;  3O2A A;  5ELV A;  2OLB A;  1GR2 A;  2QRY A;  4ECF A;  4KFQ A;  3U94 A;  2FA7 A;  4FOR A;  1D9V A;  1IXG A;  3G3F A;  4OXV A;  5H8H A;  5L8D A;  2DWA A;  1JET A;  3U1O A;  5I2K A;  3QSL A;  1P1W A;  3PV0 E;  2ZMB A;  1TFA A;  5AE4 A;  3TCF A;  3MUQ A;  1US5 A;  2DE4 A;  4JSO A;  2DWJ A;  2YPN A;  5CRY A;  3KN3 A;  1A99 A;  4KYS A;  5H8S A;  4N13 A;  2PBW A;  3G3I A;  4QFK A;  1FQE A;  5FHN A;  5H8Q A;  1IIT A;  1B3H A;  2QPQ A;  5L9M A;  2XXY A;  3K6X A;  3VE1 B;  4H67 A;  3T9H B;  2V93 A;  2DE3 A;  4AB5 A;  3C32 A;  3K6V A;  1LAF E;  1OIB A;  3UA8 A;  1WDN A;  1LAH E;  4F3P A;  4PET A;  2D3I A;  1SQY A;  2XX9 A;  4R6K A;  4GF8 A;  4M4G A;  1XOC A;  4JXI A;  1LGB C;  5IAI A;  4EF1 A;  3U8Q A;  1URD A;  2XXR A;  3RNN A;  1DPP A;  5TPA B;  5DVI A;  1VE4 A;  1BTJ A;  4OTE A;  3G3J A;  5KDT A;  3T9X B;  3FXQ A;  3VDF A;  1MQJ A;  2G29 A;  4QSC A;  3OEM A;  4DXB A;  3S9N C;  3M3L A;  2M8C A;  3FVN A;  1QKA A;  1DTZ A;  1PBP A;  2X26 A;  2ZYM A;  1D4N A;  1B46 A;  4OMB A;  1Y3P A;  3S9M C;  4AQ4 A;  1Z7N E;  4KHZ E;  3S2V A;  5I59 B;  3LUY A;  4PFT A;  2RC9 A;  3SKP A;  5ITO A;  3P7I A;  3EQ1 A;  2GRV A;  3D4C A;  3K6U A;  3ONM A;  4I9D A;  3Q27 A;  4JWY A;  2F34 A;  4ND9 A;  4WED A;  2FNC A;  3HO7 A;  3PGF A;  2I3W A;  3CIJ A;  5EYF A;  3CFX A;  3CVG A;  2F5X A;  2I6E A;  3PPQ A;  1URG A;  2A5T A;  3IB2 A;  3MPK A;  3VXC A;  4H5G A;  4MLV A;  3T9V A;  3THI A;  2I0C A;  1SDX A;  2Q2A A;  4QF9 A;  4F39 A;  4DLD A;  2F36 A;  4KD5 A;  3TZA A;  5B70 A;  2Y7R A;  2ZNS A;  2OCU A;  3MP6 A;  2QSX A;  2RCA A;  4YAH X;  4KCC A;  1N76 A;  3T22 A;  3K1M A;  1LAG E;  1SW2 A;  3SEY A;  1ZJL A;  1B40 A;  4WKM A;  4ELP A;  1B4H A;  3TAJ A;  3GBB A;  5HPQ A;  4U4S A;  5LOM A;  1B1X A;  1N0T A;  2QMW A;  4YKJ A;  1ZKB A;  1LST A;  5L9O A;  1MXU A;  3PUV E;  4QFN A;  5M2V A;  3QUF A;  3V83 A;  4BDO A;  1B5I A;  2NXO A;  1B2H A;  1B58 A;  3RN8 A;  1XC1 A;  3HHF A;  4UAC A;  1LFG A;  1UIV A;  1ELJ A;  1N3X A;  5AA3 A;  1R9L A;  4U21 A;  4THI A;  2QS4 A;  1Y20 A;  2NUV A;  3VLW A;  4BLA A;  3PPO A;  3FIR A;  3IOT A;  4QFO A;  3VVD A;  1JVX A;  4N6P A;  3LSF B;  3PUZ E;  5I2N A;  5F7V A;  4QSE A;  4PQJ A;  4PFY A;  3I5O A;  3EHU A;  4YKK A;  4POX A;  4G77 A;  4GWO A;  2UYF A;  2H99 A;  3SES A;  5AA2 A;  1B0H A;  1L5T A;  3MZB A;  4BDM A;  4U1Z A;  5I57 A;  4U23 A;  3UIF A;  3M8U A;  1PC3 A;  4JWX A;  4G2Z A;  4NF6 B;  3HV1 A;  5DEX A;  5DVJ A;  2Z8F A;  4GD5 A;  2H9B A;  1A8F A;  3MP8 A;  1EZO A;  1SW4 A;  1UTH A;  5A5X B;  1H45 A;  4R9F A;  4F1V A;  1H76 A;  1N3W A;  1LB8 A;  3N6T A;  2KLF A;  4G8N A;  1NMU A;  3RQT A;  1DMB A;  1VFD A;  4X1B A;  2XXH A;  5H8F B;  4RPO A;  1GVC A;  4R9G A;  4KR5 A;  2LAO A;  5EHS A;  2DWI A;  4YMB A;  3R26 A;  4P11 A;  3H6U A;  4RY1 A;  1S9T A;  1FQD A;  4OEV A;  4MBP A;  3C36 A;  4G4P A;  3KZG A;  3EHS A;  2UVH A;  3GXA A;  3IR1 A;  4RPN A;  2F97 A;  4BDN A;  3OO9 A;  5KZT A;  5L9S A;  2HFB A;  1PBQ A;  4QFP A;  3N5L A;  1GV8 A;  5K2X A;  3OD7 A;  3S4U A;  1NKX A;  3K02 A;  4XKR A;  5JK4 A;  1J1N A;  4XKN A;  3KBR A;  3B6W A;  4GVO A;  3GZG A;  5H8H B;  1T0K A;  5I2K B;  1OMP A;  1M5D A;  1QJM A;  3H03 A;  2UVI A;  4BDR A;  1P1Q A;  1YCJ A;  4Q30 B;  5HM4 B;  1POY 1;  2GH9 A;  1RKM A;  3LSX A;  1MG1 A;  2I4B A;  3F11 A;  1UTB B;  2I3V A;  4JDF A;  3K6W A;  3WAF A;  3MBP A;  1IXH A;  2OWS A;  3PMX A;  3CR9 A;  5H8Q B;  4IO5 A;  4DE8 A;  2F7C A;  2F7A A;  1HSJ A;  2HAV A;  1S50 A;  4QRZ A;  2ANJ A;  3TKD A;  5JTY A;  4BDQ A;  1UIU A;  4HTG A;  3LR1 A;  3TTR A;  4RA1 A;  2ZXT A;  1IUD A;  4U2R A;  2O6A A;  3JV9 A;  3LSL A;  4DXC A;  4EDP A;  2H25 A;  2Q9T A;  3PMW A;  2O1L A;  1TWY A;  3TOD A;  4EQ9 A;  4OEN A;  3QYT A;  1URS A;  3RTW B;  3MJN A;  5KDT B;  3BFU A;  3T96 B;  5ITP A;  2I49 A;  1VSO A;  2O7I A;  3CRB A;  2O68 A;  3RTF B;  2VD2 A;  4GOT A;  2YJP A;  4ELQ A;  4K3F A;  5ISU A;  3PD9 A;  4OET A;  3O6G A;  2HZL A;  4IY5 A;  4RXL A;  1LB9 A;  2HCA A;  2NVU B;  1ZIU A;  4FED A;  3SDF A;  3KFM A;  1Q35 A;  4F22 A;  4C1T A;  4OFJ A;  2I58 A;  3QIM A;  4OWD A;  2ONS A;  4H8I A;  1Y4T A;  3W9V A;  3TTK A;  3W15 C;  1YAE A;  1XT8 A;  1B5H A;  1B7Z A;  1N84 A;  4R72 A;  2F6G A;  1JQF A;  3ECR A;  3CFL A;  3FVO A;  4E0W A;  3VVE A;  2QS2 A;  1JVY A;  1ZLQ A;  3E3K A;  3LBS A;  4GRK A;  2D21 A;  2A5T B;  3SEV A;  4MF3 A;  1FCK A;  3K0V A;  2DVC A;  1A7L A;  2V3Q A;  3B6T A;  2B3B A;  4ZZE A;  1PB7 A;  4YB6 A;  3R7X A;  2GHA A;  4LZ5 A;  2DXR A;  3ILU B;  3FV1 A;  3HHG A;  2F6P A;  1N7X A;  3O66 A;  1JEV A;  2PX1 A;  1MXY A;  4NMY A;  3H6V A;  3TPA A;  1QW0 A;  4I1D A;  1MY2 A;  2XXU A;  1Z7M E;  5DYH A;  2XHD A;  2XX8 A;  4Q5T A;  2Q2C A;  3MWB A;  1OVB A;  3KSJ A;  3BBR A;  1DPE A;  3OO6 A;  4DCY A;  4POW A;  4G8H A;  4JSD A;  3FXU A;  3HPI A;  4U4X A;  4ZEK A;  1MRP A;  1FTM A;  4ESX A;  3PU5 A;  1SI1 A;  1UQW A;  1OLC A;  3OO7 A;  2ESN A;  3ZKK A;  1B3E A;  1MPB A;  1B0L A;  3FD3 A;  4LQ2 A;  1PDA A;  5I2N B;  2OK2 A;  1USY E;  3FJ7 A;  2DS9 A;  3TQW A;  3ODB A;  4IO7 A;  3SET A;  1PB9 A;  3H3G A;  4O3B A;  5AA2 B;  4FEC A;  4ZED A;  3C4M A;  5I57 B;  3VLV A;  4OFO A;  2ZNU A;  4F18 A;  5DEX B;  3PPN A;  2H4I A;  1IIW A;  1MQD A;  1UTH B;  4IGR A;  1AOV A;  1MY0 A;  3EHT A;  4U22 A;  5AA1 A;  3I6V A;  2THI A;  1NH7 A;  4EF2 A;  2RF1 A;  5EHM A;  3S9L C;  1P99 A;  3VXB A;  2GFE A;  4F3S A;  1DSN A;  1VFE A;  4Z0I A;  4DXU A;  4X9T A;  2V84 A;  4GIZ A;  1LAX A;  1MXX A;  5CMB A;  4FAT A;  1M5B A;  3KG2 A;  1LCT A;  4YB7 A;  1LBB A;  1B52 A;  3OEK A;  4HW8 A;  1HSE A;  2UXA A;  2R9J A;  1B1H A;  4C1U A;  4OZ9 A;  2VHA A;  3H6T A;  3PUW E;  4IO2 A;  3DP8 A;  1EZP A;  2DVZ A;  3E13 X;  4R2F A;  3KEI A;  4NF4 A;  3LC8 A;  5FHM A;  3FVK A;  3TCG A;  4PFW A;  4ONY A;  2PVU A;  1RYO A;  4P0G A;  2HAU A;  1JEU A;  2XD3 A;  4NTL A;  2P0S A;  2I0B A;  4GFR A;  3TFL A;  2QS3 A;  3D4G A;  4MFI A;  4NF8 A;  2AYS A;  5TP9 A;  3MPL A;  3TUS A;  1MQI A;  3VV5 A;  3TTM A;  2CZL A;  3H06 B;  1KWH A;  1FTJ A;  1M5C A;  3DLN A;  4RK2 A;  2AL4 A;  3V89 B;  2D5W A;  1YPN A;  3E4R A;  4DCX A;  1SW5 A;  5ICQ A;  1FTL A;  2Z22 A;  5JTY B;  1ZBM A;  4XTC Q;  2RKM A;  3KJ7 A;  4O3C A;  4G68 C;  4JWO A;  2Y7I A;  3DEL B;  4FIM A;  3O9P A;  4OVJ A;  3TTL A;  3DP4 A;  1NNT A;  2DQV A;  3IL1 B;  3SEU A;  3OSQ A;  1MXV A;  3PPP A;  4GQO A;  2W7Y A;  2REG A;  3MZ9 A;  4MLQ A;  3SER A;  1II5 A;  1FQF A;  5KCJ A;  3O6H A;  2FYI A;  1MH3 A;  3KOS A;  2RCB A;  4IO3 A;  1MXZ A;  2Z8E A;  4YZZ A;  3KOT A;  2B65 A;  4EUO A;  2AIX A;  1I6A A;  1SYI A;  3A09 A;  3N94 A;  1B9J A;  2Q8J A;  5I56 A;  1LCF A;  4ELR A;  1FQC A;  1OQH A;  1H3D A;  1XVY A;  2F7B A;  2O1M A;  2X7Q A;  4R6H A;  4F2O A;  1XHY A;  1JW5 A;  4JB7 A;  3U72 A;  4FEB A;  1GTK A;  1R6Z A;  3G3K A;  2ALU A;  4ESW A;  1TT1 A;  1MQG A;  4H6D A;  3UN6 A;  2NOO A;  4G68 A;  5CI5 A;  3OEL A;  1XS5 A;  3MW0 A;  3TYH A;  2REJ A;  2OBG A;  1R9Q A;  4Q8R A;  4UA8 A;  1FQA A;  3V5A A;  4WXJ A;  2Z8D A;  3IK6 B;  4P0I A;  4NWC A;  2VP1 A;  2DWH A;  3PPR A;  3GLB A;  4LZ8 A;  1NFT A;  5I58 A;  2O51 A;  3N6U A;  3I3V A;  3A3C A;  4C0R A;  2P1S A;  1MPD A;  2XXT A;  4L17 A;  1QKB A;  4ZZA A;  4HCY A;  2ZYO A;  4LQ5 A;  3VVF A;  3IOV A;  3L6G A;  4GXS B;  1XVX A;  3IOR A;  3ZKL A;  2Z23 A;  1NL5 A;  3BKI B;  5H8N A;  4GXA A;  1FW0 A;  3A3U A;  1Q1K A;  3GBA A;  1EZ9 A;  4EXK A;  1SW1 A;  3ZS6 A;  3H7M A;  4MH5 A;  3EPE A;  4OYV A;  1DTG A;  1AIV A;  4X1D A;  3Q29 A;  1B3G A;  4HS7 A;  4NED A;  4YMA A;  1S7Y A;  3K2D A;  1F9B A;  3G3G A;  4FJP A;  2H5Y A;  5J1D A;  3T66 A;  3U93 A;  4EQ7 A;  4RYA A;  3S9E A;  3CI8 A;  4LAT A;  4H65 A;  2B3F A;  1D3K A;  4LA9 A;  1SI0 A;  2RC8 A;  4KYE A;  3C9H A;  1ZTY A;  4XKP A;  2Y7K A;  1QUJ A;  4F19 A;  2XXV A;  3FVG A;  3IO4 A;  3RPW A;  1BP5 A;  4FAJ A;  3O97 A;  3V8X B;  2UYE A;  1TXF A;  5AA4 A;  3CG3 A;  1R1N A;  2O69 A;  4NE4 A;  4H8J A;  1B5J A;  1CB6 A;  2VGQ A;  3M3K A;  1EH3 A;  3MVY A;  1WOD A;  3TDJ A;  1Y1M A;  3VLU A;  1IXI A;  1NNF A;  4RK9 A;  4F31 B;  1QVS A;  1N04 A;  2V3T A;  1I6Q A;  3G7W A;  3KN7 A;  1MY3 A;  1UTB A;  2XXQ A;  1YTV A;  2I48 A;  3MP1 A;  3Q26 A;  4YB5 A;  2XXX A;  3QK6 A;  2ZYN A;  1A54 A;  5CBS A;  4KQP A;  1P1U A;  4YU0 A;  1IXC A;  2XXP A;  2Q88 A;  4AB6 A;  5FTH A;  3QUJ A;  4DIG A;  3IJX B;  1O63 A;  1AH5 A;  2IEE A;  4KYD A;  2XXW A;  4HCW A;  3B6Q A;  2NWJ A;  5FHO A;  1RYX A;  1O64 A;  4ZDM A;  5DVF A;  2HEU A;  4GL8 A;  2P2A A;  4F1U A;  2VD3 A;  3OSR A;  1MPC A;  1ZMG A;  1B3L A;  2XXI A;  3C33 A;  3OXN A;  4R73 A;  4NF4 B;  4F1Y A;  1I69 A;  3UGW A;  1QUI A;  3FJG A;  5BWJ A;  3JYR A;  4ZE9 A;  2GHB A;  2DSF A;  5DTB A;  4O3A A;  2Q89 A;  3TTN A;  4NF8 B;  1SYH A;  1VR5 A;  4IO4 A;  1FTO A;  3EN3 A;  3FUZ A;  3FAT A;  4OEU A;  5DT6 A;  1TFD A;  5TP9 B;  4XXU A;  2HZK A;  1IQ7 A;  3IB1 A;  3IB0 A;  2V3U A;  4LZ7 A;  1H44 A;  1D9Y A;  4KI0 E;  5CM6 A;  2UVJ A;  5HBC A;  3Q25 A;  3CFZ A;  4OER A;  4NF5 A;  3K00 A;  3CSB A;  2DE2 A;  2F35 A;  4OFL A;  1P1O A;  3G3H A;  1Y1Z A;  2XD2 A;  3FAS A;  2DOJ A;  3MQ9 A;  5F1Q A;  1ZU0 A;  2F8D A;  4FE8 A;  1NNK A;  3W9W A;  3SEW A;  3N26 A;  3O29 A;  2R6G E;  1OVT A;  1HSL A;  2PT1 A;  1QUK A;  1JW4 A;  4OQO A;  1MM7 A;  1LFH A;  3PD8 A;  4IY6 A;  4BDL A;  4QHQ A;  1AMF A;  1MY1 A;  2RIN A;  2ZNT A;  2H98 A;  4TQU Q;  4EXL A;  3SEX A;  5KCJ B;  4EQB A;  4TLM B;  2ONR A;  5TU0 A;  3C35 A;  1B51 A;  1SVX B;  3TMG A;  1USY H;  3PUX E;  3UOR A;  1BLF A;  3IJO B;  2OZZ A;  5I56 B;  4YKI A;  1AL3 A;  4U1O A;  3USD A;  3TEL A;  5B7D A;  3OMB A;  2Y84 A;  5TPA A;  1MQH A;  4OHN A;  2R71 A;  1MS7 A;  4R74 A;  3IO6 A;  3FXR A;  4IB2 A;  4ELO A;  2DYX A;  3WAE A;  1ANF A;  3R6U A;  4GL0 A;  1N7W A;  3E9X A;  1H43 A;  4G68 B;  3MVW A;  1SBP A;  3RUM A;  1PEB A;  4DDD A;  3FV2 A;  4TOZ A;  4PE5 B;  3FGS A;  1B32 A;  1FTK A;  4F3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...