4NE7A

Crystal structure of engineered kumamolisin-as from alicyclobacillus sendaiensis, northeast structural genomics consortium (nesg) target or367
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
356
structure length
356
Chain Sequence
PTAYTPLDVAQAYQFPEGLDGQGQCIAIIELGGGYDEASLAQYFASLGVPAPQVVSVSVDGASNQPTGDPKGPDGEVELDIEVAGALAPGAKFAVYFAPDTTAGFLDAITTAIHDPTLKPSVVSISWSGPEDSWTSAAIAAMNRAFLDAAALGVTVLAAAGDSGSTGGEQDGLYHVHFPAASPYVLACGGTRLVASGGRIAQETVWNDGPDGGATGGGVSRIFPLPAWQEHANVPPSANPGASSGRGVPDLAGNADPATGYEVVIDGEATVIGGTSAVAPLFAALVARINQKLGKAVGYLNPTLYQLPADVFHDITEGNNDIANRAQIYQAGPGWDPCTGLGSPIGVRLLQALLPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kumamolisin-As
publication title Northeast Structural Genomics Consortium Target OR367
rcsb
source organism Alicyclobacillus sendaiensis
molecule tags Hydrolase
total genus 107
structure length 356
sequence length 356
ec nomenclature
pdb deposition date 2013-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 4ne7A00
1Y9ZA 1T1EA 4AKTA 1SIOA 3Q40A 4CFYA 3WHIA 1Y33E 3A3OA 3LXUX 4Z2AA 4DJ5X 2Z30A 3TECE 1TK2A 1ST3A 1V5IA 2ST1A 4J94A 2PYZA 1S02A 1SIBE 5ARCA 1C9MA 3D43A 3I37X 4I0WB 1AVTA 3DE3X 4BWGA 4AKSA 1Q5PA 2ZWPA 2B6NA 2PMWB 1GCIA 1NLUA 4NE7A 1GTL1 1Y1KE 1TO1E 3DYBA 1GA4A 1OYVA 1SCAA 1BFKA 4JP8A 1Y34E 3WIVA 3VTAA 4LVNA 5B1DA 3VYVA 3DE5X 1SBTA 1SN7A 1T1GA 2SNIE 1SCBA 3GCXA 1PJ8A 1AU9A 3DDZX 2X8JA 4GI3A 3DE7X 2PQ2A 5JXGA 4MZDA 1XF1A 1THMA 1Y3DE 1TM1E 3VSBA 5AMXA 2PWBA 3Q5GA 1DBIA 2Z2XA 3WIUA 3VHQA 1SBHA 1SUEA 1BJRE 1MPTA 3I2YX 2W2PA 1ST2A 1EA7A 2IXTA 1SUPA 4KPGA 3LPDA 1WMEA 1GA6A 1AH2A 3PTLA 1KE1A 2V8BA 5K7SA 4DZTA 3A3NA 3DE6X 4NMXB 1SELA 2PRKA 1GA1A 2Z2YA 4H6XA 3ZXYA 3F49S 4YN3A 4K8RB 1SUCA 4HX2A 5JXHA 3QFHA 3BPSA 1SIUA 1GNSA 5ARDA 2XTJA 2SBTA 2W2MA 3BGOS 3UNXA 3T41A 1R0RE 1R6VA 4KB5A 1P7WA 3CNQS 1IC6A 1SCDA 1GNVA 3ZXXA 2P4EA 4H6VA 1TMGE 4OMCA 1SBNE 1TM7E 1YJAA 1JEAA 1SCJA 5AVKA 1TECE 1P7VA 5B1EA 3I30X 3GT4A 3P5BA 2DQKA 4NE9A 1TM5E 5SICE 2DP4E 3OSZA 3LPAA 2QTWB 3VV2A 3DE1X 1AF4A 3TI9A 2XRMA 4HVLA 2W2NA 1PFGA 1WSDA 2IY9A 2Z58A 3DVSX 3GT3A 3EDYA 1GTJ1 2PKCA 1VSBA 2W2OA 1ZVJA 2WV7A 1PEKE 1GTG1 2G4VA 1BE6A 4RYDA 2TECE 5I9SA 1NDQA 2WWTA 1HT3A 5CW1A 4CG0A 5ARBA 2WUWE 1CNMA 4DWWA 1EGQA 2DUJA 1NDUA 2W2QA 5AVJA 2SICE 2HD4A 3DE2X 1ZVKA 1R64A 1SBCA 1KDVA 4KG7A 3AJ9A 2ID4A 1TO2E 3SQOA 2Z56A 3F7OA 5JMOA 1Y3CE 5JXIA 2Z57A 3A3PA 3I34X 1AV7A 1AQNA 1YU6A 2ZRQA 1SUAA 1Y3FE 4H6WA 4OMDA 3PRKE 4C3VA 1GT91 4ZARA 1PTKA 3DWEX 1Y48E 1CSEE 5JXJA 3DVRX 3WQBA 4FONA 3D9QX 1S01A 4WOBA 3TI7A 1SBIA 3DE0X 1Y4AE 3LPCA 4LVOA 4B5LA 4C3UA 3GCWA 1WMFA 1C3LA 1OT5A 3SICE 3DVQX 3AFGA 1UBNA 3H42B 3HJRA 1KE2A 1WVMA 2HPZA 1Y4DE 1LW6E 3QMPA 3L1KA 5FFNA 3BX1A 1C9JA 1IAVA 2ID8A 1C9NA 1KDZA 4WOCA 1SUBA 1TM4E 4M1ZA 1KDYA 1BH6A 1MEEA 3CO0S 1SVNA 2WUVA 3EE6A 5FAXA 2X8JB 1DUIA 3VV3A 2Z2ZA 1V6CA 1SPBS 1OYOA 1SUDA 1A2QA 1Y3BE 1SH7A 1BE8A 3EIFA 2E1PA 1YJCA 2SECE 1WMDA 3QTLA 5AQEA 3AJ8A 1AK9A 1YJBA 1T1IA 3DE4X 2PWAA 2GKOA 1SCNE 4OV6B 3DW1X 2ZWOA 1S2NA 3F7MA 1P8JA 4ZOQI 1TM3E 5FBZA 1BFUA 3DW3X 4CFZA
chains in the Genus database with same CATH superfamily
2L18A 3T7SA 4WJLA 2O5EA 3EXHA 2WHPA 2VH1A 3O4GA 3QX8A 3UK6A 2QI9F 4N6GA 1PWEA 4IXNA 2WJYA 3D1LA 5BYBA 5K8TA 4C0HA 2WQZA 3JARB 4IEFB 4OY3A 1YS4A 1MORA 3YASA 5EL0A 2AT1A 4IQ0A 4GO1A 5HMLA 4EF4A 4O4HB 3FNGA 4Y98A 4UHDA 3OPYA 4R05A 4KODA 3DBLA 2I2WA 3V7WA 2C8KA 3VI3B 1S8AA 5F64A 4EX6A 4XLZA 2FEWB 1C50A 2F3RA 2QYOA 3KD3A 4GZ6A 2HGSA 4O5AA 2CSXA 3VNAA 3NHMA 4YI5A 2YCBA 1CDOA 4F1JA 2W6NA 4DLVA 1CF4A 4MV9A 1M2JA 1Z73A 3A4LA 3EOZA 3O8QA 3IPCA 4QECA 5ALPA 5CAEB 2CJYA 3EGCA 4B17A 3FOAA 4XWTA 3S4YA 3QUTA 4XWWA 4EKGA 1UPAA 1Q15A 4W5WA 3E8XA 2X6TA 1IN6A 3LBHA 5DNDA 1WNFA 4E5VA 3ZLJA 2OHJA 4AKSA 2H4YA 3AZOA 3K4HA 2ZWPA 4HNQA 4LG1A 4LY0A 1PJ2A 3ZVNA 3LHFA 3IVAA 3QSYA 1XMQB 3AF4A 3DQPA 3HZZA 1RKVA 2HDNB 1JMYA 3LD9A 4PG7A 3V80A 4BN0A 4X7RA 3L4BA 4F96A 5ALDA 3FNEA 5LD2B 1JHAA 1T2NA 3QQ5A 2Y0CA 2AKAB 2JJ8A 3CUYA 2X1VA 5E2AA 4PYNA 4AN0A 4DQ0A 1G41A 1KZ9A 1F0PA 3R3SA 3WZMA 1PN3A 1LS1A 2C0PA 4DQDA 4HGPA 4MYSA 1YQUA 3GF4A 1GZSA 2Z4SA 4L5BA 3MMPA 4HAVA 4ZPXA 1O1YA 4J75A 3UJDA 3WIVA 5ED4A 1H3EA 1A0OA 4BFUA 1MB9A 2J09A 3RUDA 5CB4A 4DV3B 1LI4A 4Y6RA 3SVZA 4B3RB 3X1DA 4J4HA 5EJ6A 3VOTA 5FX2A 3OBBA 4C7MA 1NDHA 4JZKA 1I33A 1KC1A 2I6SA 1V1MB 4AY3A 5C80A 1E3SA 5JHGB 5F1OA 3KJNA 3TNFA 1N0UA 2MYUA 2D2EA 2HDWA 3JTEA 3ZWVA 4BEBA 1HLFA 1GTMA 1UM9B 5CTAA 1OFHA 2MOKA 5BMVB 4MGYR 4G07A 4AQDA 2OL4A 4W5HA 1OWPA 3VPBA 4BE7B 2AF3C 1IBKB 4MCIA 1FDRA 2WUFA 3MILA 2DETA 2P2ZA 2ZEJA 4BCDA 4RO0A 1YZNA 2WKSA 1C9EA 2UZ0A 5LIRA 4AP5A 5JZMA 3ENKA 4HDSA 2VQFB 2XDYA 3W2TA 4PXAA 4XM2A 1KOFA 1XF1A 3LHIA 2FCAA 4FN5A 1ONOA 3BB3A 4IWYA 4ZDKA 4RJIA 4Z3KA 4MPRA 5JALA 1CJCA 4EKNB 1TKAA 3LP8A 3OPQA 2VK8A 5CPBA 4DXHA 4MIOA 1XU9A 4QGGA 4N4AA 4DWJA 2QUAA 3AUXA 2WSSD 4MRAA 1RFGE 4XR4A 3FSGD 3NVMB 3A4NA 3K05A 3U9LA 3ZGNA 1KKMA 5I8PA 3ZNPA 4FR5A 3W5UA 1BJRE 1DKOA 4IXTA 2NPIA 4ZVPA 1USGA 1FU8A 2D1SA 3ED1A 2C94A 5E1DA 4MR7A 3T4PA 1KBQA 2ORVA 3ZBPA 4D8XA 4E5NA 2XKKA 3CG4A 4RFVA 1G59A 2X41A 2C4UA 2OR3A 4XIIA 3CZ5A 2VXOA 3AOEA 1FRNA 5FA8A 1KJYA 1Z25A 3AKYA 4P98A 4TLCA 5EN4A 3ZX5A 1U5BB 3DEFA 2ZZKA 1UXKA 4NZYA 1AO0A 3P2EA 1JG3A 4K6KA 5AK5A 2FGKA 4MW7A 2V8BA 1CULC 1Z34A 3UN1A 2LUOA 4Q1CA 2AFHB 3ORQA 4FMDF 4NMXB 4WJKB 3C7KA 1RE0A 4ZICA 1PV4A 2EV9A 1SCIA 2MT9A 3FSRA 2LP4Y 1N5MA 1QM5A 4BFLA 1HPLA 3OCXA 2OECA 2OUIA 2Y2UA 1LUAA 3FBGA 2BIFA 4II2A 2VPYA 3HE3A 4RK6A 4F4HA 4JLUA 1OF1A 2DSTA 3UFXB 1LTQA 2QNRA 4HX2A 4RTKA 3I5XA 1L7QA 3TAHA 1FQJA 4BAUA 2L19A 4OA5A 5KAPA 3H7IA 5AM2A 5ARDA 4I3FA 1G4HA 3DMHA 2ZAMA 3UT0A 4YY3B 2SCUB 3QYPA 4JBIA 1VCHA 2FHSA 2JK0A 5CLLA 4DS3A 1EXVA 3PE3A 4HJXA 2J0UB 3N86A 4CFYA 3L07A 1O4WA 1P5FA 3WWCA 4BZQA 2HU8A 4OUDA 5DNVA 1Z0SA 2AEFA 3LC0A 3GROA 2E49A 2J4DA 3PS9A 3ZIAD 2CXHA 3NRJA 3JYQA 2VI5A 3BBPA 5G4KA 4JVOA 2BFDA 5T5QA 2QZ9A 5DZSA 5CX1B 4DSTA 3Q8LA 4K6HA 1RI5A 2ZUCA 2H7YA 1FOEB 3D6AA 3H5WA 5FPQA 3V1TC 4HQKA 3IHTA 1CRLA 5DISB 2BF7A 5CMLA 1E1QD 3OUZA 1RQGA 3KB6A 5ULLA 3T9FA 4XCXA 2CLFB 1X1AA 4LF9B 3AM5A 4IEIA 4UNQA 3VDQA 2H63A 1Z26A 4MX8A 4IJKA 1TQDA 4O2AB 5J58A 3NVKI 3SEFA 4TZ6A 2IW3A 4LYDA 2ZB2A 4ZMBA 1XDSA 1CCWA 1JR4A 1SUSA 1G17A 2HL6A 2RAPA 4J2TA 3KZXA 2OT3B 2XUJA 1RYFA 3O8RA 4ZT5A 1SBQA 4V3CA 1U2RA 3K4QA 4W1QA 5LYJF 1D7OA 1VA5A 3A7EA 3ESDA 2COUA 3OSUA 4KDFA 4TMFA 3SC4A 1PT6A 3QWIA 3S27A 4IDCA 2WAOA 1VBNA 2BMDA 2PSSA 1NVVR 2C61A 2DLNA 3ELDA 2I2XB 4GXTA 1VPDA 4DANA 4DSUA 4WQMA 2Q28A 1RQ7A 1I9CA 1RWPA 5FUVA 3FG9A 3REFA 4NAHA 3ICCA 5SZHB 4ZEOA 3VV2A 4A8JC 5FNZA 3VNRA 2IELA 5KI6A 4CM6A 1TZKA 1UODA 4KXFB 2XUKA 3ZQ6A 1BNCA 2IY9A 1D3AA 2EFCB 2RG7A 4KGXA 3CG0A 4DIUA 5E9QA 3VR3D 3LZCA 1JB1A 3F47A 1Q1QA 1WEHA 3HBFA 3O4JA 4LRSB 4M37A 1WXDA 4OHWA 4QUJA 3DEKA 4WK0B 4YACA 4GOKA 3WSVA 1GKLA 3JZAA 4LAFA 3ZR4B 1RYDA 4FLMA 1J0XO 4NENA 5AVOA 3AEUA 3MEQA 6NULA 5BN4B 3F3KA 4IFEA 5AUNB 1LQUA 2JLCA 3GT3A 5BPFA 3K0SA 5CGQB 2FN9A 2GYYA 2HR1A 3QLTA 3UTCA 2J5XA 1HDRA 2ZSFA 1H0SA 4FZ3A 4Y7CA 1PX2A 1LLQA 2GHRA 2XWJI 2R6JA 3HP1A 4QIHA 2CVHA 3AONB 2ID9A 2AF4C 3GLVA 4OBBA 4QU5A 2D5CA 3K1AB 4POAA 3NBZC 3FN4A 3TZQA 3MW8A 2QUBA 2ZBQA 2IYZA 4AI6A 4KRGA 3DFMA 4Q7KA 2PRZA 3OX2A 3QSGA 4FYYA 4V1CB 4UFOA 3TB6A 3LVRE 1ZEJA 1U7DA 2JLBA 3MMNA 2X4IA 4EUKA 4AWAA 3I9OA 5HF5A 1G3UA 3V34A 2J3JA 3T9EA 4P3PA 4HGRA 2O8NA 1N9GA 2Q8PA 1O9HA 4ZKDA 3RT1A 3RYIB 1EVJA 3LS2A 5L45A 1C3EA 5EWLB 1XK6A 3LVFO 3PHJA 3TLXA 2IP1A 1QFZA 1D2MA 3ACCA 3ROXA 3NIGB 4YAFA 1ZYUA 1V1RB 3ELUA 4Y67A 1USUA 3V8BA 3PR2B 1C5KA 4MR9A 5DNWA 1O6BA 3TW8A 1L4UA 3MRVA 2ZIUB 4EX7A 1A4RA 1MUUA 1P3DA 2B8EA 2AJBA 3CRMA 1SZCA 2WAYA 3FWZA 3L8FA 3GLFA 3NYWA 3R9WA 5IBRA 1WS6A 1X74A 3QW2A 5YASA 3SBOA 2Q62A 3HDHA 4LK3A 3RF7A 5B6JA 2OHVA 2ODEA 1KIMA 2REXB 2VWGA 4TMYA 5TT1A 3VZBA 3WMEA 3L4KA 2JGLA 3KOYA 4GZLA 2HJ9A 3E7PA 4FYWA 3E5NA 3PIIA 4C43A 5C2JB 5JJLA 2R7KA 3N7UA 4J4BA 4AKEA 3DKRA 4EYGA 2BTQA 3O0DA 4L5YA 4OQZA 5CTJA 1TKBA 3PQ2A 4JH0A 4RHTA 4JB2A 4JVMA 4XQ9A 4ZV9A 1TW2A 3JYLA 1DQYA 1W76A 2JGDA 4PQYA 2ZPUA 5DCUA 2BSXA 3T54A 1Y1SA 3RRXA 1KI8A 3PDJA 3T9AA 1T3SA 5A4MS 5I9IA 4OGGA 1QH1A 3KD2A 1UC5B 2INGX 2F1IA 2VSNA 3K7EA 3FWHA 1UZAA 1QUEA 2GLTA 2XB2A 5FO1A 2YWCA 3OT4A 3T95A 1Z2DA 2C2ZA 1VPVA 4TV9B 3VFDA 3Q2OA 4B6OA 4ENTA 4LWPA 4V03A 1NN3A 1U8FO 5DLPA 2FZEA 3GLTA 2ZQZA 4OHOA 4US2R 4QOSA 4D9EA 1NC1A 2ZUVA 4YDRA 3C6KA 1M34E 1WD7A 2VP6A 3EXFB 3L18A 4EATA 1MEJA 4JP3A 1NMQA 3MWJA 4O4IB 4RZ2A 2H17A 2G9RA 2J33A 3HUEA 3Q7IA 4QFMA 4XJXA 3QVMA 3HP4A 5DKFA 3UGKA 5D01A 5JMTA 3KOWA 1E4OA 1PYOA 1FLAA 1GNRA 1EVKA 1RHUA 2FSIA 4MWOA 3GCDA 2OV8A 2DHDA 3IBTA 4C4XA 1M5UA 3W1WA 1ODTC 1NMXA 3ZBUA 5EA2A 3TI7A 4FYKA 2HO5A 3R9XB 1E5DA 1R0KA 1KMHB 2FZGA 1CY8A 2ONZA 3QHAA 4DUZB 2J4FA 3NM6B 3V4OA 3WK9A 4QGHA 5T6MA 3NWBA 1E6MA 1BDMA 1U2ZA 3QKSA 3IVMA 3K16A 3EDOA 3RIYA 4UE2A 3OM8A 1FYVA 5CFMA 1TNDA 4LDZA 1HRDA 1ZR4A 3GX1A 3QFTA 4WY8A 1AA6A 1U3DA 4BKOA 1XVLA 1OVGA 2XUGA 3K0AA 4GX5A 4CNBA 2FOXA 2GZRA 1H2RS 5HXAA 2OQRA 5CIQA 2YIJA 3BFVA 4LGYA 2JAUA 4QVKA 2F1KA 5HNKA 4EITA 1CS0A 1RWBA 1IQRA 1JPUA 1SXJB 1UIMA 2UZIR 2Z1MA 3OCYA 4HMQA 4LIPD 5EP2A 2I65A 4YROA 1N34B 5DXFA 4OJTA 5H8WA 3AVUA 4X85A 1YWGO 2AVDA 2PGLA 3HJRA 5JH7F 2DHEA 2VEOA 2EERA 4DSZA 2W2KB 4ZI5A 2LVBA 2VK2A 1P18A 2VYNA 4RL6A 3T34A 2R8ZA 1JR2A 2FB9A 4PYRA 3VTFA 1Y8ZA 3JRXA 2VWPA 3P0HA 1BE1A 4EGSA 3M1IA 4RADA 5GY7A 4YP0A 5KCZA 3NAGA 4IYRA 3EASA 4YWJA 4DMGA 4NICA 3C1OA 5KC8A 2WJHA 1T8YA 1AKUA 1BCSA 3DZJA 4AK9A 2QRKA 1FNDA 1EUDB 2D7CA 4N0EA 4X1YB 5BP7A 3KL2A 3PLRA 4KPUA 4NJMB 4TZTA 1KJIA 2DWCA 2ZUSA 4ZAWA 2V9PA 3QX3A 1I0IA 2FX3A 3DWFA 3W34A 2YIMA 2CMDA 4B6SA 1B7GO 3ROFA 3SQDA 3ETNA 3WKAA 1P7CA 2V8OA 4G5SA 4TUYB 1GN8A 2XEDA 4YV7A 2GTHA 4UMEA 1NW4A 1QOZA 4ZVQA 1BH6A 2VT6A 3G9QA 1YASA 1XB2A 1F14A 3HCWA 3KYBA 3VISA 5KNBD 2JCSA 3WP1B 3QVLA 3MWEB 3TDMA 2H9AA 2VUIB 1NW5A 3PXAA 2GMWA 3L9WA 1SFRA 4X1KA 3WB2A 3UKDA 3NU1A 2QZPA 3SZGA 3L7LA 3WGKA 3BB1A 4RSRA 2H4XA 1CDZA 1Y3BE 2Q3DA 3K72B 2YJNA 3AETA 2WWHA 4CKXA 5FTMA 4AULA 3MBKA 2ZJ4A 5JC8A 3EIFA 4LJ5A 2GXUA 2FFAA 3CLRD 1BRMA 4NZNA 3D5EA 2JJMA 3TD6A 1BD3A 4BE4A 2BHTA 3THOA 3I9NA 2ZWIA 4IIHA 4XGQA 4JI1B 2IHZA 2M1XA 2XF2A 3NPMA 3V1KA 2Q1UA 3ICVA 1JHYA 1JI3A 3EIOA 3ZX4A 1SA0A 1OBOA 1UWCA 2BKVA 2H4FA 3K94A 4LHSA 5JZSA 4NMHA 3FPJA 3A28A 4X66B 1O9BA 3KKPA 3U1VA 2GKOA 4PPGA 4NY1A 4OHKA 4PYMA 5CIWA 1GNLA 2I3ZA 2EZTA 3FUCA 2GUWA 3JQPA 4B33A 1P4JA 2OCAA 3U3JA 2E85A 2OQ2A 5DVZA 1CWUA 1HFWA 2FN3A 4HUQA 4FC7A 2WJ3A 4F5DA 4KVAA 4MB6A 3O2QB 3QXJA 1XKTA 4IM7A 5K8CA 1SIOA 3HU1A 2R79A 1YBVA 2C3YA 2OCLA 2LGJA 3EIXA 4E51A 4ZCMA 2Q7OE 3A3OA 1DCTA 3WLTA 1DJMA 1TAQA 4R8RA 1K92A 3CWQA 1XAGA 2VPPA 3HYSA 2YHBA 3Q9NA 4TX1A 4EGFA 3BZUA 2IIBA 4IGAA 2CVPA 4G1BA 2HA0A 3CRRA 5HEKA 4I81A 2NXJA 4WZ6A 4NFLA 1G38A 2BOVA 4CEIB 1TQ4A 2KI5A 2QTFA 1ST3A 2QTBA 1W2GA 4NBKA 4N18A 5FLEX 3TR6A 3QBTA 4EFMA 5CFQA 3U5ZB 1G8JA 1XZNA 2CXUA 4Q12A 4URZR 2UAGA 2EJBA 4IXDA 1U0FA 5CXSA 4CEJB 1P74A 3Q8WA 1XZEA 4GZ3A 1SIBE 3ZHZA 1VMIA 2JGJA 5GWXA 1H2ZA 2R8XA 4IUYA 3GZNA 3PQ4A 1ZK4A 1UC9A 2C58A 2FETA 3SLRA 5HQTA 1BXGB 4TTVA 4I9NA 2ZVDA 4BX0A 2Y92A 4LE0A 3FTFA 3HXMA 1AVTA 4O2AF 2G1AA 1VHDA 4DA9A 1YIDA 4B3CA 1Q5PA 4JEIA 1XALA 4UTXA 3VAAA 1GCIA 2WUEA 3AEKA 3MIIA 3BE5A 1TTTA 1YNSA 2OGUA 4G1VA 2HCFA 1T2CA 3L79A 3U4HA 3O3MB 1NE7A 2P9QA 2LW7A 3JY6A 3PUWA 3SS9X 1M0EA 5H59A 1QRDA 4KSBA 5HF9A 4H1VA 2TMKA 4RESA 3DCJA 4KRFA 1IK6A 1NQAO 3BRCA 1OV6A 3H5RA 4CMAA 5GPBA 1GEGA 2A1TR 2ZB3A 2Z3WA 1JEJA 3GRZA 3BD8A 2PXAA 4DG9A 2XBMA 3DD1A 4FC6A 1XTPA 1YQGA 2J1LA 4JT9A 3ETGA 3LY8A 5FEUA 5JH7A 1AMNA 3SBEA 5LLDA 2BH9A 1UBHS 5LJIA 4DUPA 1FFSA 2ZT6A 4WK2B 3VHRA 1KP2A 2QUHA 2GXAA 1HE4A 3VYRB 3ZGVA 5JI3E 2J08A 3NWOA 5LIPA 3RW9A 2CLKB 2GM3A 1GL7A 1OWMA 1E4YA 3QXCA 4DR1B 1XNJA 4ZEXA 1SN7A 1UM9A 4YJKA 1JJ7A 3PDIA 4PE5B 4RKRA 3LQRA 4LDQA 1V26A 4RMHA 1TFRA 4UVHA 1LVGA 4KFUA 2VLBA 1U4NA 3LTNC 2ACVA 1PJ8A 1EH5A 5LQUA 1IG3A 4Z9BA 3UGTA 3F78A 1ZOPA 4PSDA 4CF4A 3PXUA 1F8GA 5IH3A 1SOMA 3T5PA 4KWIA 5HBGA 2ZYRA 4TLBA 1JH8A 3WOHA 1LEHA 4DBLC 2Q07A 1Y4SA 4PG5A 1II9A 3F7TA 4BN5A 4E2YA 2J7KA 2CUZA 2AZ4A 3FJYA 3N2KB 1RIFA 1Q95A 3I0MA 2AK3A 1YIOA 4GU5A 4HS9A 4YJGB 4BPRA 2JFVA 4ETNA 1T2EA 3KV1A 1RWQA 5EWJB 4B7XA 3KT0A 3R8CA 4F6RA 3RRMA 5LSAA 1JALA 3V2IA 1TM1E 1IXZA 2PMBA 4F7DA 1CY6A 4K3UA 2Q5FA 4IZ6A 5JSHA 2DQ4A 4UPEA 1MQSA 2Q4BA 5KNCA 5LU9A 3ZDCA 3KUCA 2Q1WA 3B85A 4LBVA 4M21A 5EP1A 3ZTWA 1T5DX 2GSWA 3O8CA 3DBIA 3AVQA 2MJLA 5D84A 4CMEA 1ILWA 3OX1A 3QG5A 3TQRA 1WDWB 4BBJA 1K88A 1E3LA 4DVJA 3N6XA 1VIYA 1IULA 1XDDA 3ABSB 1IHUA 3FPLA 4UW9A 2WWVD 5BQ3A 1UFQA 4H0CA 5BXYA 2HMYB 5T4FA 3I2KA 1DL5A 1EJ2A 1RWVA 4JJEA 3V3KA 4B09A 1DJNA 3RT7A 4FCVA 4M53A 4IKPA 4WKOA 4CIWA 3EA0A 2P9BA 3R3ZA 4GYKA 3A9SA 4AUMA 5JDIC 2J0QA 2FW1A 3Q4GA 4WKPA 4JNCA 4KSYA 4YMLA 5K8UA 2C7OA 4CTOA 2RGUA 3LFTA 1LD3A 3AWDA 4XIYA 4Q4JB 3REQB 4TS4A 4JJIA 1ZJZA 3SZRA 3DC7A 3LHDA 1JXQA 1O95C 5F77A 4QT4A 2XXAB 2H9IA 3T1VA 2WSIA 3MPUA 3C43A 3TN7A 3L1HA 3W78A 3G8CA 1LS6A 5TQ0B 2FSHA 3HNOA 1V43A 3GLRA 4ZGGA 1O94A 2HRDA 4CR6A 5CDUA 5KNDD 5DHPA 2SCUA 4URUR 2FXVA 3ZU5A 1MOZA 3BSFA 3QX7A 3TE7A 2VA9A 2PGDA 3H3FA 4BP8A 2PS9A 2R60A 3NLLA 5BV0A 1DAKA 4Y1GA 4CLEA 5C8VA 3VZSA 5FWYA 2JIQA 4FZRA 4X6LA 1RRVA 3CV3A 5B3AA 1TYEB 4E3ZA 2PWYA 1WUTA 2AGVA 3FPBA 4BDTA 2VHQA 4O4IF 5GJVC 4ACAA 1NI3A 4UULA 1U0OC 3BDIA 3UENA 4ZIRB 2VNSA 5DASA 4MDYA 2NZ2A 1GSOA 1QC5B 3KEFA 4QO7A 1K27A 5ALSA 2CKDA 3IEXA 3C97A 4A92A 4KE7A 3FX2A 3HBMA 1SVMA 5CA1B 4ANFA 3RUFA 1B76A 1P91A 4L9SA 2J3MA 4NLLA 1X7WA 4D4IA 5F2EA 5IVIA 5EWMB 5DRTA 3D8NA 4IIJA 1L5FA 1YQWA 4AG3A 2E5FA 4KIGA 1AA9A 2CHVA 3OMLA 2QG9A 1MIOB 4JR2A 4O8CA 4MKZA 1QYWA 1GPBA 2V4ZA 3DKKA 1ZGAA 2X77A 3JQEA 5K3AA 2B4AA 1TM7E 2QVYX 3C3BA 3LUAA 4MQMA 4DC0A 4IH4A 1YUMA 3TLGB 2DTDA 2CT8A 2FPSA 2PGAA 4G0PA 4BNZA 3T3NA 4RSHA 1N57A 4H17A 4PWYA 5EG5A 3BK1A 5FTLA 2IU3A 2XIJA 3RJ9A 1PLKA 4NNOA 5DYNA 4CVNA 2VUUA 1YA6A 1ABFA 3B6MA 3FETA 2JCBA 2YJ5A 2O06A 4K9MA 1OAAA 5JWHA 2NUTA 2VTBA 3AR3A 3CBQA 3H05A 4H4CA 4M0UA 5BNWA 3FOCA 4W9NC 3PEWA 1GPUA 1IHOA 2PD3A 2ATIA 1VL5A 4H0NA 3TLJA 4D1YA 4DQLA 1KP3A 1CZNA 2VDKB 5K6TA 2J48A 1NF3A 2WF6A 4B82A 5E6RB 2Q9UA 2UYOA 3E0XA 3PC8C 1CUAA 4HZUA 1D4AA 1IE3A 4C2TA 5IDVA 1LK0A 4PQRA 4OGLA 2QNIA 4B6FA 2RHBA 3BOSA 3D7RA 3DVSX 5KJ6A 2ZDQA 3T5BA 3EQ9A 3ZWWA 4BLQA 4L2IA 4RVGA 4ZYYA 5HIMA 3V6LA 1HEYA 2HWUA 2Q49A 3DUFB 4JC0A 1PZHA 2JLVA 3RK1A 1AOXA 1I4LD 1PR4A 3LECA 3WQHA 1F3OA 5JEEA 3D2AA 4MA5A 5F76A 1GKUB 3QQPA 2AHOA 1BJKA 1RRKA 1UADA 2MMGA 2GJAA 1CR2A 3ILVA 2XJ4A 2XT6A 4UZFA 5EIBC 1REQB 2OAP1 1UPBA 1H65A 2VA8A 2HQBA 1WW8A 3KLMX 1QGOA 1BRTA 1YD7A 1EP3B 2F1HA 2TECE 1SK9A 1BQ4A 5B2EA 5JZ9A 3W4JA 4OP2A 4N12A 2P6PA 4N39A 3O3CA 1R6AA 4CMIB 4GPAA 4D56A 5ALWA 4C7JA 1BA2A 3TNDA 4ZOLF 3B12A 3OY2A 3RYIA 4J7UA 1QIKA 1RWXA 2EWMA 4N49A 1HLGA 1TAGA 3QVVA 1QCYA 3IDOA 4O2BB 1H9CA 1SMKA 4C7BA 1EUYA 2I4MA 4AICA 4YRGA 5BUCA 3EQ7A 1Z16A 2J3EA 2GWHA 4GOXA 4TS3A 4A2CA 3AZPA 1CE8A 4FDTA 3EIEA 3KPUA 4KW7A 3P9PA 1CUGA 4IJWA 3MCWA 3JQGA 3QLVA 3DKIA 1T8SA 1GV1A 2QSZA 1A8PA 4M9CA 1GCGA 1XTSA 1Z2NX 3Q7PA 5DWVA 1VYHA 1YZGA 4FTWA 4OHCA 4L5CA 1IQPA 4YONB 5B36A 2ZJBA 1PUIA 3ELYA 4Q9LA 2WYWA 1M1NB 3NASA 4P5PA 4PSCA 4NTZA 3KQYA 1C4XA 5GZ3A 5B1YA 4WECA 3RYFB 5JS2A 1C8KA 5ALYA 2A0YA 2FG6C 3PYLA 3DFFA 1Z12A 4RTMA 2OBMA 3EEBA 3SR4A 1FMJA 1ZK1A 3EX7C 1UP7A 2ZM6B 1JA0A 2VUSA 1B2RA 1HZZC 1U28A 1BAPA 4ZCRA 4GWGA 3HB1A 3UHFA 4LYFA 1H42A 3S6JA 4EG3A 3Q3JB 1B26A 1RBQA 1D4OA 2B9EA 3EH1A 4E21A 2PVPA 3EXFA 3FF1A 5HR5A 2DUMA 1RBYA 4KFTA 2QB5A 5TF4A 1UJ5A 1AV7A 3V8MA 1TE2A 3PPWA 1AQNA 3CVOA 3VR1A 1F2DA 4ZRMA 3L0IB 1SU6A 3FYUB 1VB5A 1FQWA 1RRGA 3GLHA 2FR8C 1JFRA 4H6WA 3UCFA 1NUUA 1H2AS 2H59A 4B40A 3SIWA 1L3CA 4C7KA 4KMRA 1R6BX 1SWVA 1P2DA 3EZ2A 3FI9A 4R8VA 5IARA 3L3BA 1AQLA 1KK2A 4KUGA 5A5VA 1NUPA 3ETEA 3B6JA 3GELA 4KO1S 1IY9A 4M7OA 4L8WB 2XMZA 3N5CA 4AZSA 4DE5A 4G36A 4FGUA 1YL7A 1XQWA 3BXXA 3K2EA 2MHCA 4YJDA 1ZD8A 2A7QA 4QDJA 3KAJA 1KVSA 3PNSA 3Q88A 5HGJA 3ZTYA 3I2JA 4ALIA 4ZK6A 1CY1A 1SHUX 5HOQA 3HJHA 2OPBA 5IJ0A 4MVXA 5FWDA 3CB4A 4LNUB 3ZLVA 4DAEA 4HHEA 3TCXB 4AJIA 4AXBA 1PFQA 4TRMA 2R85A 4C3UA 1GOTA 1BWSA 1MOQA 2FVYA 5JUWA 3BCHA 2XCSB 3IILA 2CV1A 1A82A 1FJXA 2KPOA 1MVLA 2ZB7A 2HIMA 4PSKA 2GF2A 3FHJA 4B0OA 2ZCJA 3OEEA 5DMXA 4A36A 5GJBA 4ZI7A 4EEKA 3DR3A 1HQKA 1V8OA 1VDMA 4M0FA 3V46A 4YUXA 5I4BA 2LD4A 2XTAA 5LBUA 1SXJA 5FEMA 4JI5B 3ENVA 2QR3A 1P17A 2HA7A 3TEJA 4HGZA 4DILA 1PG0A 3AYZB 1PQYA 2FR0A 1U8ZA 3BERA 3BK2A 2HW8A 2FLKA 2DVMA 2CHUA 4MVJI 2VP5A 1AC5A 1M67A 4IFBA 4MWGA 3T0IA 3TIIA 2N75A 3HWX1 4FU0A 4BKQA 3SHVA 1VMAA 3VPXA 4BLVA 2OOSA 3DL4A 3H17A 5DK6A 3U7IA 2X2FA 1KAMA 2GLUA 4TMKA 2EJUA 1JMVA 1X19A 1YOBA 4EENA 1V7ZA 2I3DA 2O6HA 1KF0A 2IUEA 3D6NB 3O90A 3VSCA 1OE0A 5AUPB 1ZJ5A 1DCMA 2R86A 1KA9H 2VJMB 3I1IA 2QLTA 3LT4A 4LE2A 4FP9A 4QU8A 5JMWA 4UM9B 1I94B 1XA0A 3HDJA 4O2LA 1U7HA 5FLXA 2IHKA 1K68A 1L7XA 1A5SB 1G98A 3G0BA 1W36D 3WZ2A 4AKHA 2RK4A 3UJ6A 4QVIA 3AFNA 4P8RA 4UQPA 1VJ5A 4EA6A 1RRCA 4CRWB 1C9NA 1CD5A 3FW1A 1HDGO 3VDMA 3WTBA 4OQDA 1ACLA 4YFYA 4UNIA 4XWOA 4XWKA 1CLEA 3CZ9A 4ZOLA 3X1ZA 3IQFA 3V6MA 1V9LA 3QTBA 1RYMA 1E1YA 3FNRA 2RC6A 1Y98A 3PFWO 1GILA 4GVXA 4IVQA 3D4LA 1RQPA 3O2NA 3AM4A 3SHOA 1ZK0A 4WKBA 1GAQA 3ZY3A 4Q5IA 5E6UA 2VHJA 1QANA 2D3WA 1H2WA 2PLWA 1TJNA 2HGZA 4YRLA 1CB7A 3S8YA 2X8JB 2IZ0A 2XVZA 1L8XA 3LXRA 2C96A 1OX6A 2JVJA 3NDBB 2IZ5A 2GVDC 2CL7X 1JECA 1J8YF 1Y89A 3WWEA 2PKRA 1W0CA 3L77A 4AD8A 5CVCA 1H1LA 2H1FA 4B87A 1ADYA 1KQFA 3AY7A 3SJBA 5HP4A 2RB5A 2FQ1A 3H18A 5D86A 2BLNA 2G0TA 3OZEA 1WTCA 2JIBA 2DKOA 2J0SA 3GNLA 3OF3A 4R8KA 5EIAA 4ZO7A 1QV6A 2K7ZA 5F52A 1GIAA 1THZA 3H5LA 4CT5A 4JR0A 2PT7A 4P0QB 3CSUA 4PICA 1K1EA 1JJIA 1YI1A 3OLWA 4WW0A 3SEQA 3ZHXA 1GAXA 1IXYA 3CNNA 1HSZA 4BNGA 3FUTA 1K3UB 1Y8QA 4RY9A 4WWHA 1YJBA 3FCEA 2X7HA 1E2FA 3MD0A 4PYOA 1OIVA 1T6BY 4JLMA 4PNZA 4R81A 3VOAA 2B7BA 1D0VA 4Q47A 4C30A 1IUNA 1G9XA 1H94A 1E79D 3BCSA 4PN3A 3QVTA 3GL9A 5E95A 3CRW1 3Q8MA 4MTLA 3T7AA 4A8HA 4MUGA 2QRLA 3MWKA 4YDHB 3L41A 4TTSA 3K1YA 2GFIA 4R98A 5DX0A 4MV1A 3RG2A 3SC2A 2WYOA 1BJTA 2JJ2D 2XTMA 1FQOA 4UZSA 1KETA 1E2MA 2ECFA 4ITUA 2BGLA 1ZS9A 1VIMA 3W7AA 3M8KA 8GPBA 3DBHB 2YHSA 1WIWA 3DF7A 3KHSA 2E18A 4FD2A 5JG7A 4YRIA 3WISA 5ADUS 3UY4A 3KKZA 1SBYA 3DAFA 3A05A 3EARA 1TEZA 4PTYA 5FOWA 4NEHB 1X7YA 4CEIA 3U4DA 1ZI8A 3WI7A 4NXNB 1X8JA 1TEHA 3W90A 3D7KA 3SM3A 4OXQA 1NIJA 5AW3A 1QTRA 1V2GA 3GWGA 3KKOA 1RJ9B 4KX3A 1WR8A 2P65A 4CM4B 2IF0A 2VRCD 4X3CA 4QZVA 3GIWA 3NTXA 2NAFA 1BXGA 2YJTD 4MROA 4RYLA 4UAGA 4R1PA 3TTSA 2I91A 3I9KA 3P9CA 4D3SA 3LC2O 1POXA 5KVAA 4A0HA 2B0JA 5FBKA 2JVKA 2IA5A 2I8AA 3K30A 1O4VA 4TV8F 2ZT7A 3E81A 2X8WA 1B93A 1WP4A 3V97A 3HJAA 4NZZA 1W4LA 5DIZA 3ZIDA 5AKLA 3R6WA 4HB4A 2HMSA 4I0WB 2POCA 2ZITA 4CF7A 3C8ZA 3RBAA 2NTVA 4G65A 1KS9A 2GPBA 4M8SA 4OL9A 3FCAA 3S2IA 5IM4A 2FPOA 1WQ4A 5FWXA 2P4SA 1S3IA 2VN8A 3B20A 4LV8B 4BFVA 5F7JA 2VT3A 3M4ZA 4B6GA 4X90A 4CI9A 4Z53A 1LVHA 5BVHB 1G291 1XRLA 1QP8A 3U49A 1G8MA 1M0WA 5KYWA 1E1LA 4PVDA 5AK0A 3F3SA 3UKOA 3F9RA 4HNVA 1U1GA 1UOEA 4ML3A 1HNWB 4P4GA 3TAXA 4AZTA 3RLIA 1VG0B 3H83A 4JI6B 1L7BA 2R3SA 3A4MA 1JIUA 3KEQA 4TWZA 1QDLB 4I14A 2I55A 3JYNA 3F67A 4RTSA 2WKPA 3X1MA 5TS2A 3R77A 3PX2A 4OHUA 5AESA 4AY6A 2YDXA 5AKXA 1JG2A 3X43A 1RSZA 2P2LA 1PCXA 2ORIA 3K0CA 5F51A 2AJ8A 4GD3Q 4LYYA 2DTEA 2ZJ8A 3KNZA 3OEHA 2H29A 3N0XA 1BX0A 3EFOA 3G2LA 1J5XA 4LX0A 3K1ZA 3BMNA 2B4TO 3FYDA 3PC7A 5AJWA 3PC2A 4BO7A 3SQWA 1VOTA 5AHRA 2QL7A 2IP2A 2PFGA 1GGFA 5NLLA 2ECPA 4ROSA 3BGVA 4XW2A 1NLZA 2I6GA 5B7GA 2GBCA 4EY5A 4CE6A 1MBZA 1UKYA 1II0A 3ZD8A 1SPXA 4ZVMA 1DVRA 1U94A 1U7PA 4WGGA 5EWJA 5J4YA 2EX0A 4PLZA 4B85A 2J3LA 1EFKA 2PX0A 3G8DA 1EWVA 2C2XA 4OI1A 3S81A 1A9XA 1WCXA 1ZH4A 4JKYA 3K32A 1BS2A 4LOJA 5KTTA 5CCEA 1W6RA 2ZRLA 3ITKA 4BTVA 2AN9A 2WFAA 3QIAA 1RKUA 3HBJA 1YR7A 1F0NA 3AX6A 3SF0A 4CM3A 4OVKA 1T3HA 4WASA 2OFXA 3ZV3A 5C52B 3TW0A 1F1BA 1IDOA 2ZYVX 3HCOA 5CDGA 1NU8A 1Z45A 4O2BF 1LWOA 4F1KA 2ZIEA 4RZXA 1M1YA 1IQ0A 1N3YA 5IJ9B 3Q5GA 4W6ZA 2XNDD 4UHEA 1YACA 1SG9A 3W05A 5L4LA 3SVLA 2HKIA 3OFNA 5BT9A 1H4SA 1K8XB 1G4UR 1QE5A 1J1IA 4H1HA 2DEUA 2WT4A 1ECJA 1KI2A 1MAUA 3DA8A 1YDGA 3IP8A 3T7CA 1ISGA 4KAXA 2VQDA 4MUKA 1KL7A 5HTOA 5AD1A 2W8BB 1N2OA 4XRGA 1CZRA 3GJ5A 3P9ZA 4QYIB 2FSUA 1C41A 3TK1A 1W88B 3IS3A 4A8JB 3WLSA 4X71A 4RDCA 4JUBA 3REQA 4NR0A 2R7LA 1EUCB 5J4LA 1A8QA 3DS8A 1G8KA 1PK7A 1TZJA 2BP7B 1HUQA 3LQQA 3QNUA 4FZJA 3U80A 1AH2A 4QGFA 3KKQA 1M2FA 4C3OB 5A7HA 4D4HA 4LHVA 4U6QA 2Y1EA 9ATCA 5EE0A 4MS1B 5AVWA 4DZTA 4GX1A 3PUHA 3JWJA 3QUBA 4IIBA 3ZE6A 2ACKA 1YH3A 1IYZA 3IDZA 2W90A 2E4WA 4S0XA 4R1MA 3K70C 1Q3KA 1Q0TA 3HVHA 3GEMA 4LMRA 5BQXA 5TMPA 1EX7A 1QORA 1S5PA 4JQZA 3WLPA 1IAQA 2QDKA 4JUCA 1P81A 4TM7A 1I9GA 2TMYA 2D1FA 1Q3TA 4CJXA 2CV0A 4OGFA 5GOZA 5JXHA 2FSSA 4HNUA 4QUEA 2BFCB 3NKVA 4EA7A 2GD2A 2Q4OA 4A10A 4C3ZA 5FADA 3LHSA 1R4AA 1EGMB 4JROA 1PT7A 4JCCA 5C8XA 2IS4A 2YOGA 3ETHA 4HZIA 2IPAB 4ZIRA 3BKXA 1CUYA 1OQAA 5B58C 3ETJA 2BMVA 2K2QB 3V4FA 2NVUA 3BHNA 2G77B 4J16C 5IKOA 4DCPA 1HE3A 3HA7A 3X1WA 1WG8A 3ICEA 2ZTVA 4TV8A 3DTVD 4XX1A 3EA4A 4AYXA 4KFSA 4C2BA 4KB5A 4NCKA 3RV4A 4UQLA 4WXYB 2K4MA 4WAUA 3ASYA 1IC6A 5A03A 5DM2A 4MRPA 1AK2A 3R7NA 3HPQA 1HYBA 1V3UA 2VQ6A 2YOFA 3DNPA 1MIOA 4OLFA 2BMWA 2Z6UA 4EY3A 1YA8A 2CXTA 4PV7A 4AIIA 1WWKA 4Z7OB 2H8KA 4LDRA 2YUTA 1LF5A 3KQSA 3HJGA 1TUIA 4X3OA 3E35A 3H4VA 3G0IA 3UMSA 4P1ZA 2ILTA 2JI6A 1CUJA 2ICAA 3GH3A 1C4OA 1UBGA 4WBSA 5AVQA 4B3TB 2RJOA 2BEVA 2XF8A 4IDBA 2VF5X 3B2EA 3F6SA 3Q15C 3ZOZA 2QBYB 2ABWA 3EZGA 5AKIA 4EMUA 5H4GA 5IRCD 5F9HA 1EQUA 2E21A 1F51E 3K9CA 3BWBA 3MCVA 3C3CA 3LNCA 3NTRA 4HDOB 1N36B 1UDXA 2O1SA 4ZHQF 3SMVA 4B4VA 1M2EA 5KQPA 1SKMA 5LB4A 2WP8J 4DUGA 3QOXA 1QG2A 5I9LA 2ZJOA 3LPAA 2IXAA 5DLEA 1JA1A 3E18A 2Z9DA 3GPCA 3HN6A 3NTQA 3SSMA 4EVSA 1TUBA 3J80A 1Z63A 5JZVA 1BVYF 4Z1MA 1E20A 1F2VA 4G5OA 2VJYA 3RC3A 3UHJA 5LA6B 4D4JA 2BF4A 1E89A 1WCYA 3ODGA 3QKUA 1XDBA 3X1KA 3SVTA 3GLGB 3TUIC 3WSTA 3DUFA 5JSZA 4H7HA 5KTRA 1L8QA 1Z4PX 2XA1A 4K9NA 1XA3A 3N3AC 4MS4A 4I9UA 1Q1BA 1O57A 4YYEA 4TKUB 4X6XA 4W8OA 2EL7A 4CI0B 2BI4A 4CKYA 3PDWA 4MOWA 1KK1A 4L08A 4K6GA 2NU8A 4TTQA 4K9QA 5JNUA 4XAQA 5L3QB 2AFIA 1FEZA 4U7FA 1U02A 5HCNA 3TS1A 1W29A 3ABIA 1VSBA 1DEXA 3BHIA 4GECA 3USZA 2AK2A 5IVHA 4J1TA 3H11B 5HF8A 1R88A 1ZVJA 2AKYA 1GTG1 1FTNA 2X9QA 1B2LA 2GHQA 3DKPA 3IC5A 3U1BA 1QIDA 3IV9A 4QC2A 1EFRD 1N3LA 2IP4A 2QSUA 5FB3A 4N0DA 4Q4AB 4E4YA 5F23A 1XC7A 1ZHHA 3H1GA 4IS3A 4TTJA 2QMYA 4CM9A 4RTLA 4X3PA 1AKRA 5LP6F 3URMA 1AURA 1Q0ZA 5IBQA 4L4YA 3WL4A 1HT3A 3NM4A 2ODBA 4PY2A 4OLHA 4QXRA 3UV7A 3T7DA 2I4NA 1E1RD 3RC7A 2HV8A 5FNVA 1B8PA 2REBA 1H93A 3TUJC 4BVGA 3SIRA 1T36B 3IV6A 4RZHA 5LKAA 3V4RA 2UVPB 1QGAA 2OD9A 2Q2WA 1GAJA 2WOJA 3BJEA 3OC6A 4PCAA 5CLHA 2BR5A 4KWCA 1D1TA 2FYTA 2XYPA 4ZGWA 1PS8A 3ET5A 3FMGA 2O2XA 5E2BA 3B3AA 4ZV4A 4LOKA 2OQVA 4ATNA 3RADC 3DE2X 1NRWA 2J7PD 2W4QA 4YA6A 3ZU4A 2GQ0A 3AJDA 4WBXC 4BV9A 2JI4A 2XW6A 4BVEA 3VPFA 3UAZA 4WZBE 4AS1A 4MWEA 4LZNA 1MVOA 2CEKA 3FBWA 3GBVA 3U4CA 2G63A 2A9JA 4HS4A 5HDQA 1XD8A 4OK6A 1XCGB 2HCBA 4GI2A 4BYMA 4ZPJA 4ZU1X 3VUFA 1L9KA 1X8KA 1N8TA 2W58A 2YYAA 3P0EA 5FJJA 1SULA 1ISHA 4CKWA 1E5VA 2P77A 2RHMA 1W4CA 2P9YA 3IAFA 1MGPA 1AUPA 3KPYA 1Z6TA 1WW3A 2CFCA 5KYXB 1RM0A 1GPKA 1ZXBA 1E8NA 4KV9A 5TR9A 5JHHB 3RFUA 1A9TA 4JOQA 4BNJA 1W34A 2OO5A 2P3QA 2QP3A 2ZI9A 3HI4A 3PXBA 5EZ5A 3N8NA 4WZAE 4ZVLA 1JN0A 4MUEA 1OFUA 4HQ6A 4I9FA 5JXIA 2ASEA 2HQOA 3LI2A 1E2LA 4L3VA 2W4MA 3M5CA 5FXMA 4DDUA 3AF6A 1RIIA 2LIPA 4JXKA 2HSEA 1VJ1A 2B4QA 1Q0UA 5AM5A 1S8FA 2K87A 4CCWA 3QOYA 3JRNA 3GP8A 2D8MA 1QIHA 3KCQA 4ZXFA 2GETA 4L07A 2AJLI 2HXSA 5CHYA 1DV1A 4TKVB 4DJAA 1FTWA 4NCNA 1IY0A 1Z13A 2F4NA 2E4UA 3U17A 3V48A 1KZ6A 4V0QA 1X7ZA 2BPOA 3WKEA 3IPAA 1CEXA 1EJ0A 4BLPA 2W8ZA 3ML1A 3QF7A 2AJTA 1KEKA 5HK8A 3R76A 5KTKA 5F3DA 1ZJYA 3Q2IA 1RKBA 2VUHB 4RXUA 1S01A 2HTFA 2PLRA 3Q1LA 2VNKA 4OX9Y 2OBBA 1H2FA 5HJ5A 3V4ZA 4FXPA 1IEXA 2Q1TA 2FPPB 2P1RA 4RABA 5T3UA 4NDAA 3BYZA 3WG9A 4LXGA 3D3KA 2CSUA 2NTNA 4DT1A 1RLJA 2CXQA 4S1TA 2DKNA 2CY0A 4M8NE 2ZUDA 2N3ZA 3WR5A 2QUZA 4I1PA 1U0RA 4ZHQA 3AESB 4OQQA 4DM3A 3CUTA 4CHGA 3DR5A 5J4HA 5FI1B 4OG2A 3F6CA 3IKMB 5KSOA 4LBWA 3AK4A 3C8HA 3FNBA 4MS3A 1S2IA 4C4OA 2JFPA 2W2LD 3I8XA 3GZTB 3M6AA 4Z99A 3WO1A 1H3FA 4GX2A 3QBEA 2A5FA 2A6PA 1FXWF 2WA2A 4QFCA 4ENVA 2CL0X 3ORYA 2AKEA 3VR2D 4Q15A 3IIIA 3VO9A 4TLAA 4MEAA 1K5GA 4KACA 2VJMA 5DM70 3EUEA 4FOOA 3NP9A 3WAKA 1P4HA 1T6NA 1XTIA 7GPBA 2ODTX 4MPJA 4X8HA 4C7OA 3PJEA 2BFNA 2IPMA 1XVTA 1Y4DE 2A9OA 1I6LA 1E6LA 2WJWA 5G40A 1TL7C 3IHLA 4D3XA 1KQGA 1QH9A 4EB8A 4U7HA 3HCDA 4EGQA 1D8TA 2XE8A 3I52A 1ZL2A 4KOAA 4WE3A 1F06A 1RTTA 4OJMX 4DA6A 4G0NA 5JD5A 1N2IA 2N42A 2X7JA 3MA0A 4RORA 4QDZA 3FKQA 1P1HA 3I5UA 4BPBA 1C1XB 2YJZA 1X87A 3AILA 5LP6A 3RS2A 4EQ6B 1T8TA 3BH0A 2KLBA 1A9OA 2PX6A 3W2GA 5EESA 1DBPA 4MICA 3HV0A 2FWRA 3LBNA 2MINA 5KWIA 2VCEA 4QAQA 1NNI1 2P79A 4EJSB 1MABA 1XEXA 1XTUA 3HNRA 4OJKA 1BMDA 2FRVA 3HR4A 3AF2A 3CFYA 4D9JA 1L4LA 4OMUA 4F9TA 4ZI3A 5L4SA 1KAOA 5MFZA 1PQUA 5BR7A 4P2GA 2VL7A 3W6ZA 5EQDA 2EP7A 2ZJ1A 1DMRA 1LGYA 4BLSA 3AGPA 2P6MA 3QFCA 2ZRNA 5KBYA 5J1SB 1XMIA 4UTOA 4QUAA 4XLLA 3THWA 2IS6A 3ZE9A 3PRHA 3MM4A 4LW8A 4OYHA 3TWOA 4UEKA 1NW8A 3NHJA 4Q1BA 5LFAA 4DDVA 1JQJC 3N8GA 1RM3A 3VO2A 4AY2A 4R01A 1ODKA 2OO3A 1DINA 1QIEA 1Y9AA 1RHMA 2P40A 2RGYA 3CYFA 4IMRA 5JAPA 1R8JA 3ZY5A 2HLHA 4KBGA 3STYA 4DG5A 3TECE 5DBFA 2GCIA 3CCCA 1GYQA 4UTZA 2O5VA 1YRLA 5D1HA 2IU0A 3QK7A 5JARA 3BXEA 2F3TA 1WA5A 4KO4S 5ITWA 1FIUA 1GITA 1NX6A 2OQIA 1XLVA 3FCOA 3GAFA 3HKCB 4ZMSA 1KJZA 3FI0A 1EVYA 1N2CE 2W48A 3OTIA 3QKIA 1RYHA 4G0ZA 4K46A 3WO0A 4A91A 2B69A 3DBHA 4ZO8A 4F2WA 2FAXA 3KB8A 1GQYA 4J0IA 3TCNA 3NDJA 4K28A 4MMZB 4HSEA 5GZ6A 5I7WA 2O0JA 3EAGA 4DYHA 3DMFA 1NNLA 1SC3A 3IR5A 1RJ9A 4OB6A 3S68A 5FTWA 3B36A 2HQRA 2NZ8A 3H19A 4U00A 3RHSA 5KJFA 2HJSA 3MWDB 4B8YA 3PD1A 3BWVA 5E7JA 2WAAA 3BJIC 2YUIA 3CMCO 2PZLA 1G8AA 3ANTA 5B53A 3UC5A 2Q5HA 3DZIA 4KH0A 4D8YA 2Q6IA 1NNUA 2QVZX 4IKOA 3JQAA 3OF2A 2O6LA 3P0JA 2QR5A 4A7PA 1J2YA 2ZW9A 3EGWA 1NRJB 1PP4A 2DH5A 2OY0A 1SKYE 3QU2A 5DULA 1XUOA 2G70A 2O2GA 4TTAA 1RBMA 5EE5B 3D5TA 3VPCA 4DCGA 3QBJA 1QAMA 3DOIA 1K06A 4R2KA 4XJSA 4DDKA 3K9WA 4BKRA 4H7JA 4UNNA 4MP3A 4L9WA 2VJKA 4BYGA 1T26A 3QVJA 1KFKB 1UWKA 4KXWA 1BU8A 3JZMA 1H05A 1W2HA 1V11A 5IAKA 2EBUA 3AR5A 3KLPX 1CETA 4YCNA 5M5BA 2A30A 4IMIB 1R6XA 2XV1A 2CUKA 2VATA 3OH8A 3RT9A 2ZWVA 3OWXA 3R3UA 2C5SA 4BXOB 4YJ3A 4NOKA 3W8EA 2C99A 1QF7A 1CUZA 1IVYA 1AXRA 5GOTA 1X7DA 4QVGA 2I34A 1ICEA 1FXWA 4G41A 2PUTA 4B0PA 4YV2A 2CNOA 4Q9DA 2PU5A 3HDVA 4IO1A 4W8HA 3UUEA 3B3GA 2I29A 4N7RA 3BZBA 4G4SP 2G7ZA 4PZ0A 4DEYA 4F4DA 3FRHA 3S1SA 1Y6ZA 5ALTA 4UVIA 1Y1PA 3O8NA 3LYHA 5EYPA 1K4YA 2AX3A 4O1IA 5DX1A 1DFIA 3ED5A 3VVBA 4IQ8A 1N5IA 4FEYA 4CKCB 5LA6F 3WKBA 1MG0A 1W8IA 1GGHA 3OJEA 5D3MB 4WY5A 1AT1A 2ZR0A 4WA8A 4BU0A 3QIVA 3KSDO 2R44A 4ROTA 3KWJA 1HR0B 1OBHA 1XZAA 1BMTA 1HK7A 3MGKA 4ND7A 3RUIA 1X9GA 2BRUA 3LT1A 2ZXUA 3E1SA 2GAFA 4P7JA 2PJUA 5E9WA 4JVNA 3WS7A 1QPBA 1YB7A 3E8SA 1QZZA 2IU4A 5B7QA 3COYA 3JCZA 1S8OA 3VPGA 1RS0A 4JASB 4O59O 2DWPA 5AJHA 5IZCA 3F71A 3I3SR 1DI0A 2R8EA 4YP5A 5DGDA 1C3OB 2CL6X 3DUWA 2Y1LA 3NBAA 3BRWA 1GQ2A 1V47A 2L0XA 5ICGA 3EXAA 3T5MA 2FUNB 2V6BA 2VSQA 3R7SA 4YLGA 4ZT3A 2V1XA 5KWSA 1IU9A 1E66A 1QMGA 1ECFA 2FPIB 1N4DA 2X8BA 3AEQA 1SZPA 1D0IA 2ZRMA 3FUUA 3GAZA 5IAEA 4U8GA 4U3JB 5KAMA 4YH1A 1XV5A 3ZE1B 1JJBA 2BFPA 2BKEA 1BHQ1 2NUBA 3ITNA 4B4KA 4LXUA 3ET4A 1ODFA 3LDGA 4MAMA 4KQWA 2YQ5A 5EY5B 1F8YA 7ABPA 4LJ8A 1JUDA 5C34B 1G6KA 2JZOA 3LUBA 4MB2A 2WF7A 3OQVA 5K6AA 2E37A 1ZIDA 3CVJA 4KIUA 4MQUA 3ZBQA 1GRNA 2AC7A 2W8BA 4YGYA 4EYOA 1JMKC 2JJ1A 3IUYA 3E3AA 1DAFA 1JKXA 2G72A 1M2OB 3U61B 1FPMA 1BO6A 5EINA 4ARUA 1PF7E 4PZZA 2R6FA 2IDKA 1MVNA 2ZIZA 3DM5A 2NSHA 2AJCA 1WO8A 3PFFA 1EUCA 4KTVE 4RAQA 5A3RA 4Z0PA 5FUMA 1N4AA 2TSYB 3GT0A 4WADA 5FA6A 3RFXA 2J5QA 1ADBA 1DKNA 4MRSA 1QVVA 2PMFA 1J8MF 1K08A 1ISMA 1R5OA 3LUJA 1FSGA 2QVGA 2XMSA 3NFRA 3L6DA 4P58A 3G2JA 5FP0A 1S8NA 3PL1A 1GA6A 2HU2A 5AW2A 5EZ6B 4K1LA 3UK2A 1CIVA 4PFJA 2HC9A 4FXOA 5L3VA 2BV3A 4YRCA 1QVAA 3X3HA 3PQ7A 4MV7A 3MTBA 1KFBB 3L43A 3ZU6A 1CHNA 1Y3AA 2PRKA 1A7AA 1U7ZA 3S2YA 2C4MA 1XCBA 1QTQA 2QRVA 1WY5A 5D5QA 4NYJQ 3OA0A 5I9NA 1E9VA 3AC0A 3FPCA 2J5KA 4DIFA 3SSOA 4C08A 2CJXA 1IWPB 2I6UA 2MSNA 4R68A 4R1LA 5B2ZA 2AYXA 3FOEC 1EI9A 1MZVA 3GBSA 1RYZA 3MLEA 4O02B 1E4EB 3T3DA 3JATA 4CN8A 1OMOA 1QP7A 2OHIA 2ZYAA 4V3BA 2WEKA 3OKCA 4KDEA 1N8KA 4EZIA 5KU1A 3OICA 2BL4A 3H2GA 1V8FA 3KR1A 3LCUA 4QD3A 4W8GA 3SIXA 2WMYA 1KMMA 4FYJA 1ZDMA 4DLYA 3K9GA 4AMZA 4MA0A 4CIYA 2KWIA 3M49A 2PZAA 1FW6A 4M3NA 5AW1A 2I4OA 1G8GA 3I2FA 4IXWA 1N2XA 3MELA 5K9ZA 2YVAA 2KB0A 2PKYX 2ZJZA 3D64A 3Q8XB 2ZS7A 3S1AB 4FIZA 1DKRA 4M0DA 4CCAA 2ZK7A 2PZJA 3U4IA 4XQEA 5T57A 4P4SB 5IC5A 5DT9A 1H1TA 3FRIA 2XB4A 2YWRA 1PJZA 1UXGA 1QXSA 3OLVA 4KYTA 1SURA 5T6BA 5ABPA 5JNTA 3LQKA 2F4VB 4OFWA 1EE9A 2QRGA 1SCDA 3R5FA 3OUTA 1UQTA 4OKSA 3ZXXA 3K9BA 4ZN6A 1KTVA 1FB5A 5KPDA 1Q6ZA 3O8DA 1EX6A 4PFKA 2P0YA 2R2AA 3MZ0A 2Z3VA 3DMGA 2QAGC 2I33A 4EG4A 3RRNA 5ER9A 1YI0A 2X0JA 1H2YA 5KYYB 1O94D 3PHCA 4AF8A 3E1KA 1Z68A 1K6XA 2I66A 3HJTA 4LDAA 3IOEA 1PWZA 1YCFA 4WEQA 1Z4LA 2I8LA 3R7LA 5LM3A 1J0EA 2CDBA 3CUEF 4OHBA 2AEEA 4V0SA 1TEXA 2YVKA 2Z8YM 2XE7A 4R31A 5FOTA 4PLGA 2QS9A 1HQDA 4MV8A 1G2PA 4OXIA 1VPWA 4Y8VA 1YT5A 1V7PC 4IZHA 4PNHA 2IJGX 3U6BA 1PJSA 5SICE 1ZM2A 3G9XA 3G8BA 1ZVMA 1Y37A 4GRIA 1NP3A 3SMQA 4XE5A 3NIDB 4DXAA 4UU7A 5SZIA 2WYVA 1PJRA 1UC4B 1OJ7A 3DE1X 4AO8A 3ZEIA 4FFNA 5IAAA 3OZRA 1OUMA 4DFDA 1Y80A 1QYXA 1JHXA 2W2NA 1VXRA 4XPIB 4DEXA 2JHAA 4LQCA 3Q41A 4PQGA 3GA0A 1B0AA 2GEVA 4AMBA 1FE8A 4BP9A 1H8EA 4RTOA 4XQ0A 1ULHA 2XMGA 4JGGA 2VUTA 2JFHA 2J9GA 5EJ8A 3KYDB 2QLBA 3HO8A 1U9IA 3UM9A 1NVDA 1HNNA 3SGLA 2JHCA 3UT5B 1IBCA 2CF6A 5EKUA 4JNKA 3DXFA 2G8NA 3LY5A 2EC5A 2XMPA 4Q02A 3I1JA 4CL0A 4ETWA 3EMKA 1KO1A 4JI3B 5DHRA 2HCRA 2I2DA 2B37A 3OCZA 5THQA 4YIHA 1H9BA 2JRLA 3ASVA 1FMTA 2AQKA 5T8KC 4U2GA 1D8AA 4MJ7A 4PLHA 2I1QA 2QZSA 3RYTC 4BMXA 3FROA 4Z51A 5BT8A 4LJRA 1V8DA 4RUKA 3AKZA 3IEKA 2NP6A 2GHIA 1WUJS 1G3IA 4EO7A 4N3AA 3A4VA 4GMKA 2YV1A 1SVUA 3AVVA 4NU8X 1NE2A 3IT0A 3AL3A 5EMLA 3OM1A 3DP9A 3HADA 1N2ZA 5IYZB 1MH9A 1ESDA 1U4SA 3NEPX 5L7TA 3U48A 1SD2A 1WL8A 1Z6PA 3ICOA 2Q6LA 3NZEA 4ARAA 1MO5A 2JIPA 4PYIA 1RPJA 4I1UA 4TMZA 1J0DA 3GFVA 1D2GA 2D7DA 4JJZA 5KSWB 1NXOA 3MS4A 2ECKA 3QV1A 1QK4A 3WFJA 4YRFA 1VHJA 4JL6A 1Y7HA 3WIDA 3CLSC 2UUAB 2ZG6A 1DWUA 3AVXA 1X14A 4HC4A 4QSMA 1GGKA 1MW9X 1U3CA 2XNHA 1JSLA 5KX5A 2W6PA 4W99A 2ZULA 3TZHA 5CFNA 4HDMB 2FOLA 4ZC1A 1RWKA 1T6YA 3HMQA 4KSCA 5CLFA 3LBIA 2J3QA 5DRYA 1KDVA 2X9GA 5CT8A 2IYUA 1XN4A 2V7VA 3K09C 4BMYA 2PA0A 721PA 3BXGA 2PY6A 2E0IA 3JYHA 3TKAA 1ZSNA 1L7MA 3NUGA 1NV8A 1AKQA 2ZRIA 3VSEA 4ISCA 4XTRA 4I08A 3K6JA 1T3TA 2WD7A 5M2QA 1MB4A 4RCZA 2FRDC 3Q12A 3S3TA 2IF2A 4PC6A 1HEIA 2P3LA 1P9WA 2IYTA 5JAOA 3NV9A 3G8AA 4I6GA 3JVUA 1JYSA 2Y1OA 4P3XA 5CNJA 2A57A 2RK6A 4MGZR 4BNFA 1Q19A 4I8IA 4FUQA 2I71A 2ZJYA 2NO0A 2GN4A 3SDSA 4NFSA 1NNSA 4HR7A 1ORVA 2WFZA 4JYCA 3WYCA 1VLLA 2X8LA 4MCHA 1F8FA 1XD2B 2B2XA 2FOIA 3EC2A 4FINA 2GF9A 4KIWA 4TGLA 5REQB 3WYAA 2GI4A 5CDFE 1CC1S 3NQ41 1P9NA 2J32A 3NUZA 1U0EA 2O9JA 4MEBA 3NBMA 4RVNA 4XIGS 4BNNA 5JXJA 1EM6A 1PRYA 1RM4A 1R9MA 3RD5A 1U1DA 4MA4A 4ZCLA 2HLDD 1U9JA 1P5RA 2IKSA 2W4IA 3WV5A 2MYTA 3C24A 3C7TA 3LAWA 4V0KA 5IF9A 5D3ZA 4UPDA 3C3MA 2C7QA 3IAUA 1IWOA 1EFPA 4ND6A 4E15A 2JA1A 1WOYA 2PKEA 4K1XA 3ZZ0A 1M34B 1FDTA 1NXWA 3DDCA 4D9MA 3VPDA 2ODAA 1D6JA 1Z8DA 3TVTA 3RUHA 5LQJA 1JVBA 1KIFA 1TC2A 2RG1A 1N7JA 2C9BA 1D2EA 3DXZA 1DRVA 2ZE7A 5ESXA 3IAM1 1F4PA 2Q0XA 3GCWA 2VF2A 4WGFA 1VYUA 3KKNA 1YZUA 4CQLA 3VU9A 2UYCA 1MJHA 4UHBA 3SBXA 2Y0DA 4HNAA 4HPJB 3WJ1A 4I1RA 4ACBA 2AFVA 2XSZD 4CNQA 2XUHA 3OPNA 4RD1A 1LA2A 2NOAA 4RGBA 4J07A 3STUA 4B73A 3PZBA 3ANMA 4L4UA 1XMXA 3ZUGA 3SICE 3TOSA 3LM8A 5G1NA 3TVDA 5H83A 5AUQA 1PWYE 2V6IA 3V7FA 4DJTA 1MW8X 4OI2A 3D4PA 4KCGA 4GC9A 2WWIA 4XFDA 4V0RA 5J2TB 3H42B 1SOWA 2IC5A 3PLNA 4OAPA 2JBHA 5JNRA 3OECA 4M6WB 1T9DA 1FU4A 3AB3A 3WMWA 1WHTB 1U8XX 4FBMA 5JEDA 1AUXA 1XD9A 3WNQA 3IBSA 4C0LA 3PTAA 3ETDA 1ZGZA 1I3CA 3QKRA 3L8GA 2VPZA 5GGYA 3TJRA 3EYAA 3ZCRA 3IXQA 5D3QA 4KO2S 4UU1A 4M9SA 4DB2A 4NX2A 1IAVA 1BXRB 3EAFA 5B1HA 3ZQUA 3NHAA 5MN5A 2WV9A 3DEAA 2JA2A 3OEED 4BMSA 5EZYB 1CJMA 1VCMA 2VSXA 4YJFA 2FZWA 2Y4OA 5DYGA 3RJMA 5BSTA 1KI6B 3LBYA 2EF1A 3LKZA 4LCBA 4LPKA 2NV2B 3QPWA 4UNSA 5AKGA 1TM4E 3R5KA 4B6PA 1EWQA 1XNRB 2ZU0C 3L1JA 5JBQA 3AR4A 1VRWA 3CO0S 3DV2A 4HYTA 4Z4GA 1Q2UA 1ZIYA 2WUVA 3RSOA 1UKVY 1NSYA 1AMOA 1CHDA 1KYVA 4IIUA 2WFLB 3IAS6 3QEBZ 1PIWA 2QZJA 1XRSB 3FAZA 3NT2A 2O2IA 3AOGA 4HG2A 1KR5A 2YZNA 5FOUA 3HKEA 3O4RA 2BTOA 1MX9A 2X2EA 4A2QA 1U1FA 2DECA 3EXIA 2K2WA 1OCEA 1HMPA 4MUHA 4CGZA 2OD2A 5TLSA 4M89A 3TRDA 3ROMA 4M60A 1IN1A 2O8EB 1KO4A 5CA0F 3Q8KA 1DQNA 3PNLA 3OFSA 1E0SA 3QPDA 1ACMA 3IFSA 4N5DA 1IXSB 2EFYA 3L0PA 4IHAA 2YL2A 4RPLA 4AJJA 3LHKA 4QGAA 1BE0A 1HH4A 2HSWA 4AW9A 5FH9A 4WKCA 1J09A 1SKBA 2ECOA 3ME5A 5EE9A 4NYJR 1UJCA 3BA6A 4FHDA 1K7SN 3G2IA 3R7BA 3QWBA 5GV7A 5C8ZA 2Q5EA 2R1TB 3IT3A 1FFXB 4M36A 1PZFA 1RI1A 5CH3A 3SFTA 4AWBA 5LVAA 4QQNA 1YDHA 5BY2A 1J8DA 1SCNE 2AWNA 1TCUA 1QH8A 3MK31 4GF5A 4JLJA 4K9PA 1YRQA 4H3SA 1T9GR 3MQFA 1C0PA 5KYGA 3R3HA 3LSTA 1ELOA 4TRNA 4INOA 3T61A 1DO0A 2VJAA 3JQRA 4JCOA 4EVRA 1L7OA 5CA0B 1H5UA 4RX1A 1UJBA 4WI1A 1NP7A 2DWOA 3O0TA 4YR7A 2IPNA 2G71A 3BIWA 1ZUWA 5DK4A 4H35A 2I6TA 3NEAA 1WDKA 3EGDA 3MWDA 3L4BC 5DN6D 2JHPA 2NSYA 1NXSA 5EMJA 5LQSA 5JJKA 4I2VA 1U3VA 4QEKA 1PFYA 3N0VA 1TCCA 2AOWA 1Y33E 2V03A 4IMPA 4TMVA 1SKQA 4L28A 1ORDA 1GFWA 4RHEA 1Q1AA 2G1KA 5CBPB 5IDWA 2FZLA 4AJEA 1QQAA 1T9KA 2GFHA 4KIFA 4O2RA 2ZYIA 4FYIA 1GG5A 2IE8A 3I76A 4YCCA 4UBOA 1NBIA 5EIOA 5A9TA 1BWRA 1EU1A 5LXTB 4EPVA 3JD0A 1A69A 2XWPA 3GUYA 2YY5A 1W0JA 3JS5A 1EVLA 2D7JA 1S7CA 2RGNA 2Y9PB 1GPAA 3M6FA 4RZUA 1GZDA 4L51A 1KEPA 3Q98A 4AAYA 4AZ3A 3V00A 1RM5A 1Y9JA 2AN1A 3FXAA 2C83A 4EUNA 3B3JA 1JF8A 2B1JA 5FHRA 1IATA 3H0CA 2D5AA 3GUZA 3IULA 1Z2PX 2DSNA 4IDQA 2YHAA 3DOUA 3E7XA 5EXEA 4NV1A 1GCOA 3VYTB 2MSWA 4ASUA 5JPDA 5ALRA 2OZLB 4P32A 2W6QA 4WRRA 3B6EA 1G6OA 4YRDA 2ZJ5A 5C46F 3GRVA 1XQXA 5LNK1 1GRQA 4MSUA 1Z8FA 1NI4A 2R4TA 3UW1A 1Z6YA 3GDFA 3WLFA 1C9KA 1GPDG 3IMEA 4Q3AA 1KYTA 2H57A 4JD5A 4ILKA 4PRYA 3WLKX 1XAJA 3PNOA 1GG2A 5BV2P 3A9RA 1CQIB 5FBQB 4MHSA 5H9WA 1G5IA 2IDJA 1RDFA 2OBNA 2BCGY 3N05A 4FDLA 4KN8A 5E4TA 3ZJYA 2GCOA 3K70B 1EDBA 1CUFA 4FFMA 3HQ4O 2IX9A 4HNHA 5CP8A 2GASA 4RHXA 3E9NA 4F3NA 3EJ6A 2JLUA 3F4KA 2NUPB 2OV2A 2C8JA 1MX1A 1NBMA 1W5TA 1FRVA 3HFGA 3HLYA 3GAMA 4KLAA 5F73A 2A2ZA 4Q4CA 1T1RA 2P8JA 5TQJA 2WQ6A 3OU2A 2A5DA 5HFNA 2IHVA 3PXGA 1JGTA 1JQKA 2R4UA 3T3PB 4B6EA 4D96A 1TK9A 5CEFA 5SYNA 2V7PA 3GCXA 3UWSA 4ZQGA 5G3ZA 3O3NB 2FPLA 3AOEC 1SQ6A 1AU9A 1JLMA 4CR8A 2HMVA 4MUYA 3N07A 3MN1A 5J2UB 4YP1A 3ZGLA 2VAWA 4U3JA 5BYAA 2F9MA 4TZ0A 2QL9A 1MX3A 1N5LA 1E98A 1QO7A 1WB6A 1ZL0A 1RMTA 2EFGA 1EG2A 2PQ2A 3QJYA 3U9TA 3VDXA 2YZ7A 2HFJA 3K0BA 4XB1A 3M33A 5FORA 2WZCA 1VCOA 3S2EA 4WNAB 1JEDA 4GMGA 4TKLA 2L42A 3ONVA 4MKIA 1DRJA 2VQSA 2YN2A 4WBNF 1G3QA 3DEIA 2Z95A 3L0OA 2IHYA 5JAMA 4N5NA 1L7RA 3H5IA 4FZ5A 4DGSA 3QWAA 4TVKA 3GDHA 5G0UA 1W73A 1EMDA 2WJGA 1YB5A 2FPGB 2REOA 2WT9A 4O6VA 4QPDA 1ODJA 2GXQA 1YR3A 1VJRA 3KT3A 2Z9BA 2ZDGA 3KUXA 4MWZA 3QPAA 1GCUA 4HF7A 5CA0A 3SZUA 4DLRA 3U16A 4RTNA 1V5GA 2HA2A 3FHTA 4KUEA 2DYKA 1DEAA 3AVTA 1L8LA 1XXHE 2GT1A 3COWA 4PZCA 4Z9YA 3VR5D 1P33A 1QIFA 1W44A 1NQUA 3K1TA 1S89A 4NU6A 3DBVO 3N8HA 3SXUB 2CDCA 2BGNA 3SYNA 3ZPXA 4DMRA 3C6MA 4JLKA 2IQIA 3I0NA 3I2YX 3BORA 5CT4A 5BOVA 5IU6A 2O8CB 2CV2A 4N7MA 4NBTA 3JAWB 3NIFB 4KPGA 1RAFA 1IZ8A 3LZ6A 1TLLA 4CZ2A 3PCTA 2P2NA 3PDCA 4ND2A 1KYYA 3AJRA 1ISIA 1IY8A 3FAKA 4P9NA 3FZNA 3TIXB 4FE4A 1FP4A 1AS2A 4EPXA 3DJYA 5AOAA 3C2QA 2WHYA 1HLPA 4HAIA 4PX2A 4LRXA 1ARZA 3DE6X 4NYIR 3MT9A 4P3OA 4J7CA 3X1YA 1E6EA 2FDXA 2BGIA 1FLDA 1YCGA 2QX9A 2AMLA 3EBPA 3P96A 4H7DA 4NJEB 1CUCA 4Q93A 3RGWS 2B83A 5CYOA 4Y2XA 4C05A 1YCDA 2OXRA 4Y18A 4HADA 2I67A 4R4JA 3VSDA 4AJ2A 3OFND 4HTAA 3GCZA 5FUBA 1K7XB 4OOEA 5H3LA 3UXMA 1EJ6A 1SUFA 1EBUA 1UFOA 2PZ8A 3C3AA 1X6VA 3A26A 1QV7A 3S2ZA 3ESRA 5CRIA 1YIAA 3MTIA 4KIJA 4KQ2A 1XT6A 3A8TA 3HUTA 4FK8A 1FYDA 2FI1A 4UEQA 1XQ9A 3DAGA 2V98A 5BV7A 4X1OA 3SSAA 1GT6A 1WSWA 4CGYA 4KGVA 4TLDA 3U3DA 2XMRA 3O75A 4AO7A 1TQ6A 1ZOIA 3PEVA 4FQ5A 4LN1A 4E46A 2QMZA 4XA8A 1B0PA 1XKLA 4RJKA 4QXPA 3IA7A 1WMSA 1RLMA 2NTEA 3F98A 2QTVA 2N9UA 2RHTA 4GSLA 1G18A 3OQIB 5C0OE 4A4DA 4DMMA 3ZHCA 1JE1A 2IYVA 3PJRA 2JFBA 4P3KA 2FWBA 3THYA 3SAJA 2D0OB 4X00A 1KSGA 1ZINA 4KK4A 4M9RA 2O0KA 3IEVA 3L1IA 4C4YA 3ZG6A 1FZQA 4JC5A 3ZZNA 5F1KA 4D3YA 2ZT5A 1FFWA 4E03A 1LSOA 2C88A 4D8WA 1C7FA 1V45E 2H4HA 2QN6A 3CN7A 3O9VA 4LECA 2A14A 2UUCB 2X8AA 4RNDB 2Q2VA 1CIJA 3VR6D 2SKEA 2LPMA 5EPOA 4ZVKA 4B5KA 2H08A 2J3HA 2KHZA 4HDKA 2WDZA 4XVRA 2EBWA 3CR7A 5EC8A 1EK0A 2CD7A 1SUIA 2AG0A 4L16A 1HNXB 1KRHA 3TYXA 2QTGA 4UM8B 2X4DA 3JASA 1OVMA 1L5LA 3A6ZA 1AK1A 1VI6A 4HK4A 1RJDA 4EG5A 1EZ1A 2YWBA 2JPDA 1U1EA 4R9VA 1G5FA 2DH6A 2IVZA 2WZDA 5CVVA 3N8IA 3ZKWB 4CUJA 5K8IA 1E3MA 1TPZA 1WCIA 4RDXA 1QCDA 3N87A 5CXQA 1I2AA 4HMOA 3HP7A 1WB9A 3LLVA 4V39A 1QHFA 3CVWA 3UT5A 2IUUA 3PJFA 4RXTA 3OA2A 2ORED 1RZUA 3HH8A 4FVTA 3GJQA 1F3LA 5TNXA 2BBOA 5JJCA 2GO1A 1J5EB 4R9SA 2I0FA 5D3KA 2II6A 2IQ5A 2ZIXA 4A16A 1A1VA 4F8JA 1E1KA 1NZJA 4ZQCB 4HJRA 2D0PB 3IUNA 2A58A 2VHEA 3FYCA 1UXIA 4EUFA 4FWBA 4TLLB 4I4LA 4AVYA 5B3KA 3TF5A 1N2JA 1PEKE 3QE0A 2QQGA 5EP4A 4WBNA 1U2DA 1KZ1A 1JTFA 3HXQA 2C77A 2QDXA 4OHRA 4NU0A 1JIJA 1FY2A 3CUKA 3C15C 1JG7A 1T9CA 1BN7A 2VNIA 5FOQA 5AHKA 4EGAA 3PEEA 2YWGA 1DHTA 4J76A 2P9CA 4LHWA 2ZBEA 3G79A 2P9EA 4BO4A 4AJ9A 1I1NA 4D6PA 4HDAA 1TVCA 4ZYXA 1P77A 4P31A 2H7XA 3GEPA 3OQOA 4N3GA 3WB1A 2FMKA 3O03A 1N77A 1EWTA 2JIDA 3OM9A 2W2QA 1YQQA 3LUGA 3LPNA 5TQ2A 1UPFA 3AP2A 4JQCA 4PGGA 3EGXB 4UEOA 2RKWA 3NATA 4M0EA 3K9FC 5A0VA 1XGKA 1TIKA 3JQ9A 2QRNA 4HBGA 4OU4A 3VYSB 4C01A 5A1TA 2PPLA 2FFJA 1TZBA 2OVFA 4LZZA 3OHMA 4IRXA 4S35A 3O3OB 3NDRA 4GC5A 4PSAA 2OK8A 3NHRA 1DTWA 2BUBA 1PWHA 2J9ZB 2RI1A 3OTGA 2AX4A 3IV7A 1ZX1A 1OBCA 1Y81A 3BIJA 1IZ0A 4ZYLA 2Q46A 2BR3A 4AT1A 4GOMD 1Q17A 1AGRA 3IAS1 1SBCA 1ZCJA 4K9DA 1DOZA 4V38A 3ZNQA 1FA9A 3KAKA 4JLSA 3KAPA 4S0ZA 3WRVA 2HUNA 4R51A 5J59A 1E9DA 2BT4A 5GM2A 1L4BA 4AMUA 3VR4H 4C6TA 3SQOA 2WSMA 5JAIA 1C81A 2RFLA 3NB0A 1USWA 3H1PA 2JNWA 1FXSA 1ZU5A 4HYYA 1SK8A 3AB7A 2OWDA 1XQ6A 1HLDA 3KQVA 2HRRA 4QQKA 2JEZA 2QN1A 3NRBA 4XDZA 1FUYB 5GONB 1FTGA 1FFAA 2BFFB 3T9DA 1GQRA 4AJ1A 3N59A 1XHFA 4KE8A 2CGEA 3IBYA 1K5DA 3OZ7A 2HCJB 4QRHA 4HDNB 5LJLA 1V3VA 4GLBA 3K4PA 4M0KA 4U2KA 4YIKA 4F9GA 2NO9A 2P5UA 1BQEA 2NU6B 4NHEA 4PF1A 5BN5A 4QUKA 4IZOA 2R96A 3ECCA 3Q85A 1XFDA 4QTZA 4ZARA 1DT5A 1FFEA 2AOUB 4RHYA 4WPGA 2QUJA 5LXTF 4C76A 4FR2A 1M34A 2A5GA 3R5HA 4GWKA 5A7FA 4JAVC 2FWJA 1HYEA 4Q39A 5LL6P 3UPUA 3ZDFA 3CT6A 1IEWA 1NSTA 1RYBA 2RIRA 3HB9A 4K05A 4UAVA 3TM5A 4CT0A 1DUVG 3JZIA 1KVUA 3CLTC 1MMFB 4E1AA 3LL4A 4YWHA 1YRYE 4BUJA 4HH4A 5E1OA 5E6SB 3K9HA 2ZPAA 3I53A 1L5ZA 3K8ZA 1ETHA 4S1WA 5AI5A 2R751 4ZZ3A 5H7XA 2XYRA 4WN9A 3UQZA 2IOYA 1QWSA 4EL0A 5DMHA 2AMVA 2I3AA 3LCMA 2LKCA 5ALXA 1AQ6A 1KKUA 3D6JA 3NORA 1QHEA 2CNWA 3EYWA 3FTCA 2P8SA 2BGRA 4L95C 4ND5A 2CLDX 3AFOA 4P33A 3PKZA 3R7WB 4KR6A 2XVXA 1RRFA 4G1CA 1JHZA 4G01B 4O29A 2YFYA 4MGHA 3LUKA 5DOVA 4UPVA 5F1YA 2REQB 4D6XA 3L1UA 4D74A 2HK9A 1KY3A 1E60A 2PRSA 1YCHA 3WADA 3ADDA 2QQFA 2ZIAA 2IHUA 3VO8A 2HSJA 4MV0A 5AXBA 3INYA 4XDHA 2IEZA 4ZAGA 1YS2X 1KIAA 1ODSA 1E7QA 4QDUA 5JSUA 4CM9D 2H2GA 2KJQA 4M9ZA 1ZRMA 2O3SA 4AYWA 2ZYHA 1SHJA 1S7GA 2O1EA 3EWSA 3C7CB 1E9CA 4DRXA 2IOQA 3KQHA 2OE2A 4EDFA 3IL2A 3WSWA 4X94A 1JDTA 3UPDA 1OV4A 2QRUA 1N1GA 4L6AA 4RZIA 1XAHA 3D3JA 4DAOA 1VLZA 4DLWA 3GMIA 2GEBA 2WMDA 1IY2A 2PXHA 1PBTA 1ZMTA 3WRYA 3ESAA 1M72A 2GF0A 1UANA 2J3KA 1MAAA 2GPYA 3IKVA 3AFIA 2X0NA 2VZ9A 3OMXA 4F7WA 2YMQA 1AG9A 1E1NA 4RPHA 5KPJA 4L57A 4PZ9A 3PKIA 1L1FA 5I5GA 3V42A 2BI7A 3L4EA 3ZK8A 2VDPB 1SUBA 3WLNA 4WNIA 2Q5LA 3L93A 2V6FA 3I73A 4YALA 4ZVUA 3VYWA 3H65A 5KZMB 4BN4A 2EP5A 1EXNA 2OP1A 3D6TB 1PVDA 4TN5A 4M9QA 3NBQA 1UDCA 1MEEA 3H9UA 3ZWKA 5FAXA 1CNEA 2BMEA 4G1MB 2O7NA 1TA0A 3U81A 3MUNA 4RA9A 1SPBS 1CUDA 2VDWB 4UM9D 2R47A 2PKQP 1RABA 4KNWA 4NPHA 4CQMB 1NLMA 4IDHA 5K3FA 5B4VA 1XYGA 4F04A 5G0WA 3C6QA 3NHZA 3HCEA 1E0DA 4TWJA 1BE8A 1E7MA 1NOJA 3KK0A 4CLOB 4CMKA 5I45A 1F2TB 2C5FA 3CF6R 2AR0A 1VCNA 3GMDA 1L1EA 1RAEA 2VT2A 2HWXA 1N0WA 4REOA 3HVKA 1NVUQ 4Y2SA 4AM8A 2R1TA 5ERXA 1JJVA 4EHBA 1XJ0A 2JGFA 3ADCA 3ZJUA 2WRZA 4B3HA 3PFHA 5LZ4A 1KC3A 1SGWA 3D8BA 3QVXA 4MRMA 4OSOA 4EAAA 1F4VA 3AJ8A 3IE0A 4PGHA 3UKJA 3BTOA 3OLCX 5LQMA 4PHTA 1Y7LA 1I6MA 2I7VA 3SU8A 1YRWA 2JGEA 3P26A 2V6GA 3SSNA 5KC9A 4BB6A 5GIPE 2VT7A 1XHEA 4OYLA 1IVSA 5GJWC 4L74A 3UV6A 2VDNB 3MJSA 5TVGA 1MHPA 3KXPA 1TGYA 4WDQA 2VOJA 1FRFS 1DDOA 3F1LA 3F7MA 4YUYA 5BORA 1J9ZA 1Z2AA 4N48A 2VYCA 2D1YA 3CZRA 4C04A 5I47A 5A3JA 3FTQA 3V3TA 2C9OA 3D8SA 4BNVA 1R4MB 5THXA 5CJJA 3S70A 1VBFA 2H48A 4B74A 5JATA 1Q7BA 1TOAA 3EEOA 3HCAA 2Z6QA 3D5QA 4A3SA 2EX4A 1CRZA 4CMHA 3C6YA 3P9XA 2IIQA 1HKHA 2YW9A 3VC2A 3LXUX 3WZLA 1W96A 1LPAB 3DB2A 2Q7DA 2FW0A 2B20A 3WYBA 2O2ZA 3I9LA 4US0R 2PJRA 1PU2A 2YV5A 2Z30A 3D3WA 2GCGA 2XYVA 3TEFA 3TQIA 4DG8A 2ST1A 3QVGA 5EJ5A 1LPOA 1NRXA 1UMBA 3QHQA 4CKEA 1E8MA 1UMCB 2IHBA 3PPXA 3U44A 2EQBA 1IBLB 1KWGA 4OX9B 4RSMA