4NE5B

Human mhf1-mhf2 complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
74
structure length
74
Chain Sequence
b'SGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Centromere protein S
publication title The MHF complex senses branched DNA by binding a pair of crossover DNA duplexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 22
structure length 74
sequence length 74
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2013-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09415 CENP-X CENP-S associating Centromere protein X
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.286.100 Mainly Alpha Orthogonal Bundle GTP Cyclohydrolase I; Chain A, domain 1 GTP Cyclohydrolase I; Chain A, domain 1 4ne5B02
4DRBJ 4NE3B 4NE5B 4NE6B 4E45B 3B0BC 4DRAE 4E44B
chains in the Genus database with same CATH superfamily
2WSCK 1WM9A 1WPLA 4DRBJ 2KR1A 1TFEA 4NE5B 1A8RA 4E45B 4DRAE 2WSEG 3VEJA 2P11A 1FBXA 1EFUB 1AIPC 2LO0A 2WSCG 3LW5K 4R8QA 1WURA 5DMZA 3BMBA 1GTPA 4JA3A 2PN0A 4NE6B 3LW5G 1EL6A 1IS7A 4QPMA 4NE3B 1N3TA 2WSFK 1WUQA 1A9CA 4Q7JA 4E44B 1IS8A 1N3SA 2O01G 2WSFG 3B0BC 1N3RA 4DU6A 1FB1A 2WSEK 2LNZA
chains in the Genus database with same CATH topology
1WM9A 1WPLA 4DRBJ 2KR1A 1TFEA 4NE5B 1A8RA 4E45B 4DRAE 3VEJA 2P11A 1FBXA 1EFUB 1AIPC 2LO0A 5DMZA 4R8QA 1WURA 3BMBA 1GTPA 4JA3A 2PN0A 4NE6B 1EL6A 1IS7A 4QPMA 4NE3B 1N3TA 1WUQA 1A9CA 4Q7JA 4E44B 1IS8A 1N3SA 3B0BC 1N3RA 4DU6A 1FB1A 2LNZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRB J;  4NE3 B;  4NE5 B;  4NE6 B;  4E45 B;  3B0B C;  4DRA E;  4E44 B; 
#chains in the Genus database with same CATH topology
 2WSC K;  1WM9 A;  1WPL A;  4DRB J;  2KR1 A;  1TFE A;  4NE5 B;  1A8R A;  4E45 B;  4DRA E;  2WSE G;  3VEJ A;  2P11 A;  1FBX A;  1EFU B;  1AIP C;  2LO0 A;  2WSC G;  3LW5 K;  4R8Q A;  1WUR A;  5DMZ A;  3BMB A;  1GTP A;  4JA3 A;  2PN0 A;  4NE6 B;  3LW5 G;  1EL6 A;  1IS7 A;  4QPM A;  4NE3 B;  1N3T A;  2WSF K;  1WUQ A;  1A9C A;  4Q7J A;  4E44 B;  1IS8 A;  1N3S A;  2O01 G;  2WSF G;  3B0B C;  1N3R A;  4DU6 A;  1FB1 A;  2WSE K;  2LNZ A; 
#chains in the Genus database with same CATH homology
 1WM9 A;  1WPL A;  4DRB J;  2KR1 A;  1TFE A;  4NE5 B;  1A8R A;  4E45 B;  4DRA E;  3VEJ A;  2P11 A;  1FBX A;  1EFU B;  1AIP C;  2LO0 A;  5DMZ A;  4R8Q A;  1WUR A;  3BMB A;  1GTP A;  4JA3 A;  2PN0 A;  4NE6 B;  1EL6 A;  1IS7 A;  4QPM A;  4NE3 B;  1N3T A;  1WUQ A;  1A9C A;  4Q7J A;  4E44 B;  1IS8 A;  1N3S A;  3B0B C;  1N3R A;  4DU6 A;  1FB1 A;  2LNZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...