4NEED

Crystal structure of ap-2 alpha/simga2 complex bound to hiv-1 nef
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
142
structure length
142
Chain Sequence
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How HIV-1 Nef hijacks the AP-2 clathrin adaptor to downregulate CD4.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Viral protein/protein transport
molecule keywords AP-2 complex subunit sigma
total genus 48
structure length 142
sequence length 142
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2013-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01217 Clat_adaptor_s Clathrin adaptor complex small chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.60 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4neeD00
4UQIS 4UQIM 4P6ZS 4P6ZM 5MC7A 2JKTI 1W63M 1W63Q 3TJZC 2VGLM 2VGLS 2XA7S 4NEED 2JKRM 1NRJA 2JKTM 2JKRI 2FH5A 2HF6A 2XA7M
chains in the Genus database with same CATH superfamily
4OPQA 4L9EA 1Q2PA 3PAGA 3G2ZA 1WE4A 3LY3A 1OPXA 3G35A 1BZAA 1G68A 3UY6A 1I2SA 3G6OA 5DFXA 1PWGA 4WUJA 3BLMA 4XXRA 1XP4A 4OOLA 2A2LA 4NG2A 1VHMA 5FQJA 3MXRA 3MKEA 3LO7A 3G4PA 5KIZA 1L0EA 4EETB 1S67L 3ZHHA 3TE8A 1GCEA 2QYBA 4P6BA 3MQOA 3HLDA 1DP8A 4JGRA 5HWVA 1PZPA 3V39A 3OLOA 1TF1A 4WF0A 3ZG5A 4HJ4A 4OH0A 3LIEA 1BLCA 3OCNA 5DF8A 4BJPA 3ITAA 2VGLS 2JBFA 1HLUP 2OLUA 3UDXA 1EROA 4Y3IA 1YM1A 5TFQA 2W1TB 5CHMA 2JHEA 5FQMA 2J7VA 1L0FA 3B33A 3EGDC 3HLGA 3VMAA 2H0YA 3K3DA 4JKTA 1K38A 3ULFA 3L7HA 4JF5A 3PYPA 4KQRA 2JKTI 1IELA 2BASA 2H0TA 3E4QA 2V8CA 2W3DA 3UDFA 1YLTA 1KE3A 5HDCA 1OTBA 2ZMVA 2C6WB 2O9AA 3P09A 2XF3A 2M7UA 4EESA 4WMCA 1OT9A 4C3QA 1W5DA 4HBUA 1GHIA 4WZ4A 4M3KA 4ARZA 4HJ3A 1YKDA 3UE3A 3C7UA 2Z6DA 4OPYA 4WLAA 1ODVA 5J7EA 3G30A 4PKYG 3WS2A 3DTKA 3NOPC 1T18A 2CC1A 5A8BA 1NYMA 3CPTA 3QP2A 4DJ3A 3ZG7B 3V3SA 4G3VA 2ZL1B 2EFXA 3A0VA 1IYSA 3CLOA 3EQUA 3EWKA 4G3WA 3LIDA 4R3BA 2HPBA 4P85A 1RGZA 1SKOB 4QU3A 4OP8A 1KDWA 4BENA 2XROA 1K57A 1Y54A 5DTKA 5FQQA 5HWTA 3KX0X 4GKUA 2VLGA 2JE5A 3P7NA 5F6AA 3GSGA 4EEUA 1P0ZA 2A24B 1XJ6A 1XXMA 2QKPA 3LFVA 3IH8A 1N9LA 3NIAA 1Z6FA 1RCJA 1SKFA 4M4XA 1TS6A 2HP5A 1O07A 4UA7A 3SW1A 3T4JA 5EE8A 3FWLA 3V5MA 3UPPA 1XGIA 5GLAA 5HD5A 2G2WA 4OLDA 4Q8IA 4EUZA 1BT5A 3OCLA 4BMWA 4ESPA 4R4RA 4QJGA 1MY8A 4GDNA 3VOZA 3R7WB 5FDHA 4H6JB 4PKYA 3BY8A 2OSUA 1BLHA 1FSYA 1NWZA 2PBDP 2Y4AA 5HAIA 1E3UD 4EBPA 5EUAA 2OLVA 1M40A 1DJCA 1YPRA 1E3UA 3LGOA 3N8LA 5HAPA 2ZLYA 4XUZA 4WEKA 3KO6A 2IA2A 3MMHA 4II7A 3DWKA 5I94A 2DNSA 1S4RA 2JN7A 5F68A 1ES2A 2WAEA 3VOLA 3DTEA 5KSHA 5EVIA 2OV5A 1DP6A 4JXSA 1TD5A 1LI9A 4PMAA 3WS4A 2NUTC 2XRNA 4E3JA 5JYPA 4ZDXA 1NZUA 2OAQ1 2PU2A 1OTEA 3S7OA 1PFLA 5IHVA 4LPZA 5AQBA 2QWSA 2P7JA 3NC8A 1K0KA 2R9XA 4BWIA 4N1XA 1IYOA 4KZ4A 5F5YA 3T4TA 2PR5A 2Y2NA 1G6OA 4I38A 4KQQA 2FFYA 2XA7M 4PM6A 4KG5A 2P08A 3BW6A 2PBYA 1N4OA 4S2JA 1K25A 4JXVA 3PXPA 1DRMA 1NJ4A 5HDDA 1ERMA 2G7UA 3EEAA 3HCYA 3IX3A 2R9WA 5EECA 3UN7A 2PD7A 3C5AA 2V0UA 4R0QA 2QZ6A 3LR3A 1J9MA 4KZBA 4ZAMA 3VSKA 4OLGA 5M1AA 3OZHA 1VB6A 4O0PA 3LR4A 4X56A 2O0YA 1K57C 4JPMA 1G5UA 1KOUA 3CG5A 2XEPA 1CK3A 3UB9A 1LL9A 3OOVA 3F1PB 1AWIA 2HDQA 3TG9A 2GZAA 4GCZA 4X68A 1ZG4A 4Q0IA 3WRZA 4N9KA 5F82A 1MBLA 1VETA 4LRZE 1XA1A 3LEQA 2OWJA 2D02A 1ES3A 1W79A 4WYYA 1TS8A 3D72A 3FYZA 2VA0A 1NZOA 4HP9A 2X02A 1K54C 3BJNA 1IOUA 5F1GA 4WL9A 3DW0A 2HP6A 1YLZA 3P98A 4S2OA 1H8MA 4CLCA 4K91A 1H3QA 1ONHA 3FPWA 1NY0A 3GMWA 4QY6A 2Y59A 4GZBA 1MZUA 4EBNA 4IUHA 1FILA 1K6SA 4FH4A 3BQ8A 4NEED 3NOTC 2XA7S 3N4IA 4MBFA 1WYBA 3T1RA 3T4KA 4MLLA 3Q81A 3GDIA 4GHIA 2XD5A 5FAOA 3OPRA 2W3HA 5FEGA 4PPRA 4YOFA 1OMEA 4PM9A 5FQKA 3IH9A 3BFDA 1YLYA 3BFEA 4DE2A 2VK3A 4I39A 4Y0OA 2WGIA 5MC7A 2V20A 4Y2FA 4MN7A 3A3DA 5G18A 1MPLA 1STZA 3LYXA 2ZQDA 1WA9A 1T1AA 4LCMA 3C4PA 1H8ZA 3IWIA 3MSHA 4S2NA 2EX6A 5DTSA 3GECA 5TBMB 2P9VB 3BRMA 2WKHA 1K56A 1JVJA 2WAFA 3QP6A 4DE1A 3S7PA 3T1XA 2PDRA 4WMCD 2EXAA 4LV3A 2Q9MA 1DP9A 1KGEA 3B42A 4IEDA 5HWWA 3TOIA 1YLPA 2W27A 4GW9A 1XFQA 1KVLA 5FAQA 2P74A 4WBGA 1L0GA 2ZC6B 3BWLA 4KQDA 4IVIA 3HLBA 2WGWA 4FH2A 4D60A 3PBOA 2QJ5A 3MS6A 4HIAA 3HLFA 4EUVA 5AVFA 2NUPC 4X25A 3K2NA 3KSHA 4N92A 4P6ZS 1IEMA 1QMEA 3NJAA 4WZ5A 5I5LA 5FAPA 2PD8A 3A0RA 3H7WB 3F1NA 5J8XA 1ZC2A 2W1RA 2PT7A 1G28A 3UPNA 3GTCA 3U4LP 3T4SA 2WYXA 3B47A 3IXGA 1PNEA 5HARA 2J80A 3ICYA 5GLCA 1FIKA 4GS9B 1F2KA 3KSFA 3VP2A 3FV7A 2QJ7A 3Q7VB 5EVIC 2GJ3A 3W2ZA 3E0YA 5IT5A 2KDKA 2VGJA 3HUMA 2B5RA 1ERQA 3T50A 4O8GA 2KLIA 3WS5A 4ETZA 3JVVA 2O9BA 1OTIA 3IXHA 2JC7A 4R70A 3LEZA 3MXQA 1YT4A 3VP1A 3EQVA 4EV4A 4LENA 4FTXA 3PBNA 2XSSA 4B4ZA 5DKKA 2BLSA 1CEGA 3BQAA 4BL3A 2ZOIA 3QHYA 2EA9A 2Y2KA 4I3AA 3D3OA 1H0MA 2KOIA 5DF9A 4NXBA 3UE1A 3D4FA 3MBZA 3M2JA 2B95A 5CERA 1CQAA 2EX8A 3HJIA 1S66L 1NXYA 2Y91A 5HX9A 4DE0A 4Y15A 5GHXA 3H9WA 3V3RA 3RXWA 4HH3A 3S7NA 3HVFA 4P6ZM 1KVMA 5FQ9A 4RQ9A 3MQQA 4ZJ1A 2E8IA 2I9VA 2BTFP 2V0WA 2XH9A 4OQHA 2EWVA 1IYPA 3Q07A 3Q82A 3IX4A 1HTZA 1SDEA 1CF0A 1KGGA 1HD8A 2Y2MA 4E3MA 1MWRA 3P01A 2IWBA 2OOLA 4RA7A 3C38A 2HP9A 2H28A 1KE0A 3OBFA 1W63M 1XJ3A 5HL1A 4Y7PA 4R3AA 4ARZB 1GA9A 2ZQAA 5FEFA 1CI9A 2M7VA 4P0MA 4BBUA 2XLNA 1CI8A 4Y17A 1SKOA 3IHAA 4KG2A 2Y55A 2P04A 3FC7A 3WRTA 2QHKA 2GDNA 4UQIS 5HDSA 5HPIA 3N7WA 3K3CA 4RVAA 3T1QB 3UE0A 4NXGA 3MZFA 4Y0UA 2L0WA 1BLPA 2XGNA 1KE4A 5AQ9A 5TBMA 1FCMA 1ZHHB 5EPHA 2IWCA 3B3XA 3ZQ5A 3QNCA 2VV7A 1D06A 3T12B 5E2FA 2ZQ7A 2Y2JA 2KX6A 4EERA 4PM7A 2ZQ8A 5AQAA 1F98A 4QWOA 3TJZC 1M6KA 4OQIA 1MWTA 2W3GA 2PAVP 4GB7A 1YSQA 2HJ9C 1FCOA 3F1OB 4R3JA 5DF7A 4G3KA 1LL5A 3S7QA 2W0NA 4EQ1A 1PWCA 4JF4A 3SH9A 2JKFA 1FSWA 5HPFA 3BM6A 4HHDA 1Z09A 2ACGA 3V67A 4OPRA 3C30A 3E2KA 1BULA 2RL3A 3PR6A 2VKSA 4LGWA 2O9CA 2WKRA 4Q0JA 1D7EA 3WS0A 3R7WA 3TW8A 3PAEA 3ZNYA 5E2GA 3IWOA 2Y2OA 3VP4A 2DRWA 4HH2A 1T1BA 2XK1A 2ZM2A 1ALQA 1JWVA 1PI5A 5D3OA 5FATA 3I7JA 4R23A 5CXWA 4CLCD 3M6BA 1TDGA 5EM0A 4GN2A 4UQIM 1PIOA 2V8FA 5HD3A 3BEBA 4HOIA 3HUNA 4C6YA 5J3WA 4LRYC 3S4XA 5EVIB 4DF6A 1X0OA 1XJ2A 3IS2A 4IJGA 1EW0A 4ZBEA 4E3LA 4YNRA 2HF6A 2HV1A 4B93A 4X6TA 5CEBA 4R6LA 5CGSA 4YWZA 3E2LA 1LL8A 4HP4A 4HNBA 4D2OA 4HEFA 2OWHA 3KSGA 4KZ7A 3ZG0A 1YMXA 4E3OA 3ZG8B 3UB5P 1JTDA 1XPBA 3EEHA 4E3KA 3T1SA 1VEUB 4X55A 4EXOA 3F1PA 5CGXA 3OPPA 3KYQA 2C5WB 3ZDJA 2BG1A 3CJMA 4EBLA 4JF6A 1VEUA 3BFFA 3CZDA 1K6RA 4GS9A 1BTLA 1N9BA 1PI4A 2V2FF 3JPUA 5EOEA 3SH7A 4LV1A 4EU0A 4XT2B 4I5SA 3CWFA 3MJQA 2Y2QA 3VP0A 1K4EA 1FR6A 4L9GA 2XQZA 3LI9A 3O86A 1IKIA 2B18A 3KYEA 1TVFA 3GV9A 3TRCA 3MXSA 1K4FA 1P9RA 2YKFA 3L9KA 3HUOA 3VFHA 2ZC4B 2INWA 2HDSA 1ZTUA 5DVAA 4I3JA 4KZ9A 3BYDA 4MDZA 2HZ5A 2PRFA 4UEYA 3N8SA 5FI2A 3IF6A 2VJWA 4HJ6A 4DXBA 1LLBA 4E6XA 3WWXA 5BOHA 2LB9A 2ZC3B 4OQ0A 3QP4A 4IHQA 1SCWA 1C3BA 4LV2A 4OONA 3DTMA 1ESUA 2Y2PA 1DY6A 4JGOA 2J3TC 3FG8A 3GQZA 1FOFA 2WZZA 4FD8A 2G2UA 3ZFZA 5GHYA 3A3IA 3RFBA 5L09A 2J9PA 5M19A 3UB6A 5IU1A 1LSWA 1NYYA 2P9VA 3NHQA 1CEFA 3DBAA 4NKPA 5FA7A 4UHUA 4LFUA 2Q9NA 3BECA 3DTIA 1TDLA 2V1AA 4ETXA 3HJKA 2VGKA 2XFTA 3RJUA 2X71A 1PW1A 4MBHA 4KUKA 5LBRA 3G31A 2HJEA 5TJJA 2VV8A 2W3EA 4C75A 3LIAA 2DMWA 3GVBA 2ZQCA 2J8YA 3IT9A 5FI6A 4LV0A 1RP5A 3T4QA 5G4ZA 1WYCA 4AFIA 3FZCA 3H7WA 4OP5A 3M2KA 3M6HA 3CPTB 4RX2A 4KQOA 5TR7A 1SDNA 5CHJA 5A93A 4ZRRA 1S0WA 4CQHA 3RTYA 2IWDA 4KENB 2ZOHA 4CLCE 3IS2B 2ZC5B 3NBLA 4BD0A 4QY5A 5IS1A 1TS7A 4QB8A 5EOOA 5L10A 1YAXA 5DKLA 5HAQA 3ZYTA 5GL9A 5F69A 5GHZA 5KSCA 2EFUA 3UDIA 2QPNA 1UWPX 1BLSA 1YLJA 1BSGA 4Y0TA 2GX5A 5A90A 2WGVA 4F3LB 3ZGAB 4MN5A 3O87A 2A3UA 5FI7A 3ZCZA 3SS3A 5E43A 2WKIA 2VV6A 1U60A 4GNUA 2JCHA 2PU4A 2O99A 4XUXA 5DFYA 5FDSA 1KDSA 4GD8A 1N9OA 5DJUA 5EVLA 1CJFA 1MKMA 4KZAA 5M18A 2PYRA 1H8YA 4JLFA 2W1TA 3IHBA 4Z9QA 3VP3A 4K08A 2ZC7A 2J3TD 4PM5A 2FZ0A 4EWFA 1NRJA 4OOYA 3W4OA 3LR0A 5AJGA 4S2NC 1IFQA 3LIFA 3AGFA 3N8RA 3VOYA 3N6IA 4CLCC 1I5QA 4GD6A 4IVKA 1D1JA 5E2HA 4BBVA 3EOIA 1IYQA 4Y13A 4E04A 2R78A 1PZOA 1JTGA 2K7SA 2WZXA 3AGDA 3NDGA 3HBRA 4DJ2A 1Q2QA 4UA6A 1ES4A 4QD4A 3Q7ZA 1NLZA 1V9ZA 4F3LA 4R4SA 4JGPA 2PYPA 2ZL1A 3Q1FA 3BFGA 4EQIA 1GSXA 5FASA 3S22A 3NOUC 2JKTM 3F1NB 3TSGA 4X69A 2Z2LB 3MR0A 4GDBA 4KZ8A 4R38A 2WUQA 3SZTA 3VV4A 2E8JA 4JXWA 2UWXA 1YSPA 2XDMA 5AQ7A 2WGWB 1S4SA 3IX8A 2Q0OA 2ZD8A 4BLMA 1MC0A 3SS5A 1OJGA 2V1BA 5A92A 1MXOA 2EX9A 1LHYA 1PRQA 4L9FA 4R1GA 4DN0A 2J9OA 4BQMA 3G32A 2VGLM 4IBXA 1NLYA 3F1OA 1XFNA 3LIBA 5J4EA 5C5KA 3GR2A 2DCFA 1FQGA 3NY4A 2Y79A 3KSIA 3LICA 2PR6A 3PBSA 4E3IA 1SZVA 1L0DA 4N9LA 3CI6A 2VEAA 3ZNTA 3IWQA 1K54A 3ITBA 3ZG9B 4QPRA 4DMZA 3FKWA 3SS4A 4RYEA 2J3WA 3LCEA 4L0LA 3H82B 5CX7A 3CITA 3FKVA 3SH8A 3IXDA 1GA0A 2V9AA 1RGYA 3G34A 1EI5A 1G6AA 3O3VA 2K2NA 5A91A 3UNWA 2VZWA 2WADA 4JBFA 3VE3A 3V50A 2JKGA 4CPKA 1K55C 3C4OA 1YLWA 4DRTA 4GHIB 1E25A 1UGUA 3MQ0A 2Z2MB 4UAAA 3WS1A 3LR5A 4DDSA 2XR0A 2LB5A 1W63Q 1TEMA 3IQAA 1K55A 3A3EA 1AXBA 1BYWA 4WM9A 1EWZA 1TS0A 1VETB 1T1CA 1I2WA 1S6RA 2Y2HA 4DKIA 5K5BA 4FSFA 4X1LA 5CTNA 1ES5A 3HLWA 4OQGA 3S1YA 3ISGA 1S1ZA 2I72A 1PYYA 5HW3A 2JKRM 1J3WA 1F9IA 4NXFA 3O5YA 4ZJ3A 3MZDA 3NDEA 5CHUA 2FH5A 3MZEA 1JNUA 4H8RA 4PAUA 2VX8A 3R4KA 3VSLA 4LRXC 2YKHA 3G2YA 1GHMA 2UV0E 3UB8A 4MBKA 3UMDA 3CUEC 1MWUA 3ZVTA 4KUOA 2D01A 1F5MA 2EWWA 4B9OA 3QP5A 4K0XA 1VQQA 1LT0A 3CMZA 3C8CA 5CTMA 5HZHA 2M1CA 4LLOB 4BD1A 3BFCA 3UO9A 1XGJA 2HDRA 3UE6A 5EVID 3T4OA 4ME4A 3DAVA 3BLSA 3NECA 2ZM8A 4WELA 5KMWA 3PHYA 3UMEA 1OTDA 1K56D 2Y2LA 1XA7A 5GLBA 4MNRA 4FUWA 1JWZA 2QMIA 4HI4A 1SHVA 3PBRA 2RCXA 3PBQA 3IF6C 5E2EA 4S2MA 2WK0A 2XFSA 4IUKA 1FR1A 1XX2A 4MMNA 1YQSA 4I3IA 4HBTA 4DXCA 3BY9A 4FOFA 4U0TA 3C7VA 3ZVWA 4F94A 2B02A 3HLEA 1ONGA 1GSVA 1H5XA 3E98A 5U47A 1P9WA 3D9YA 3LI8A 4GJ4A 2Y8HA 4MCWA 5CGWA 3E4PA 5HSQA 4A5RA 1W7FA 1W8YA 1MWSA 4NETA 2L4RA 4JXGA 2CMNA 4HESA 2PHYA 4GLQA 1V9YA 1VM1A 3PBTA 1O7EA 1ZG6A 5G4YA 4KZ6A 2A24A 4OVDA 4QHCA 1QMFA 4S2IA 4PHTA 2XD1A 4EEPA 3JYIA 1A0KA 3W4QA 3GRJA 4E6WA 1XKZA 2ZMFA 1GHPA 5EFWA 1E4DA 3IBJA 5FL3A 4RX3A 5CECA 5KZHA 1JWPA 5AVEA 4DDYA 3RXXA 5F1FA 3DWZA 1LSVA 1ESIA 4OPZA 4Y5FA 4KZ3A 4KG6A 4O01A 1HZOA 4N1HA 3A0SA 2V1ZA 4NK3A 2MJ6A 3A3FA 3QNBA 4WEJA 3HLCA 4XT2A 3VE4A 3QP8A 3C2WA 5L2FA 2H10A 4MN6A 4KZ5A 4GOGA 1ZKJA 5GLDA 4WZ5C 2HGVA 2FFFB 3JVUA 4LCLA 5L07A 2GNXA 2EXBA 3QP1A 1L2SA 3VFFA 1FCNA 3A3JA 4HQAA 4ZTKA 4S2PA 2AVXA 2Y2GA 3OPHA 4CJNA 4NXEA 2K31A 3UPOA 4OKPA 5HFOA 4B4XA 2ZJ9A 4WN5A 3IXBA 3RH8B 4X1MA 1OJ5A 3IF5A 1IKGA 3KYZA 3MFDA 1LI0A 5DTTA 1BUEA 5EV0A 2WKQA 2H5SA 5EVEA 1KGFA 1LSXA 3O88A 5L8MA 1T19A 2ZMAA 5JYOA 1L3LA 2Z6CA 3MF0A 3Q7VA 3IF6B 1PWDA 3NULA 3AGEA 4JGQA 1S1YA 2ZBBA 1PW8A 3PTEA 5CRFA 5CEDA 4X53A 1Y28A 3CUEA 3HREA 3LUQA 3IBRA 1MKIA 2ZQ9A 3EGXC 4HY8A 5FSRA 1OTAA 2W3FA 3W4PA 3T4LA 3CAXA 4YFMA 2OAP1 1UWNX 4ZJ2A 5DJTA 4IBRA 3LY4A 4E3NA 5HL6A 2Y2IA 2WKPA 1P97A 1W8QA 1YMSA 1XJ4A 4U3TA 4Q0HA 1Y4OA 4BL2A 3FPVA 4FCFA 1DJAA 2JKRI 4UA9A 4Z1WA 4OOMA 1OT6A 2WKEA 4PM8A 4BBTA 3OC2A 1HVBA 1NRFA 2ZM0A 5EM1A 4ID4A 1N9NA 3W8KA 2X01A 4MEZA 4CLCB 4S2LA 3MKFA 3MFXA 3NCKA 4YINA 2L1MA 2A49A 2EX2A 4DE3A 4EW7A 3OPLA 3UB7A 3E4OA 3U2AA 4U0XA 4O7DA 1GSWA 3HL9A 5F83A 4K0WA 3H82A 4B88A 2HDUA 3CHWP 5TGFA 4S2KA 4H6JA 4P87A 1ACFA 3SOIA 5FQIA 1DJBA 3NI9A
chains in the Genus database with same CATH topology
4L0LA 3H82B 4L9EA 5CX7A 3CITA 4EXOA 3F1PA 2W3HA 2V9AA 4YOFA 3KYQA 1OPXA 2K2NA 4I39A 2VZWA 3VE3A 5MC7A 4GS9A 4Y2FA 3G6OA 5DFXA 4MN7A 4GHIB 4WUJA 1UGUA 4OOLA 3MQ0A 2A2LA 1STZA 1VHMA 3LYXA 1WA9A 4EU0A 4XT2B 1T1AA 4I5SA 3CWFA 3MJQA 3LR5A 5KIZA 4L9GA 4EETB 1S67L 2LB5A 3LI9A 3GECA 5TBMB 1W63Q 3TE8A 2QYBA 2B18A 3MQOA 3S7PA 1DP8A 2PDRA 4JGRA 3TRCA 1BYWA 5HWVA 1P9RA 2YKFA 1TS0A 3OLOA 1DP9A 1T1CA 1TF1A 5K5BA 4WF0A 4FSFA 4HJ4A 2INWA 3B42A 5HWWA 1ZTUA 3LIEA 4I3JA 3OCNA 1S1ZA 2W27A 4GW9A 4BJPA 2VGLS 1XFQA 4MDZA 2JKRM 1F9IA 4NXFA 3O5YA 3BWLA 4UEYA 4Y3IA 4KQDA 2FH5A 2W1TB 1JNUA 4PAUA 2VJWA 2JHEA 2VX8A 3R4KA 4HJ6A 4LRXC 2YKHA 3PBOA 2QJ5A 3UB8A 4HIAA 4EUVA 3B33A 5AVFA 2NUPC 3UMDA 3EGDC 2LB9A 3CUEC 3K3DA 3K2NA 4IHQA 3KSHA 4P6ZS 3NJAA 3ULFA 5I5LA 2PD8A 4KUOA 3A0RA 4JGOA 2D01A 3H7WB 2J3TC 1F5MA 2EWWA 3F1NA 3PYPA 3FG8A 4B9OA 2W1RA 2PT7A 2JKTI 1LT0A 2BASA 1G28A 3E4QA 3RFBA 3C8CA 3UB6A 5HZHA 2W3DA 3T4SA 2M1CA 3B47A 4LLOB 5IU1A 1LSWA 2J80A 3ICYA 5HDCA 4GS9B 1OTBA 3KSFA 2QJ7A 2ZMVA 3NHQA 3DBAA 4NKPA 3UE6A 2O9AA 3T4OA 2GJ3A 4ME4A 3W2ZA 2M7UA 4EESA 1OT9A 3E0YA 4ARZA 4WELA 5IT5A 2KDKA 3PHYA 4HJ3A 3UMEA 1OTDA 1YKDA 3UE3A 3T50A 2Z6DA 4O8GA 2KLIA 4WLAA 2V1AA 4ETZA 3JVVA 1ODVA 5J7EA 2O9BA 1OTIA 4PKYG 4ETXA 3NOPC 3HJKA 1T18A 4HI4A 3PBRA 5A8BA 4DJ3A 3PBQA 4R70A 4KUKA 5LBRA 4G3VA 3MXQA 2HJEA 5TJJA 2VV8A 2W3EA 3A0VA 3LIAA 2DMWA 4IUKA 3EQVA 4MMNA 3PBNA 2XSSA 3CLOA 3EQUA 4I3IA 3EWKA 4G3WA 3BY9A 4FOFA 5DKKA 3BQAA 3LIDA 2ZOIA 2B02A 2EA9A 3T4QA 5G4ZA 4I3AA 4AFIA 1GSVA 3H7WA 3D3OA 3E98A 1P9WA 2KOIA 4KQOA 5DF9A 4NXBA 2XROA 4ZRRA 3LI8A 4GJ4A 4CQHA 3RTYA 2Y8HA 4MCWA 2ZOHA 3E4PA 3HJIA 4CLCE 1S66L 3IS2B 3KX0X 5HWTA 5HSQA 2VLGA 3P7NA 2L4RA 3H9WA 5F6AA 4EEUA 2CMNA 1P0ZA 2A24B 4HH3A 2PHYA 3S7NA 4GLQA 1XJ6A 5IS1A 1V9YA 3PBTA 2QKPA 4P6ZM 3LFVA 4RQ9A 1N9LA 3MQQA 5G4YA 2A24A 2I9VA 2V0WA 4M4XA 1TS6A 3SW1A 1TS7A 2EWVA 3T4JA 1YAXA 5DKLA 4PHTA 3ZYTA 5F69A 4EEPA 5HD5A 2ZMFA 5EFWA 1UWPX 3IBJA 5FL3A 5AVEA 3P01A 2GX5A 3OCLA 2OOLA 4BMWA 4F3LB 4MN5A 3R7WB 3C38A 4H6JB 4PKYA 1LSVA 3BY8A 2H28A 3OBFA 4Y5FA 1W63M 1XJ3A 4R3AA 1NWZA 4O01A 4ARZB 2M7VA 3A0SA 4BBUA 2VV6A 2MJ6A 4WEJA 2O99A 4WEKA 4XT2A 3VE4A 3C2WA 3KO6A 2IA2A 3MMHA 4MN6A 5DFYA 4II7A 1S4RA 2JN7A 2HGVA 3JVUA 2P04A 3FC7A 5F68A 2GNXA 1N9OA 5DJUA 3VOLA 2QHKA 5KSHA 4HQAA 1DP6A 1MKMA 4UQIS 2PYRA 5HDSA 5HPIA 3K3CA 1TD5A 2NUTC 2XRNA 4NXGA 2L0WA 2OAQ1 2W1TA 1OTEA 3S7OA 4K08A 5TBMA 1ZHHB 4LPZA 3ZQ5A 2J3TD 4NXEA 2K31A 2QWSA 2FZ0A 1NRJA 2VV7A 1D06A 2P7JA 4WN5A 3RH8B 3LR0A 5AJGA 4BWIA 1OJ5A 1IFQA 3LIFA 5F5YA 3KYZA 3T4TA 2PR5A 1G6OA 4I38A 2WKQA 2KX6A 2XA7M 4EERA 2P08A 4CLCC 3BW6A 1LSXA 4BBVA 3EOIA 1F98A 3TJZC 5L8MA 3PXPA 1T19A 1DRMA 5HDDA 2W3GA 4E04A 1YSQA 2HJ9C 2R78A 2K7SA 2Z6CA 3F1OB 2G7UA 3EEAA 4G3KA 3HCYA 3MF0A 3S7QA 2W0NA 4EQ1A 4DJ2A 4JGQA 2PD7A 1NLZA 1S1YA 1V9ZA 2ZBBA 4F3LA 5HPFA 2V0UA 4HHDA 3LR3A 4JGPA 2PYPA 1Y28A 3CUEA 4O0PA 1VB6A 1GSXA 3LUQA 3LR4A 3IBRA 2O0YA 3V67A 3C30A 3NOUC 2JKTM 3F1NB 3EGXC 1KOUA 4HY8A 1OTAA 3PR6A 2VKSA 2W3FA 2O9CA 2WKRA 3UB9A 4Q0JA 1D7EA 3T4LA 3R7WA 3MR0A 3OOVA 3CAXA 3TW8A 3F1PB 2OAP1 1UWNX 4R38A 2GZAA 4GCZA 5DJTA 3VV4A 4HH2A 1T1BA 5HL6A 2WKPA 4Q0IA 1YSPA 1P97A 4LRZE 1S4SA 2OWJA 2D02A 1XJ4A 4Q0HA 4CLCD 1TS8A 3D72A 3FPVA 2VA0A 1MC0A 2JKRI 4HP9A 4UQIM 3BJNA 1OJGA 1IOUA 2V1BA 5HD3A 4Z1WA 4HOIA 4OOMA 1OT6A 5J3WA 4WL9A 4LRYC 4L9FA 4DN0A 1H8MA 4BBTA 4CLCA 2VGLM 3OC2A 1X0OA 1XJ2A 1N9NA 3IS2A 1NLYA 4IJGA 1EW0A 3F1OA 1H3QA 1XFNA 3LIBA 3FPWA 5J4EA 5C5KA 4YNRA 2HF6A 2HV1A 4CLCB 3MFXA 4B93A 2L1MA 4R6LA 1MZUA 4IUHA 4YWZA 4EW7A 1LL8A 2Y79A 3KSIA 3E4OA 4HNBA 4HP4A 3UB7A 3LICA 2PR6A 3U2AA 2OWHA 3PBSA 4NEED 3KSGA 3BQ8A 3NOTC 2XA7S 3CI6A 1GSWA 2VEAA 3H82A 4QPRA 4DMZA 3T4KA 4H6JA 4GHIA 3GDIA 3EEHA 2J3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UQI S;  4UQI M;  4P6Z S;  4P6Z M;  5MC7 A;  2JKT I;  1W63 M;  1W63 Q;  3TJZ C;  2VGL M;  2VGL S;  2XA7 S;  4NEE D;  2JKR M;  1NRJ A;  2JKT M;  2JKR I;  2FH5 A;  2HF6 A;  2XA7 M; 
#chains in the Genus database with same CATH topology
 4OPQ A;  4L9E A;  1Q2P A;  3PAG A;  3G2Z A;  1WE4 A;  3LY3 A;  1OPX A;  3G35 A;  1BZA A;  1G68 A;  3UY6 A;  1I2S A;  3G6O A;  5DFX A;  1PWG A;  4WUJ A;  3BLM A;  4XXR A;  1XP4 A;  4OOL A;  2A2L A;  4NG2 A;  1VHM A;  5FQJ A;  3MXR A;  3MKE A;  3LO7 A;  3G4P A;  5KIZ A;  1L0E A;  4EET B;  1S67 L;  3ZHH A;  3TE8 A;  1GCE A;  2QYB A;  4P6B A;  3MQO A;  3HLD A;  1DP8 A;  4JGR A;  5HWV A;  1PZP A;  3V39 A;  3OLO A;  1TF1 A;  4WF0 A;  3ZG5 A;  4HJ4 A;  4OH0 A;  3LIE A;  1BLC A;  3OCN A;  5DF8 A;  4BJP A;  3ITA A;  2VGL S;  2JBF A;  1HLU P;  2OLU A;  3UDX A;  1ERO A;  4Y3I A;  1YM1 A;  5TFQ A;  2W1T B;  5CHM A;  2JHE A;  5FQM A;  2J7V A;  1L0F A;  3B33 A;  3EGD C;  3HLG A;  3VMA A;  2H0Y A;  3K3D A;  4JKT A;  1K38 A;  3ULF A;  3L7H A;  4JF5 A;  3PYP A;  4KQR A;  2JKT I;  1IEL A;  2BAS A;  2H0T A;  3E4Q A;  2V8C A;  2W3D A;  3UDF A;  1YLT A;  1KE3 A;  5HDC A;  1OTB A;  2ZMV A;  2C6W B;  2O9A A;  3P09 A;  2XF3 A;  2M7U A;  4EES A;  4WMC A;  1OT9 A;  4C3Q A;  1W5D A;  4HBU A;  1GHI A;  4WZ4 A;  4M3K A;  4ARZ A;  4HJ3 A;  1YKD A;  3UE3 A;  3C7U A;  2Z6D A;  4OPY A;  4WLA A;  1ODV A;  5J7E A;  3G30 A;  4PKY G;  3WS2 A;  3DTK A;  3NOP C;  1T18 A;  2CC1 A;  5A8B A;  1NYM A;  3CPT A;  3QP2 A;  4DJ3 A;  3ZG7 B;  3V3S A;  4G3V A;  2ZL1 B;  2EFX A;  3A0V A;  1IYS A;  3CLO A;  3EQU A;  3EWK A;  4G3W A;  3LID A;  4R3B A;  2HPB A;  4P85 A;  1RGZ A;  1SKO B;  4QU3 A;  4OP8 A;  1KDW A;  4BEN A;  2XRO A;  1K57 A;  1Y54 A;  5DTK A;  5FQQ A;  5HWT A;  3KX0 X;  4GKU A;  2VLG A;  2JE5 A;  3P7N A;  5F6A A;  3GSG A;  4EEU A;  1P0Z A;  2A24 B;  1XJ6 A;  1XXM A;  2QKP A;  3LFV A;  3IH8 A;  1N9L A;  3NIA A;  1Z6F A;  1RCJ A;  1SKF A;  4M4X A;  1TS6 A;  2HP5 A;  1O07 A;  4UA7 A;  3SW1 A;  3T4J A;  5EE8 A;  3FWL A;  3V5M A;  3UPP A;  1XGI A;  5GLA A;  5HD5 A;  2G2W A;  4OLD A;  4Q8I A;  4EUZ A;  1BT5 A;  3OCL A;  4BMW A;  4ESP A;  4R4R A;  4QJG A;  1MY8 A;  4GDN A;  3VOZ A;  3R7W B;  5FDH A;  4H6J B;  4PKY A;  3BY8 A;  2OSU A;  1BLH A;  1FSY A;  1NWZ A;  2PBD P;  2Y4A A;  5HAI A;  1E3U D;  4EBP A;  5EUA A;  2OLV A;  1M40 A;  1DJC A;  1YPR A;  1E3U A;  3LGO A;  3N8L A;  5HAP A;  2ZLY A;  4XUZ A;  4WEK A;  3KO6 A;  2IA2 A;  3MMH A;  4II7 A;  3DWK A;  5I94 A;  2DNS A;  1S4R A;  2JN7 A;  5F68 A;  1ES2 A;  2WAE A;  3VOL A;  3DTE A;  5KSH A;  5EVI A;  2OV5 A;  1DP6 A;  4JXS A;  1TD5 A;  1LI9 A;  4PMA A;  3WS4 A;  2NUT C;  2XRN A;  4E3J A;  5JYP A;  4ZDX A;  1NZU A;  2OAQ 1;  2PU2 A;  1OTE A;  3S7O A;  1PFL A;  5IHV A;  4LPZ A;  5AQB A;  2QWS A;  2P7J A;  3NC8 A;  1K0K A;  2R9X A;  4BWI A;  4N1X A;  1IYO A;  4KZ4 A;  5F5Y A;  3T4T A;  2PR5 A;  2Y2N A;  1G6O A;  4I38 A;  4KQQ A;  2FFY A;  2XA7 M;  4PM6 A;  4KG5 A;  2P08 A;  3BW6 A;  2PBY A;  1N4O A;  4S2J A;  1K25 A;  4JXV A;  3PXP A;  1DRM A;  1NJ4 A;  5HDD A;  1ERM A;  2G7U A;  3EEA A;  3HCY A;  3IX3 A;  2R9W A;  5EEC A;  3UN7 A;  2PD7 A;  3C5A A;  2V0U A;  4R0Q A;  2QZ6 A;  3LR3 A;  1J9M A;  4KZB A;  4ZAM A;  3VSK A;  4OLG A;  5M1A A;  3OZH A;  1VB6 A;  4O0P A;  3LR4 A;  4X56 A;  2O0Y A;  1K57 C;  4JPM A;  1G5U A;  1KOU A;  3CG5 A;  2XEP A;  1CK3 A;  3UB9 A;  1LL9 A;  3OOV A;  3F1P B;  1AWI A;  2HDQ A;  3TG9 A;  2GZA A;  4GCZ A;  4X68 A;  1ZG4 A;  4Q0I A;  3WRZ A;  4N9K A;  5F82 A;  1MBL A;  1VET A;  4LRZ E;  1XA1 A;  3LEQ A;  2OWJ A;  2D02 A;  1ES3 A;  1W79 A;  4WYY A;  1TS8 A;  3D72 A;  3FYZ A;  2VA0 A;  1NZO A;  4HP9 A;  2X02 A;  1K54 C;  3BJN A;  1IOU A;  5F1G A;  4WL9 A;  3DW0 A;  2HP6 A;  1YLZ A;  3P98 A;  4S2O A;  1H8M A;  4CLC A;  4K91 A;  1H3Q A;  1ONH A;  3FPW A;  1NY0 A;  3GMW A;  4QY6 A;  2Y59 A;  4GZB A;  1MZU A;  4EBN A;  4IUH A;  1FIL A;  1K6S A;  4FH4 A;  3BQ8 A;  4NEE D;  3NOT C;  2XA7 S;  3N4I A;  4MBF A;  1WYB A;  3T1R A;  3T4K A;  4MLL A;  3Q81 A;  3GDI A;  4GHI A;  2XD5 A;  5FAO A;  3OPR A;  2W3H A;  5FEG A;  4PPR A;  4YOF A;  1OME A;  4PM9 A;  5FQK A;  3IH9 A;  3BFD A;  1YLY A;  3BFE A;  4DE2 A;  2VK3 A;  4I39 A;  4Y0O A;  2WGI A;  5MC7 A;  2V20 A;  4Y2F A;  4MN7 A;  3A3D A;  5G18 A;  1MPL A;  1STZ A;  3LYX A;  2ZQD A;  1WA9 A;  1T1A A;  4LCM A;  3C4P A;  1H8Z A;  3IWI A;  3MSH A;  4S2N A;  2EX6 A;  5DTS A;  3GEC A;  5TBM B;  2P9V B;  3BRM A;  2WKH A;  1K56 A;  1JVJ A;  2WAF A;  3QP6 A;  4DE1 A;  3S7P A;  3T1X A;  2PDR A;  4WMC D;  2EXA A;  4LV3 A;  2Q9M A;  1DP9 A;  1KGE A;  3B42 A;  4IED A;  5HWW A;  3TOI A;  1YLP A;  2W27 A;  4GW9 A;  1XFQ A;  1KVL A;  5FAQ A;  2P74 A;  4WBG A;  1L0G A;  2ZC6 B;  3BWL A;  4KQD A;  4IVI A;  3HLB A;  2WGW A;  4FH2 A;  4D60 A;  3PBO A;  2QJ5 A;  3MS6 A;  4HIA A;  3HLF A;  4EUV A;  5AVF A;  2NUP C;  4X25 A;  3K2N A;  3KSH A;  4N92 A;  4P6Z S;  1IEM A;  1QME A;  3NJA A;  4WZ5 A;  5I5L A;  5FAP A;  2PD8 A;  3A0R A;  3H7W B;  3F1N A;  5J8X A;  1ZC2 A;  2W1R A;  2PT7 A;  1G28 A;  3UPN A;  3GTC A;  3U4L P;  3T4S A;  2WYX A;  3B47 A;  3IXG A;  1PNE A;  5HAR A;  2J80 A;  3ICY A;  5GLC A;  1FIK A;  4GS9 B;  1F2K A;  3KSF A;  3VP2 A;  3FV7 A;  2QJ7 A;  3Q7V B;  5EVI C;  2GJ3 A;  3W2Z A;  3E0Y A;  5IT5 A;  2KDK A;  2VGJ A;  3HUM A;  2B5R A;  1ERQ A;  3T50 A;  4O8G A;  2KLI A;  3WS5 A;  4ETZ A;  3JVV A;  2O9B A;  1OTI A;  3IXH A;  2JC7 A;  4R70 A;  3LEZ A;  3MXQ A;  1YT4 A;  3VP1 A;  3EQV A;  4EV4 A;  4LEN A;  4FTX A;  3PBN A;  2XSS A;  4B4Z A;  5DKK A;  2BLS A;  1CEG A;  3BQA A;  4BL3 A;  2ZOI A;  3QHY A;  2EA9 A;  2Y2K A;  4I3A A;  3D3O A;  1H0M A;  2KOI A;  5DF9 A;  4NXB A;  3UE1 A;  3D4F A;  3MBZ A;  3M2J A;  2B95 A;  5CER A;  1CQA A;  2EX8 A;  3HJI A;  1S66 L;  1NXY A;  2Y91 A;  5HX9 A;  4DE0 A;  4Y15 A;  5GHX A;  3H9W A;  3V3R A;  3RXW A;  4HH3 A;  3S7N A;  3HVF A;  4P6Z M;  1KVM A;  5FQ9 A;  4RQ9 A;  3MQQ A;  4ZJ1 A;  2E8I A;  2I9V A;  2BTF P;  2V0W A;  2XH9 A;  4OQH A;  2EWV A;  1IYP A;  3Q07 A;  3Q82 A;  3IX4 A;  1HTZ A;  1SDE A;  1CF0 A;  1KGG A;  1HD8 A;  2Y2M A;  4E3M A;  1MWR A;  3P01 A;  2IWB A;  2OOL A;  4RA7 A;  3C38 A;  2HP9 A;  2H28 A;  1KE0 A;  3OBF A;  1W63 M;  1XJ3 A;  5HL1 A;  4Y7P A;  4R3A A;  4ARZ B;  1GA9 A;  2ZQA A;  5FEF A;  1CI9 A;  2M7V A;  4P0M A;  4BBU A;  2XLN A;  1CI8 A;  4Y17 A;  1SKO A;  3IHA A;  4KG2 A;  2Y55 A;  2P04 A;  3FC7 A;  3WRT A;  2QHK A;  2GDN A;  4UQI S;  5HDS A;  5HPI A;  3N7W A;  3K3C A;  4RVA A;  3T1Q B;  3UE0 A;  4NXG A;  3MZF A;  4Y0U A;  2L0W A;  1BLP A;  2XGN A;  1KE4 A;  5AQ9 A;  5TBM A;  1FCM A;  1ZHH B;  5EPH A;  2IWC A;  3B3X A;  3ZQ5 A;  3QNC A;  2VV7 A;  1D06 A;  3T12 B;  5E2F A;  2ZQ7 A;  2Y2J A;  2KX6 A;  4EER A;  4PM7 A;  2ZQ8 A;  5AQA A;  1F98 A;  4QWO A;  3TJZ C;  1M6K A;  4OQI A;  1MWT A;  2W3G A;  2PAV P;  4GB7 A;  1YSQ A;  2HJ9 C;  1FCO A;  3F1O B;  4R3J A;  5DF7 A;  4G3K A;  1LL5 A;  3S7Q A;  2W0N A;  4EQ1 A;  1PWC A;  4JF4 A;  3SH9 A;  2JKF A;  1FSW A;  5HPF A;  3BM6 A;  4HHD A;  1Z09 A;  2ACG A;  3V67 A;  4OPR A;  3C30 A;  3E2K A;  1BUL A;  2RL3 A;  3PR6 A;  2VKS A;  4LGW A;  2O9C A;  2WKR A;  4Q0J A;  1D7E A;  3WS0 A;  3R7W A;  3TW8 A;  3PAE A;  3ZNY A;  5E2G A;  3IWO A;  2Y2O A;  3VP4 A;  2DRW A;  4HH2 A;  1T1B A;  2XK1 A;  2ZM2 A;  1ALQ A;  1JWV A;  1PI5 A;  5D3O A;  5FAT A;  3I7J A;  4R23 A;  5CXW A;  4CLC D;  3M6B A;  1TDG A;  5EM0 A;  4GN2 A;  4UQI M;  1PIO A;  2V8F A;  5HD3 A;  3BEB A;  4HOI A;  3HUN A;  4C6Y A;  5J3W A;  4LRY C;  3S4X A;  5EVI B;  4DF6 A;  1X0O A;  1XJ2 A;  3IS2 A;  4IJG A;  1EW0 A;  4ZBE A;  4E3L A;  4YNR A;  2HF6 A;  2HV1 A;  4B93 A;  4X6T A;  5CEB A;  4R6L A;  5CGS A;  4YWZ A;  3E2L A;  1LL8 A;  4HP4 A;  4HNB A;  4D2O A;  4HEF A;  2OWH A;  3KSG A;  4KZ7 A;  3ZG0 A;  1YMX A;  4E3O A;  3ZG8 B;  3UB5 P;  1JTD A;  1XPB A;  3EEH A;  4E3K A;  3T1S A;  1VEU B;  4X55 A;  4EXO A;  3F1P A;  5CGX A;  3OPP A;  3KYQ A;  2C5W B;  3ZDJ A;  2BG1 A;  3CJM A;  4EBL A;  4JF6 A;  1VEU A;  3BFF A;  3CZD A;  1K6R A;  4GS9 A;  1BTL A;  1N9B A;  1PI4 A;  2V2F F;  3JPU A;  5EOE A;  3SH7 A;  4LV1 A;  4EU0 A;  4XT2 B;  4I5S A;  3CWF A;  3MJQ A;  2Y2Q A;  3VP0 A;  1K4E A;  1FR6 A;  4L9G A;  2XQZ A;  3LI9 A;  3O86 A;  1IKI A;  2B18 A;  3KYE A;  1TVF A;  3GV9 A;  3TRC A;  3MXS A;  1K4F A;  1P9R A;  2YKF A;  3L9K A;  3HUO A;  3VFH A;  2ZC4 B;  2INW A;  2HDS A;  1ZTU A;  5DVA A;  4I3J A;  4KZ9 A;  3BYD A;  4MDZ A;  2HZ5 A;  2PRF A;  4UEY A;  3N8S A;  5FI2 A;  3IF6 A;  2VJW A;  4HJ6 A;  4DXB A;  1LLB A;  4E6X A;  3WWX A;  5BOH A;  2LB9 A;  2ZC3 B;  4OQ0 A;  3QP4 A;  4IHQ A;  1SCW A;  1C3B A;  4LV2 A;  4OON A;  3DTM A;  1ESU A;  2Y2P A;  1DY6 A;  4JGO A;  2J3T C;  3FG8 A;  3GQZ A;  1FOF A;  2WZZ A;  4FD8 A;  2G2U A;  3ZFZ A;  5GHY A;  3A3I A;  3RFB A;  5L09 A;  2J9P A;  5M19 A;  3UB6 A;  5IU1 A;  1LSW A;  1NYY A;  2P9V A;  3NHQ A;  1CEF A;  3DBA A;  4NKP A;  5FA7 A;  4UHU A;  4LFU A;  2Q9N A;  3BEC A;  3DTI A;  1TDL A;  2V1A A;  4ETX A;  3HJK A;  2VGK A;  2XFT A;  3RJU A;  2X71 A;  1PW1 A;  4MBH A;  4KUK A;  5LBR A;  3G31 A;  2HJE A;  5TJJ A;  2VV8 A;  2W3E A;  4C75 A;  3LIA A;  2DMW A;  3GVB A;  2ZQC A;  2J8Y A;  3IT9 A;  5FI6 A;  4LV0 A;  1RP5 A;  3T4Q A;  5G4Z A;  1WYC A;  4AFI A;  3FZC A;  3H7W A;  4OP5 A;  3M2K A;  3M6H A;  3CPT B;  4RX2 A;  4KQO A;  5TR7 A;  1SDN A;  5CHJ A;  5A93 A;  4ZRR A;  1S0W A;  4CQH A;  3RTY A;  2IWD A;  4KEN B;  2ZOH A;  4CLC E;  3IS2 B;  2ZC5 B;  3NBL A;  4BD0 A;  4QY5 A;  5IS1 A;  1TS7 A;  4QB8 A;  5EOO A;  5L10 A;  1YAX A;  5DKL A;  5HAQ A;  3ZYT A;  5GL9 A;  5F69 A;  5GHZ A;  5KSC A;  2EFU A;  3UDI A;  2QPN A;  1UWP X;  1BLS A;  1YLJ A;  1BSG A;  4Y0T A;  2GX5 A;  5A90 A;  2WGV A;  4F3L B;  3ZGA B;  4MN5 A;  3O87 A;  2A3U A;  5FI7 A;  3ZCZ A;  3SS3 A;  5E43 A;  2WKI A;  2VV6 A;  1U60 A;  4GNU A;  2JCH A;  2PU4 A;  2O99 A;  4XUX A;  5DFY A;  5FDS A;  1KDS A;  4GD8 A;  1N9O A;  5DJU A;  5EVL A;  1CJF A;  1MKM A;  4KZA A;  5M18 A;  2PYR A;  1H8Y A;  4JLF A;  2W1T A;  3IHB A;  4Z9Q A;  3VP3 A;  4K08 A;  2ZC7 A;  2J3T D;  4PM5 A;  2FZ0 A;  4EWF A;  1NRJ A;  4OOY A;  3W4O A;  3LR0 A;  5AJG A;  4S2N C;  1IFQ A;  3LIF A;  3AGF A;  3N8R A;  3VOY A;  3N6I A;  4CLC C;  1I5Q A;  4GD6 A;  4IVK A;  1D1J A;  5E2H A;  4BBV A;  3EOI A;  1IYQ A;  4Y13 A;  4E04 A;  2R78 A;  1PZO A;  1JTG A;  2K7S A;  2WZX A;  3AGD A;  3NDG A;  3HBR A;  4DJ2 A;  1Q2Q A;  4UA6 A;  1ES4 A;  4QD4 A;  3Q7Z A;  1NLZ A;  1V9Z A;  4F3L A;  4R4S A;  4JGP A;  2PYP A;  2ZL1 A;  3Q1F A;  3BFG A;  4EQI A;  1GSX A;  5FAS A;  3S22 A;  3NOU C;  2JKT M;  3F1N B;  3TSG A;  4X69 A;  2Z2L B;  3MR0 A;  4GDB A;  4KZ8 A;  4R38 A;  2WUQ A;  3SZT A;  3VV4 A;  2E8J A;  4JXW A;  2UWX A;  1YSP A;  2XDM A;  5AQ7 A;  2WGW B;  1S4S A;  3IX8 A;  2Q0O A;  2ZD8 A;  4BLM A;  1MC0 A;  3SS5 A;  1OJG A;  2V1B A;  5A92 A;  1MXO A;  2EX9 A;  1LHY A;  1PRQ A;  4L9F A;  4R1G A;  4DN0 A;  2J9O A;  4BQM A;  3G32 A;  2VGL M;  4IBX A;  1NLY A;  3F1O A;  1XFN A;  3LIB A;  5J4E A;  5C5K A;  3GR2 A;  2DCF A;  1FQG A;  3NY4 A;  2Y79 A;  3KSI A;  3LIC A;  2PR6 A;  3PBS A;  4E3I A;  1SZV A;  1L0D A;  4N9L A;  3CI6 A;  2VEA A;  3ZNT A;  3IWQ A;  1K54 A;  3ITB A;  3ZG9 B;  4QPR A;  4DMZ A;  3FKW A;  3SS4 A;  4RYE A;  2J3W A;  3LCE A;  4L0L A;  3H82 B;  5CX7 A;  3CIT A;  3FKV A;  3SH8 A;  3IXD A;  1GA0 A;  2V9A A;  1RGY A;  3G34 A;  1EI5 A;  1G6A A;  3O3V A;  2K2N A;  5A91 A;  3UNW A;  2VZW A;  2WAD A;  4JBF A;  3VE3 A;  3V50 A;  2JKG A;  4CPK A;  1K55 C;  3C4O A;  1YLW A;  4DRT A;  4GHI B;  1E25 A;  1UGU A;  3MQ0 A;  2Z2M B;  4UAA A;  3WS1 A;  3LR5 A;  4DDS A;  2XR0 A;  2LB5 A;  1W63 Q;  1TEM A;  3IQA A;  1K55 A;  3A3E A;  1AXB A;  1BYW A;  4WM9 A;  1EWZ A;  1TS0 A;  1VET B;  1T1C A;  1I2W A;  1S6R A;  2Y2H A;  4DKI A;  5K5B A;  4FSF A;  4X1L A;  5CTN A;  1ES5 A;  3HLW A;  4OQG A;  3S1Y A;  3ISG A;  1S1Z A;  2I72 A;  1PYY A;  5HW3 A;  2JKR M;  1J3W A;  1F9I A;  4NXF A;  3O5Y A;  4ZJ3 A;  3MZD A;  3NDE A;  5CHU A;  2FH5 A;  3MZE A;  1JNU A;  4H8R A;  4PAU A;  2VX8 A;  3R4K A;  3VSL A;  4LRX C;  2YKH A;  3G2Y A;  1GHM A;  2UV0 E;  3UB8 A;  4MBK A;  3UMD A;  3CUE C;  1MWU A;  3ZVT A;  4KUO A;  2D01 A;  1F5M A;  2EWW A;  4B9O A;  3QP5 A;  4K0X A;  1VQQ A;  1LT0 A;  3CMZ A;  3C8C A;  5CTM A;  5HZH A;  2M1C A;  4LLO B;  4BD1 A;  3BFC A;  3UO9 A;  1XGJ A;  2HDR A;  3UE6 A;  5EVI D;  3T4O A;  4ME4 A;  3DAV A;  3BLS A;  3NEC A;  2ZM8 A;  4WEL A;  5KMW A;  3PHY A;  3UME A;  1OTD A;  1K56 D;  2Y2L A;  1XA7 A;  5GLB A;  4MNR A;  4FUW A;  1JWZ A;  2QMI A;  4HI4 A;  1SHV A;  3PBR A;  2RCX A;  3PBQ A;  3IF6 C;  5E2E A;  4S2M A;  2WK0 A;  2XFS A;  4IUK A;  1FR1 A;  1XX2 A;  4MMN A;  1YQS A;  4I3I A;  4HBT A;  4DXC A;  3BY9 A;  4FOF A;  4U0T A;  3C7V A;  3ZVW A;  4F94 A;  2B02 A;  3HLE A;  1ONG A;  1GSV A;  1H5X A;  3E98 A;  5U47 A;  1P9W A;  3D9Y A;  3LI8 A;  4GJ4 A;  2Y8H A;  4MCW A;  5CGW A;  3E4P A;  5HSQ A;  4A5R A;  1W7F A;  1W8Y A;  1MWS A;  4NET A;  2L4R A;  4JXG A;  2CMN A;  4HES A;  2PHY A;  4GLQ A;  1V9Y A;  1VM1 A;  3PBT A;  1O7E A;  1ZG6 A;  5G4Y A;  4KZ6 A;  2A24 A;  4OVD A;  4QHC A;  1QMF A;  4S2I A;  4PHT A;  2XD1 A;  4EEP A;  3JYI A;  1A0K A;  3W4Q A;  3GRJ A;  4E6W A;  1XKZ A;  2ZMF A;  1GHP A;  5EFW A;  1E4D A;  3IBJ A;  5FL3 A;  4RX3 A;  5CEC A;  5KZH A;  1JWP A;  5AVE A;  4DDY A;  3RXX A;  5F1F A;  3DWZ A;  1LSV A;  1ESI A;  4OPZ A;  4Y5F A;  4KZ3 A;  4KG6 A;  4O01 A;  1HZO A;  4N1H A;  3A0S A;  2V1Z A;  4NK3 A;  2MJ6 A;  3A3F A;  3QNB A;  4WEJ A;  3HLC A;  4XT2 A;  3VE4 A;  3QP8 A;  3C2W A;  5L2F A;  2H10 A;  4MN6 A;  4KZ5 A;  4GOG A;  1ZKJ A;  5GLD A;  4WZ5 C;  2HGV A;  2FFF B;  3JVU A;  4LCL A;  5L07 A;  2GNX A;  2EXB A;  3QP1 A;  1L2S A;  3VFF A;  1FCN A;  3A3J A;  4HQA A;  4ZTK A;  4S2P A;  2AVX A;  2Y2G A;  3OPH A;  4CJN A;  4NXE A;  2K31 A;  3UPO A;  4OKP A;  5HFO A;  4B4X A;  2ZJ9 A;  4WN5 A;  3IXB A;  3RH8 B;  4X1M A;  1OJ5 A;  3IF5 A;  1IKG A;  3KYZ A;  3MFD A;  1LI0 A;  5DTT A;  1BUE A;  5EV0 A;  2WKQ A;  2H5S A;  5EVE A;  1KGF A;  1LSX A;  3O88 A;  5L8M A;  1T19 A;  2ZMA A;  5JYO A;  1L3L A;  2Z6C A;  3MF0 A;  3Q7V A;  3IF6 B;  1PWD A;  3NUL A;  3AGE A;  4JGQ A;  1S1Y A;  2ZBB A;  1PW8 A;  3PTE A;  5CRF A;  5CED A;  4X53 A;  1Y28 A;  3CUE A;  3HRE A;  3LUQ A;  3IBR A;  1MKI A;  2ZQ9 A;  3EGX C;  4HY8 A;  5FSR A;  1OTA A;  2W3F A;  3W4P A;  3T4L A;  3CAX A;  4YFM A;  2OAP 1;  1UWN X;  4ZJ2 A;  5DJT A;  4IBR A;  3LY4 A;  4E3N A;  5HL6 A;  2Y2I A;  2WKP A;  1P97 A;  1W8Q A;  1YMS A;  1XJ4 A;  4U3T A;  4Q0H A;  1Y4O A;  4BL2 A;  3FPV A;  4FCF A;  1DJA A;  2JKR I;  4UA9 A;  4Z1W A;  4OOM A;  1OT6 A;  2WKE A;  4PM8 A;  4BBT A;  3OC2 A;  1HVB A;  1NRF A;  2ZM0 A;  5EM1 A;  4ID4 A;  1N9N A;  3W8K A;  2X01 A;  4MEZ A;  4CLC B;  4S2L A;  3MKF A;  3MFX A;  3NCK A;  4YIN A;  2L1M A;  2A49 A;  2EX2 A;  4DE3 A;  4EW7 A;  3OPL A;  3UB7 A;  3E4O A;  3U2A A;  4U0X A;  4O7D A;  1GSW A;  3HL9 A;  5F83 A;  4K0W A;  3H82 A;  4B88 A;  2HDU A;  3CHW P;  5TGF A;  4S2K A;  4H6J A;  4P87 A;  1ACF A;  3SOI A;  5FQI A;  1DJB A;  3NI9 A; 
#chains in the Genus database with same CATH homology
 4L0L A;  3H82 B;  4L9E A;  5CX7 A;  3CIT A;  4EXO A;  3F1P A;  2W3H A;  2V9A A;  4YOF A;  3KYQ A;  1OPX A;  2K2N A;  4I39 A;  2VZW A;  3VE3 A;  5MC7 A;  4GS9 A;  4Y2F A;  3G6O A;  5DFX A;  4MN7 A;  4GHI B;  4WUJ A;  1UGU A;  4OOL A;  3MQ0 A;  2A2L A;  1STZ A;  1VHM A;  3LYX A;  1WA9 A;  4EU0 A;  4XT2 B;  1T1A A;  4I5S A;  3CWF A;  3MJQ A;  3LR5 A;  5KIZ A;  4L9G A;  4EET B;  1S67 L;  2LB5 A;  3LI9 A;  3GEC A;  5TBM B;  1W63 Q;  3TE8 A;  2QYB A;  2B18 A;  3MQO A;  3S7P A;  1DP8 A;  2PDR A;  4JGR A;  3TRC A;  1BYW A;  5HWV A;  1P9R A;  2YKF A;  1TS0 A;  3OLO A;  1DP9 A;  1T1C A;  1TF1 A;  5K5B A;  4WF0 A;  4FSF A;  4HJ4 A;  2INW A;  3B42 A;  5HWW A;  1ZTU A;  3LIE A;  4I3J A;  3OCN A;  1S1Z A;  2W27 A;  4GW9 A;  4BJP A;  2VGL S;  1XFQ A;  4MDZ A;  2JKR M;  1F9I A;  4NXF A;  3O5Y A;  3BWL A;  4UEY A;  4Y3I A;  4KQD A;  2FH5 A;  2W1T B;  1JNU A;  4PAU A;  2VJW A;  2JHE A;  2VX8 A;  3R4K A;  4HJ6 A;  4LRX C;  2YKH A;  3PBO A;  2QJ5 A;  3UB8 A;  4HIA A;  4EUV A;  3B33 A;  5AVF A;  2NUP C;  3UMD A;  3EGD C;  2LB9 A;  3CUE C;  3K3D A;  3K2N A;  4IHQ A;  3KSH A;  4P6Z S;  3NJA A;  3ULF A;  5I5L A;  2PD8 A;  4KUO A;  3A0R A;  4JGO A;  2D01 A;  3H7W B;  2J3T C;  1F5M A;  2EWW A;  3F1N A;  3PYP A;  3FG8 A;  4B9O A;  2W1R A;  2PT7 A;  2JKT I;  1LT0 A;  2BAS A;  1G28 A;  3E4Q A;  3RFB A;  3C8C A;  3UB6 A;  5HZH A;  2W3D A;  3T4S A;  2M1C A;  3B47 A;  4LLO B;  5IU1 A;  1LSW A;  2J80 A;  3ICY A;  5HDC A;  4GS9 B;  1OTB A;  3KSF A;  2QJ7 A;  2ZMV A;  3NHQ A;  3DBA A;  4NKP A;  3UE6 A;  2O9A A;  3T4O A;  2GJ3 A;  4ME4 A;  3W2Z A;  2M7U A;  4EES A;  1OT9 A;  3E0Y A;  4ARZ A;  4WEL A;  5IT5 A;  2KDK A;  3PHY A;  4HJ3 A;  3UME A;  1OTD A;  1YKD A;  3UE3 A;  3T50 A;  2Z6D A;  4O8G A;  2KLI A;  4WLA A;  2V1A A;  4ETZ A;  3JVV A;  1ODV A;  5J7E A;  2O9B A;  1OTI A;  4PKY G;  4ETX A;  3NOP C;  3HJK A;  1T18 A;  4HI4 A;  3PBR A;  5A8B A;  4DJ3 A;  3PBQ A;  4R70 A;  4KUK A;  5LBR A;  4G3V A;  3MXQ A;  2HJE A;  5TJJ A;  2VV8 A;  2W3E A;  3A0V A;  3LIA A;  2DMW A;  4IUK A;  3EQV A;  4MMN A;  3PBN A;  2XSS A;  3CLO A;  3EQU A;  4I3I A;  3EWK A;  4G3W A;  3BY9 A;  4FOF A;  5DKK A;  3BQA A;  3LID A;  2ZOI A;  2B02 A;  2EA9 A;  3T4Q A;  5G4Z A;  4I3A A;  4AFI A;  1GSV A;  3H7W A;  3D3O A;  3E98 A;  1P9W A;  2KOI A;  4KQO A;  5DF9 A;  4NXB A;  2XRO A;  4ZRR A;  3LI8 A;  4GJ4 A;  4CQH A;  3RTY A;  2Y8H A;  4MCW A;  2ZOH A;  3E4P A;  3HJI A;  4CLC E;  1S66 L;  3IS2 B;  3KX0 X;  5HWT A;  5HSQ A;  2VLG A;  3P7N A;  2L4R A;  3H9W A;  5F6A A;  4EEU A;  2CMN A;  1P0Z A;  2A24 B;  4HH3 A;  2PHY A;  3S7N A;  4GLQ A;  1XJ6 A;  5IS1 A;  1V9Y A;  3PBT A;  2QKP A;  4P6Z M;  3LFV A;  4RQ9 A;  1N9L A;  3MQQ A;  5G4Y A;  2A24 A;  2I9V A;  2V0W A;  4M4X A;  1TS6 A;  3SW1 A;  1TS7 A;  2EWV A;  3T4J A;  1YAX A;  5DKL A;  4PHT A;  3ZYT A;  5F69 A;  4EEP A;  5HD5 A;  2ZMF A;  5EFW A;  1UWP X;  3IBJ A;  5FL3 A;  5AVE A;  3P01 A;  2GX5 A;  3OCL A;  2OOL A;  4BMW A;  4F3L B;  4MN5 A;  3R7W B;  3C38 A;  4H6J B;  4PKY A;  1LSV A;  3BY8 A;  2H28 A;  3OBF A;  4Y5F A;  1W63 M;  1XJ3 A;  4R3A A;  1NWZ A;  4O01 A;  4ARZ B;  2M7V A;  3A0S A;  4BBU A;  2VV6 A;  2MJ6 A;  4WEJ A;  2O99 A;  4WEK A;  4XT2 A;  3VE4 A;  3C2W A;  3KO6 A;  2IA2 A;  3MMH A;  4MN6 A;  5DFY A;  4II7 A;  1S4R A;  2JN7 A;  2HGV A;  3JVU A;  2P04 A;  3FC7 A;  5F68 A;  2GNX A;  1N9O A;  5DJU A;  3VOL A;  2QHK A;  5KSH A;  4HQA A;  1DP6 A;  1MKM A;  4UQI S;  2PYR A;  5HDS A;  5HPI A;  3K3C A;  1TD5 A;  2NUT C;  2XRN A;  4NXG A;  2L0W A;  2OAQ 1;  2W1T A;  1OTE A;  3S7O A;  4K08 A;  5TBM A;  1ZHH B;  4LPZ A;  3ZQ5 A;  2J3T D;  4NXE A;  2K31 A;  2QWS A;  2FZ0 A;  1NRJ A;  2VV7 A;  1D06 A;  2P7J A;  4WN5 A;  3RH8 B;  3LR0 A;  5AJG A;  4BWI A;  1OJ5 A;  1IFQ A;  3LIF A;  5F5Y A;  3KYZ A;  3T4T A;  2PR5 A;  1G6O A;  4I38 A;  2WKQ A;  2KX6 A;  2XA7 M;  4EER A;  2P08 A;  4CLC C;  3BW6 A;  1LSX A;  4BBV A;  3EOI A;  1F98 A;  3TJZ C;  5L8M A;  3PXP A;  1T19 A;  1DRM A;  5HDD A;  2W3G A;  4E04 A;  1YSQ A;  2HJ9 C;  2R78 A;  2K7S A;  2Z6C A;  3F1O B;  2G7U A;  3EEA A;  4G3K A;  3HCY A;  3MF0 A;  3S7Q A;  2W0N A;  4EQ1 A;  4DJ2 A;  4JGQ A;  2PD7 A;  1NLZ A;  1S1Y A;  1V9Z A;  2ZBB A;  4F3L A;  5HPF A;  2V0U A;  4HHD A;  3LR3 A;  4JGP A;  2PYP A;  1Y28 A;  3CUE A;  4O0P A;  1VB6 A;  1GSX A;  3LUQ A;  3LR4 A;  3IBR A;  2O0Y A;  3V67 A;  3C30 A;  3NOU C;  2JKT M;  3F1N B;  3EGX C;  1KOU A;  4HY8 A;  1OTA A;  3PR6 A;  2VKS A;  2W3F A;  2O9C A;  2WKR A;  3UB9 A;  4Q0J A;  1D7E A;  3T4L A;  3R7W A;  3MR0 A;  3OOV A;  3CAX A;  3TW8 A;  3F1P B;  2OAP 1;  1UWN X;  4R38 A;  2GZA A;  4GCZ A;  5DJT A;  3VV4 A;  4HH2 A;  1T1B A;  5HL6 A;  2WKP A;  4Q0I A;  1YSP A;  1P97 A;  4LRZ E;  1S4S A;  2OWJ A;  2D02 A;  1XJ4 A;  4Q0H A;  4CLC D;  1TS8 A;  3D72 A;  3FPV A;  2VA0 A;  1MC0 A;  2JKR I;  4HP9 A;  4UQI M;  3BJN A;  1OJG A;  1IOU A;  2V1B A;  5HD3 A;  4Z1W A;  4HOI A;  4OOM A;  1OT6 A;  5J3W A;  4WL9 A;  4LRY C;  4L9F A;  4DN0 A;  1H8M A;  4BBT A;  4CLC A;  2VGL M;  3OC2 A;  1X0O A;  1XJ2 A;  1N9N A;  3IS2 A;  1NLY A;  4IJG A;  1EW0 A;  3F1O A;  1H3Q A;  1XFN A;  3LIB A;  3FPW A;  5J4E A;  5C5K A;  4YNR A;  2HF6 A;  2HV1 A;  4CLC B;  3MFX A;  4B93 A;  2L1M A;  4R6L A;  1MZU A;  4IUH A;  4YWZ A;  4EW7 A;  1LL8 A;  2Y79 A;  3KSI A;  3E4O A;  4HNB A;  4HP4 A;  3UB7 A;  3LIC A;  2PR6 A;  3U2A A;  2OWH A;  3PBS A;  4NEE D;  3KSG A;  3BQ8 A;  3NOT C;  2XA7 S;  3CI6 A;  1GSW A;  2VEA A;  3H82 A;  4QPR A;  4DMZ A;  3T4K A;  4H6J A;  4GHI A;  3GDI A;  3EEH A;  2J3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...