4NEED

Crystal structure of ap-2 alpha/simga2 complex bound to hiv-1 nef
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
142
structure length
142
Chain Sequence
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AP-2 complex subunit sigma
publication title How HIV-1 Nef hijacks the AP-2 clathrin adaptor to downregulate CD4.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Viral protein/protein transport
total genus 48
structure length 142
sequence length 142
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2013-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01217 Clat_adaptor_s Clathrin adaptor complex small chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.60 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4neeD00
2XA7M 4NEED 1W63M 2XA7S 1W63Q 2JKRI 2JKTI 2VGLM 5MC7A 3TJZC 4P6ZM 2VGLS 4UQIS 2FH5A 4UQIM 4P6ZS 1NRJA 2JKRM 2JKTM 2HF6A
chains in the Genus database with same CATH superfamily
4B88A 1K25A 3SS5A 1KGGA 2G2WA 4FD8A 3IF6B 1ESUA 3LR5A 4PM7A 2V1BA 4CLCB 4GDBA 2GNXA 3MKEA 5M1AA 1VEUA 4P6ZS 2Y2KA 3BEBA 1IKIA 3IF5A 2JN7A 2PBYA 4H8RA 3NI9A 1OT9A 3RJUA 4OLGA 5HD5A 2ZC5B 3GRJA 2ZC4B 2IA2A 5FQIA 1SKOA 2MJ6A 1DP6A 1TVFA 2QZ6A 5F1FA 5FQMA 1K57A 3OZHA 3NHQA 3C5AA 5HWVA 5TBMB 2J80A 2VK3A 1H3QA 4XT2B 4LV3A 1C3BA 4MLLA 1H0MA 4OQGA 3ZHHA 4EW7A 1DP8A 3ZG8B 3T4KA 4KZ6A 4P87A 4WELA 1K4FA 2WADA 4PPRA 4R3BA 2WGIA 3ZVTA 1W8YA 4BBTA 4MN5A 4LENA 3O5YA 1ES5A 5A92A 2VV8A 2C5WB 4E3JA 3VV4A 3O87A 3K3CA 2ZBBA 1H8ZA 3M6BA 1K55C 4WYYA 1YQSA 3VP2A 2RCXA 5FQJA 5E2HA 1KDWA 2VGJA 2WYXA 4H6JA 3FYZA 3DAVA 2L1MA 2XR0A 3QHYA 2QPNA 2VZWA 3JVUA 5D3OA 3ZG5A 2ZJ9A 4QY5A 3IBRA 4BL3A 5TGFA 4PKYA 4N1HA 5EECA 2JKGA 1AWIA 4B9OA 2PD7A 1J3WA 1XP4A 5CX7A 2V1AA 5FATA 5FASA 4JF4A 1TEMA 2EX8A 3CAXA 2H0TA 3F1NB 5FDHA 4S2NC 3D4FA 4I39A 1P0ZA 5F5YA 3OCNA 4GW9A 5CGXA 2FFFB 4DRTA 4II7A 4Z1WA 4FSFA 1O07A 3VOLA 1ES3A 4KQQA 3A0SA 4EWFA 4RX2A 4LV1A 5LBRA 1HD8A 2PRFA 1VETB 5K5BA 5FAOA 3GTCA 2XSSA 3UE0A 4OQIA 4NXEA 4LFUA 3UB8A 3VP3A 3IQAA 3HLWA 2PAVP 1O7EA 2EXBA 3UO9A 3KO6A 4KZ9A 2QWSA 2Z2MB 4PM6A 3GV9A 1Y54A 3IXHA 1LSVA 2EA9A 3NDEA 2YKFA 3IH9A 4R1GA 2WUQA 2P08A 2OLVA 4L0LA 4N92A 2XRNA 3V39A 2XA7S 1YM1A 4OOLA 1OTAA 4GD6A 1VEUB 1JWPA 2A24B 4QD4A 2OWJA 1PIOA 4WZ5A 5BOHA 2C6WB 2UV0E 3WS1A 4JXWA 5G4ZA 4FOFA 5EE8A 2Y2PA 3PBSA 5EOOA 2K7SA 2ZQAA 4KUKA 1T1BA 1ZG6A 3UDXA 2WKEA 3NIAA 5E2EA 5U47A 4OPZA 5L8MA 1SKOB 2XF3A 2IWCA 5I94A 1BLCA 2O99A 5I5LA 1LL8A 1Y28A 3R4KA 1F98A 4P6ZM 2J3WA 1OJ5A 1KVMA 4EBNA 4HY8A 1HVBA 3CPTA 1W79A 2O9BA 1NZUA 3N8SA 1WE4A 3A3JA 3HBRA 4UHUA 4Q0HA 4HI4A 3QP4A 2PR5A 4IUHA 2WKPA 2XFTA 1N9LA 3NDGA 2ZOHA 1MWRA 1W8QA 1YAXA 2V8CA 1BLPA 3T1XA 4KZ8A 4R3JA 2VA0A 5GHXA 4HNBA 4PM5A 4QB8A 3DBAA 4XXRA 4S2KA 5HPIA 2W3EA 4DN0A 4GZBA 1G68A 4CLCD 4EV4A 1V9ZA 4PM8A 1XJ6A 3HVFA 3T1RA 2Y2NA 1VB6A 3C4OA 2O9CA 4X1MA 3IF6A 3QP8A 3S7OA 4H6JB 4GB7A 4Y0UA 4C6YA 4B4ZA 4G3KA 2ZD8A 4R70A 2Z6DA 2XLNA 3KSIA 2W0NA 4MBHA 4EQIA 3MF0A 2XQZA 3MS6A 4RYEA 2FH5A 4G3VA 3D72A 1PW8A 1KE4A 1BTLA 1XJ4A 2WKIA 3WRTA 1MBLA 1S67L 3S4XA 3ISGA 2VEAA 2HP6A 5EV0A 2ZLYA 3S22A 3A0RA 1T1AA 3MXRA 4U0TA 3LR3A 2OLUA 1EWZA 5HX9A 1GHIA 1OPXA 3NJAA 4XT2A 3PAGA 1H8MA 5GHZA 3PXPA 4Y2FA 2XD5A 4WEJA 4JXGA 1VHMA 1PWDA 3UB5P 4BENA 1K38A 1IYOA 2ZC6B 2J9OA 1DRMA 4ZAMA 3LY3A 2EWWA 3ZQ5A 2HDQA 1PZPA 1LHYA 3AGEA 1F2KA 4N1XA 5IU1A 3WS2A 2Q9NA 5EVIC 3UMDA 1PWGA 1JTDA 5FEGA 1MWSA 4GJ4A 4LRXC 4ESPA 3W4PA 2P04A 2P9VA 3PBTA 1FSYA 4ME4A 3WWXA 1NZOA 4N9KA 1KDSA 4KZ7A 1XX2A 3HLCA 1SKFA 4HJ3A 3MFDA 4ZDXA 1E25A 2GZAA 4IHQA 4EETB 4IVKA 4R38A 5CECA 3L7HA 3LUQA 3C4PA 1K54A 3QP6A 2XH9A 4DDYA 4DE1A 1W63M 1UGUA 2B95A 4HQAA 1OTBA 4OPYA 3TOIA 3MZFA 3S1YA 3V3SA 2ZM2A 3BLSA 3ZCZA 4DXBA 3BY9A 3M2KA 4DJ3A 4I38A 3F1NA 3IS2A 5M19A 3BFGA 1E3UD 2XA7M 3VP1A 1YMSA 4KZ5A 3C30A 1PYYA 1NLZA 3VFHA 3EGXC 4CLCE 1XGJA 3ZYTA 2J9PA 1GSXA 1ZHHB 1G6OA 1W63Q 4X69A 4E3KA 3WS4A 4BD0A 3JVVA 1YT4A 2WGVA 4KZBA 3SS3A 3SOIA 2Y55A 2JKRM 4OP8A 1VETA 2Y2QA 1SDEA 5GHYA 4X1LA 3PBQA 3G30A 1S1YA 3LIFA 1MC0A 4Y0TA 3A3EA 1I5QA 3QP5A 1BYWA 1P9RA 1Q2PA 3UPNA 2V9AA 3GQZA 3RXWA 1K0KA 1K6SA 3AGDA 3NBLA 4RVAA 1SZVA 4CJNA 3UPOA 4R3AA 1IELA 1FCOA 5AVFA 3OPPA 3IBJA 3IWQA 4FCFA 4HIAA 3MZEA 1TDLA 4OQ0A 4MDZA 4OP5A 2PT7A 3LFVA 3VOZA 3MFXA 4DKIA 2A24A 1QMEA 4BD1A 2YKHA 3LI9A 2HDUA 1FCNA 5L2FA 3G6OA 2PD8A 4GS9B 3LR0A 3PR6A 3NY4A 3MZDA 4JPMA 1D06A 3FKWA 1NJ4A 2ZMVA 5CGWA 4HJ6A 4NXFA 3HLBA 3UE6A 5DFYA 3VFFA 1L0EA 3RFBA 3LY4A 2O9AA 2V1ZA 2B02A 5FI2A 5CHUA 5A91A 4L9FA 3HJIA 1HZOA 3C7UA 3KYQA 4WUJA 2WKRA 5DFXA 3FV7A 1K6RA 1I2WA 1PZOA 1GA9A 1M6KA 2PYRA 3NOPC 4M3KA 3JYIA 3S7PA 2WZXA 3H7WA 4IEDA 2R78A 2DMWA 1F5MA 4Y7PA 1CI9A 3LEQA 2J3TC 1TDGA 4E3IA 4IVIA 3CJMA 2KDKA 3LR4A 2AVXA 3VSLA 1S1ZA 4WZ4A 4GD8A 2J8YA 4I3IA 4HESA 1XFQA 4BMWA 3H82B 5EM1A 3VSKA 4R4SA 4LV2A 2Q0OA 1N9BA 2W3GA 1VM1A 2XD1A 2P9VB 2PHYA 3BY8A 4D60A 4IBXA 4F3LA 4IJGA 3TSGA 2BASA 3KSGA 3SH8A 5FSRA 4CPKA 5IHVA 3UN7A 3HL9A 1XJ2A 2HJEA 5IT5A 4ZRRA 1XGIA 4B4XA 3FC7A 3VMAA 4Q8IA 5KZHA 2EX9A 2A3UA 3IXBA 3T4OA 2XDMA 3E4QA 3OBFA 1S4RA 3LYXA 2IWBA 2WAEA 4UQIS 3NCKA 4G3WA 1CEGA 4XUZA 1OTEA 4NG2A 3IS2B 3O3VA 2BG1A 5HAPA 4HH2A 4BBVA 4MCWA 2H5SA 5AQAA 2WAFA 1BSGA 1FCMA 5C5KA 2BLSA 1JVJA 3G35A 4OH0A 4NKPA 4UA7A 2G7UA 4MEZA 2E8IA 2EWVA 1RCJA 1JWVA 3P7NA 3DTKA 5E2FA 3UPPA 3T4LA 3N7WA 4QPRA 2VGLM 5EVIA 4LRYC 4JXSA 5FEFA 4Q0JA 5CTMA 5AJGA 1NYMA 1ZKJA 2HV1A 5CEBA 2HJ9C 2JKTM 5EFWA 1YKDA 3BFEA 4EERA 3EQUA 4EXOA 2OV5A 2JCHA 3MXQA 4LV0A 3CUEA 4FUWA 3IXGA 1XXMA 3W8KA 4EQ1A 1CQAA 3T4QA 1T1CA 5HD3A 3UB9A 3B42A 3FZCA 1A0KA 5J7EA 5CERA 4MNRA 2V0UA 4KQDA 4I3AA 4EESA 2Z2LB 2ZM0A 4QY6A 4OPRA 3RXXA 4E04A 2WGWB 2IWDA 1WA9A 3FKVA 5HAIA 1LI0A 5HL1A 3V50A 1YLTA 2HZ5A 2I72A 4HP9A 3LEZA 1L3LA 5DJUA 3PAEA 4NXGA 3IWIA 2ZOIA 4AFIA 1GSWA 2Y2LA 5CHMA 4GCZA 2ZC7A 1LSXA 3HUMA 4KUOA 1YLJA 3QP1A 5CEDA 2JKFA 5DF9A 4YNRA 5HAQA 4UEYA 3UE1A 3ZG7B 1HLUP 2RL3A 3KSFA 4HH3A 4JGQA 4EU0A 3H7WB 4ZJ2A 4U0XA 3QNCA 5E2GA 4KZ3A 4Y5FA 3L9KA 4QJGA 3KX0X 2HDRA 2R9XA 1CEFA 3ITBA 2UWXA 4DE2A 4HBUA 4Y0OA 4E3LA 2DCFA 4O7DA 5EUAA 3V67A 1K57C 3GMWA 1LSWA 2P74A 4DE3A 3K2NA 4JGRA 3SS4A 3U2AA 2Y2IA 4ZTKA 4KZAA 3I7JA 2PDRA 4GN2A 3SH7A 2EXAA 5CRFA 2JE5A 1OTDA 1YMXA 4OLDA 1G6AA 1TS8A 5HDDA 2DNSA 4YWZA 3OPRA 4F3LB 4ZBEA 4BQMA 1LI9A 2P7JA 2BTFP 2VV7A 4E6WA 3CLOA 1KGFA 4GS9A 1L0GA 1G28A 5L07A 1ERQA 5AQ7A 5FQ9A 1P97A 3EGDC 3FPWA 2INWA 5FA7A 1YLZA 3NULA 4GKUA 1XFNA 3OC2A 4LGWA 4HJ4A 3ICYA 4GLQA 4GHIB 2WZZA 4P6BA 1MZUA 4WLAA 5CGSA 2CC1A 4BL2A 3T4JA 1HTZA 5FI6A 1GA0A 4EUZA 5IS1A 3QNBA 5DTSA 3E4OA 1BULA 3VP0A 5GLAA 5TFQA 5DJTA 1EROA 1KGEA 2EX6A 5DVAA 2Y8HA 1S0WA 2VKSA 3OCLA 1ALQA 4UQIM 1ACFA 5HFOA 3DWKA 5TJJA 3VOYA 2V8FA 5EVLA 1BLHA 4GDNA 4KZ4A 5EVIB 1T19A 2I9VA 1MKMA 3B3XA 4WBGA 1P9WA 3MKFA 2PU4A 2PYPA 4K91A 5G4YA 1D7EA 1XKZA 2H28A 1K55A 5F82A 3H82A 2W1RA 1L0FA 5DKLA 5JYPA 1RGZA 3G32A 1SDNA 3TRCA 3N6IA 4L9GA 2GX5A 3Q07A 3ZNTA 4EBLA 1W5DA 5KSCA 4NK3A 3UNWA 2B18A 3TE8A 1BLSA 2JKRI 1OT6A 1PRQA 1SCWA 4KQRA 5CHJA 4OKPA 3SZTA 3S7QA 1DY6A 3GR2A 1DJCA 3PBOA 4WF0A 4DMZA 2PU2A 2E8JA 3GSGA 3E2KA 3DTEA 3HLGA 4RX3A 2M1CA 2VV6A 4S2NA 5CTNA 3ZGAB 1FR6A 1U60A 4MBFA 4GNUA 2Y2JA 3CI6A 3P98A 1YSQA 2GDNA 4ZJ1A 1BUEA 4JXVA 5GLCA 1GSVA 3ZDJA 3DTMA 4WN5A 1GCEA 4DDSA 1H5XA 4S2JA 2EFUA 4DF6A 3MSHA 3NOUC 1KOUA 1S4SA 3F1OB 2ZM8A 3IWOA 1JTGA 2KX6A 2L4RA 5AQ9A 3T4SA 1STZA 1S66L 3MQ0A 4BWIA 5EVEA 2Q9MA 3G4PA 5HZHA 3N4IA 4KG5A 3CWFA 1ES4A 1WYBA 3BRMA 4EEPA 2DRWA 4FH4A 2VX8A 3ZFZA 4S2IA 2WK0A 3T1SA 1KE3A 3OPHA 4HP4A 3N8RA 4E3NA 3ZVWA 2EX2A 3B33A 1NLYA 1ESIA 3T1QB 4ETZA 3LGOA 4X68A 3Q7VA 4P85A 1IFQA 2W3DA 3MQQA 4S2PA 1F9IA 5FQKA 3D9YA 2ZMAA 5FAQA 2WGWA 5HARA 3Q7ZA 1QMFA 4D2OA 3LI8A 3BW6A 4ID4A 5HPFA 2HPBA 1FILA 1XJ3A 3FG8A 4E3OA 2OAQ1 5FI7A 3IF6C 2QJ5A 1L2SA 4I3JA 1PWCA 3B47A 2A49A 2H0YA 1W7FA 4CLCC 1TD5A 2J7VA 3A3FA 3O88A 2XK1A 4BLMA 1WYCA 4MBKA 1OTIA 3C2WA 2ZC3B 5F6AA 4JGOA 3DW0A 2XFSA 5EM0A 3KSHA 5KSHA 2FFYA 1XA1A 3VE3A 2KOIA 1RP5A 4EEUA 3MBZA 4QHCA 4B93A 4WL9A 1PW1A 3BFDA 3Q1FA 3EWKA 1DJAA 2WKQA 1X0OA 1YLPA 3R7WB 1JNUA 3KYZA 1PNEA 5FQQA 1IYPA 3G2YA 4PM9A 3WS0A 3PBNA 4OOYA 3MR0A 4OONA 1DP9A 5KMWA 1K56D 3KYEA 1ONGA 4X55A 2W1TB 4YFMA 1MPLA 2D02A 5AVEA 4X25A 1YSPA 2EFXA 4DJ2A 1K56A 4NETA 1ZG4A 4PHTA 3PHYA 4JF6A 3SW1A 1T18A 3GVBA 1ZTUA 3TG9A 3N8LA 1SHVA 4YINA 4EBPA 2KLIA 3DTIA 3PTEA 4JF5A 2M7VA 5FAPA 5DF7A 2GJ3A 1M40A 2ZQ9A 2JKTI 4K0WA 5EPHA 2Y2MA 2VGKA 3W4QA 2QMIA 5TR7A 3VP4A 1GHPA 2HP9A 2H10A 5HSQA 4GHIA 1OJGA 1FOFA 1CK3A 5GL9A 1PI4A 1H8YA 4OPQA 1ZC2A 5DF8A 4MMNA 4ETXA 3UDFA 3UDIA 5HW3A 4HEFA 4Y15A 4KG2A 2Y4AA 1K54C 3UY6A 1KE0A 5EVID 1ES2A 3HLFA 4E6XA 3D3OA 4I5SA 5J8XA 1FSWA 4NXBA 1MKIA 2QKPA 2NUPC 3G2ZA 2A2LA 4O8GA 3CZDA 1Z6FA 3E4PA 4S2OA 3E0YA 4C3QA 3BWLA 4PKYG 2LB5A 3AGFA 4K08A 4Y13A 3OOVA 3G31A 4DE0A 4GOGA 2XGNA 4P0MA 2QJ7A 3IX4A 1FR1A 3LO7A 4ARZA 3V5MA 1Y4OA 4X53A 4FTXA 5GLDA 3PBRA 3IX8A 3BYDA 5HDCA 2Y2GA 3Q7VB 4LCLA 5F68A 1TS6A 3LCEA 4RA7A 1FQGA 2WKHA 1I2SA 3C7VA 4O01A 2X71A 2M7UA 4HHDA 1GHMA 2Y91A 3BECA 4JKTA 4Z9QA 3HCYA 1RGYA 3HUOA 2V2FF 2ACGA 3OLOA 4EUVA 4LLOB 3NOTC 2K31A 3IXDA 1NRFA 5KIZA 3FPVA 2LB9A 2QHKA 4JLFA 1DJBA 3GDIA 4X56A 4Y17A 4MN6A 1BT5A 4KENB 3DWZA 5FDSA 2W3FA 1LLBA 3F1OA 2PR6A 3IT9A 5HDSA 2O0YA 1LL9A 1IYSA 3IHBA 2VLGA 2K2NA 4R23A 4OQHA 1L0DA 2ZL1A 3F1PA 5A90A 4S2MA 4PAUA 3LIBA 1LT0A 1XA7A 4WMCD 4R4RA 1TS0A 5A8BA 3NC8A 3IX3A 3G34A 3T12B 4N9LA 4PMAA 3HREA 3ULFA 5L10A 4OVDA 3V3RA 3P01A 3Q81A 4WMCA 1ERMA 4L9EA 3ITAA 5HL6A 2W27A 4K0XA 1MWTA 3HJKA 3E98A 3HLEA 3W4OA 4U3TA 1Q2QA 4NEED 5HWWA 1YLWA 3S7NA 2QYBA 3HUNA 1N9NA 4XUXA 2ZQ7A 3W2ZA 1TS7A 2V20A 3H9WA 2Y79A 2JHEA 5DTKA 5AQBA 2G2UA 5CXWA 4FH2A 2OOLA 3A3DA 2X01A 4KQOA 4CLCA 4Y3IA 3LICA 4MN7A 1XPBA 3RH8B 1IOUA 3EEAA 2HDSA 3M6HA 4ZJ3A 1VQQA 3K3DA 1YPRA 3WS5A 2X02A 1KVLA 3EEHA 1BZAA 2J3TD 1UWPX 1ODVA 4C75A 2Z6CA 1E4DA 1EI5A 1PFLA 3P09A 1NY0A 1OMEA 3UE3A 5M18A 1Z09A 3O86A 5F1GA 3QP2A 2Y59A 1CJFA 5J3WA 1J9MA 4UA9A 4O0PA 1ONHA 3BFCA 3R7WA 5TBMA 3MQOA 2HF6A 1YLYA 3LIAA 4KG6A 5L09A 2V0WA 1JWZA 2OSUA 3MMHA 3CG5A 2XEPA 4YOFA 2Y2HA 2HP5A 4HOIA 3T50A 5J4EA 4E3MA 2W1TA 4LPZA 1N9OA 3ZNYA 1AXBA 3BFFA 4ARZB 3LIDA 2XROA 5DTTA 2W3HA 3C38A 4CQHA 4OOMA 4A5RA 2NUTC 1IEMA 3T4TA 3PYPA 5HWTA 4X6TA 2ZMFA 2OWHA 1TF1A 4F94A 5EOEA 2R9WA 1S6RA 5G18A 1V9YA 2VJWA 2JBFA 3CUEC 3Q82A 3RTYA 4BJPA 4UA6A 3A3IA 3IHAA 4DXCA 1NWZA 3CMZA 1N4OA 5A93A 5DKKA 5JYOA 2JC7A 3BQAA 1MWUA 1D1JA 3M2JA 1EW0A 2ZQ8A 4WEKA 3NECA 4QWOA 4IUKA 3CHWP 4R6LA 4WZ5C 2D01A 3CITA 3FWLA 4BBUA 4UAAA 2VGLS 1G5UA 3JPUA 1IYQA 3WRZA 3UMEA 3VE4A 2ZL1B 4RQ9A 3F1PB 3UB6A 3HLDA 1FIKA 1PI5A 2Y2OA 1IKGA 2B5RA 3EQVA 1NXYA 4QU3A 3BLMA 4S2LA 3C8CA 3MJQA 1E3UA 4JGPA 1CI8A 4Q0IA 1UWNX 1MXOA 2L0WA 5GLBA 5F83A 5MC7A 3BQ8A 1K4EA 3CPTB 3OPLA 3UB7A 3SH9A 2PBDP 2CMNA 4M4XA 1LL5A 3BM6A 1MY8A 4HBTA 1NYYA 1CF0A 3EOIA 4R0QA 3U4LP 2FZ0A 3MXSA 3BJNA 5F69A 2ZQDA 4LRZE 3TW8A 2ZQCA 4IBRA 3ZG0A 3TJZC 4WM9A 3ZG9B 4LCMA 2OAP1 3A0VA 4JBFA 2HGVA 5FL3A 5E43A 3E2LA 3IH8A 3LIEA 3GECA 1NRJA
chains in the Genus database with same CATH topology
4UEYA 3ZQ5A 1OJGA 3KSFA 4HH3A 4JGQA 5IU1A 4EU0A 3UMDA 3H7WB 3LR5A 4MMNA 2V1BA 4ETXA 4CLCB 2GNXA 4GJ4A 4Y5FA 3KX0X 4P6ZS 4LRXC 2P04A 3PBTA 2JN7A 3V67A 4ME4A 1LSWA 3K2NA 4JGRA 3U2AA 3D3OA 4I5SA 4NXBA 2PDRA 1OT9A 2QKPA 2NUPC 4HJ3A 2A2LA 5HD5A 4O8GA 2GZAA 4IHQA 4EETB 4R38A 2IA2A 3E4PA 2MJ6A 3LUQA 1OTDA 3E0YA 1DP6A 1TS8A 5HDDA 3BWLA 4YWZA 4PKYG 2LB5A 1W63M 4K08A 1UGUA 4HQAA 3NHQA 1OTBA 4F3LB 3OOVA 2QJ7A 5HWVA 5TBMB 2P7JA 2J80A 1H3QA 4XT2B 3BY9A 4DJ3A 4ARZA 2VV7A 3F1NA 3IS2A 4I38A 3CLOA 4GS9A 1G28A 4EW7A 1DP8A 3T4KA 1P97A 2XA7M 3PBRA 3EGDC 3FPWA 5HDCA 2INWA 4WELA 3C30A 1XFNA 3OC2A 1NLZA 3EGXC 4CLCE 3ZYTA 4HJ4A 1GSXA 1ZHHB 1G6OA 1W63Q 3ICYA 4GLQA 1TS6A 4GHIB 5F68A 4BBTA 4MN5A 3O5YA 3JVVA 1MZUA 4WLAA 4O01A 3T4JA 2M7UA 4HHDA 5IS1A 2JKRM 2VV8A 3E4OA 3HCYA 3VV4A 3K3CA 2ZBBA 3OLOA 4EUVA 3PBQA 4LLOB 5DJTA 3NOTC 1S1YA 2K31A 3LIFA 1MC0A 2Y8HA 5KIZA 2VKSA 3FPVA 2LB9A 4H6JA 2QHKA 3GDIA 3OCLA 2L1MA 4MN6A 4UQIM 1BYWA 1P9RA 5TJJA 2W3FA 2V9AA 3F1OA 2VZWA 1T19A 2I9VA 1MKMA 2PR6A 3JVUA 5HDSA 2O0YA 4R3AA 1P9WA 2VLGA 2PYPA 2K2NA 3IBRA 5G4YA 5AVFA 1D7EA 2H28A 3IBJA 3F1PA 4PKYA 3H82A 4HIAA 2W1RA 5DKLA 4MDZA 4PAUA 4B9OA 2PD7A 3LIBA 1LT0A 2PT7A 3LFVA 3MFXA 1TS0A 5CX7A 5A8BA 3TRCA 2A24A 2V1AA 4L9GA 2GX5A 2YKHA 3LI9A 3CAXA 3ULFA 3F1NB 3G6OA 3P01A 2B18A 2PD8A 3TE8A 4GS9B 4I39A 1P0ZA 5F5YA 3LR0A 3PR6A 2JKRI 4L9EA 3OCNA 5HL6A 1OT6A 2W27A 1D06A 2ZMVA 4HJ6A 4NXFA 4GW9A 3HJKA 3UE6A 3E98A 5DFYA 4II7A 3S7QA 4Z1WA 4FSFA 3RFBA 2O9AA 3PBOA 4WF0A 3VOLA 4DMZA 2B02A 3A0SA 4NEED 5HWWA 4L9FA 3HJIA 3S7NA 2QYBA 3KYQA 2M1CA 2WKRA 4WUJA 5LBRA 1N9NA 2VV6A 5DFXA 3W2ZA 1TS7A 5K5BA 2XSSA 3H9WA 2Y79A 2JHEA 3CI6A 4NXEA 1YSQA 2PYRA 3NOPC 3S7PA 2OOLA 3UB8A 3H7WA 2R78A 1GSVA 4KQOA 2DMWA 1F5MA 4CLCA 4Y3IA 3LICA 4WN5A 4MN7A 2J3TC 3KO6A 3RH8B 1IOUA 3EEAA 2QWSA 2KDKA 3NOUC 3LR4A 3K3DA 1KOUA 1S1ZA 1S4SA 3F1OB 2KX6A 2L4RA 1LSVA 3EEHA 2EA9A 2J3TD 4I3IA 2YKFA 3T4SA 1UWPX 1ODVA 1STZA 1XFQA 4BMWA 2P08A 2Z6CA 3H82B 1S66L 3MQ0A 4BWIA 4L0LA 2XRNA 4GHIA 2XA7S 3UE3A 2W3GA 5HZHA 4OOLA 1OTAA 2A24B 2OWJA 3CWFA 2PHYA 5J3WA 3BY8A 4EEPA 4O0PA 4F3LA 2VX8A 5G4ZA 4FOFA 4IJGA 3R7WA 3PBSA 2K7SA 3MQOA 2HF6A 5TBMA 3LIAA 4KUKA 2BASA 1T1BA 3KSGA 4HP4A 2EWWA 2V0WA 3MMHA 4YOFA 1XJ2A 2HJEA 5IT5A 3B33A 5L8MA 4ZRRA 1NLYA 3FC7A 2O99A 3T4OA 5I5LA 1LL8A 1Y28A 4HOIA 4ETZA 3R4KA 1F98A 3E4QA 4P6ZM 3T50A 5J4EA 2W1TA 3OBFA 2J3WA 4LPZA 1OJ5A 1N9OA 1S4RA 3LYXA 1IFQA 4UQIS 2W3DA 3MQQA 4HY8A 1F9IA 4G3WA 1OTEA 2O9BA 4ARZB 3IS2B 3LIDA 3LI8A 2XROA 4Q0HA 3BW6A 4HI4A 5HPFA 4HH2A 4BBVA 4MCWA 1XJ3A 2PR5A 2W3HA 4IUHA 3C38A 4CQHA 2WKPA 4OOMA 5C5KA 1N9LA 4NKPA 3FG8A 2OAQ1 2QJ5A 2G7UA 2NUTC 2ZOHA 4I3JA 3T4TA 3PYPA 1YAXA 3B47A 5HWTA 2EWVA 2ZMFA 4CLCC 2OWHA 2VA0A 1TD5A 1TF1A 4HNBA 3P7NA 1OTIA 3C2WA 3T4LA 3DBAA 1V9YA 2VJWA 5F6AA 2W3EA 5HPIA 4JGOA 4DN0A 4QPRA 3CUEC 3RTYA 2VGLM 3KSHA 4CLCD 5KSHA 4LRYC 4BJPA 3VE3A 2KOIA 1V9ZA 4Q0JA 5AJGA 1XJ6A 4EEUA 1NWZA 4B93A 2HV1A 5DKKA 1VB6A 2O9CA 4WL9A 3BQAA 2HJ9C 2JKTM 5EFWA 1YKDA 3S7OA 1EW0A 4H6JB 4EERA 5HSQA 3EWKA 4WEKA 3EQUA 4EXOA 2WKQA 1X0OA 4G3KA 4IUKA 4R6LA 3R7WB 4R70A 1JNUA 3KYZA 2Z6DA 3KSIA 2W0NA 2D01A 3MXQA 3CITA 3CUEA 4BBUA 2VGLS 3MF0A 3PBNA 4EQ1A 2FH5A 4G3VA 3T4QA 3UMEA 3MR0A 1T1CA 3D72A 5HD3A 3UB9A 3VE4A 1DP9A 4RQ9A 3F1PB 3UB6A 3B42A 5J7EA 1XJ4A 2W1TB 3EQVA 1S67L 2V0UA 4I3AA 4KQDA 4EESA 2D02A 3C8CA 3MJQA 4JGPA 5AVEA 2VEAA 4Q0IA 1UWNX 1YSPA 2L0WA 3A0RA 4DJ2A 5MC7A 1T1AA 3BQ8A 4PHTA 3PHYA 4E04A 3UB7A 3SW1A 1T18A 2CMNA 3LR3A 1ZTUA 1WA9A 4M4XA 4HP9A 1OPXA 2KLIA 3NJAA 5DJUA 4XT2A 1H8MA 2M7VA 3EOIA 2FZ0A 4NXGA 3BJNA 5F69A 2ZOIA 4AFIA 1GSWA 4GCZA 3PXPA 4Y2FA 4LRZE 2GJ3A 4WEJA 3TW8A 1LSXA 2JKTI 4KUOA 1VHMA 3TJZC 2OAP1 3A0VA 2HGVA 5FL3A 1DRMA 3LIEA 5DF9A 4YNRA 3GECA 1NRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XA7 M;  4NEE D;  1W63 M;  2XA7 S;  1W63 Q;  2JKR I;  2JKT I;  2VGL M;  5MC7 A;  3TJZ C;  4P6Z M;  2VGL S;  4UQI S;  2FH5 A;  4UQI M;  4P6Z S;  1NRJ A;  2JKR M;  2JKT M;  2HF6 A; 
#chains in the Genus database with same CATH topology
 4B88 A;  1K25 A;  3SS5 A;  1KGG A;  2G2W A;  4FD8 A;  3IF6 B;  1ESU A;  3LR5 A;  4PM7 A;  2V1B A;  4CLC B;  4GDB A;  2GNX A;  3MKE A;  5M1A A;  1VEU A;  4P6Z S;  2Y2K A;  3BEB A;  1IKI A;  3IF5 A;  2JN7 A;  2PBY A;  4H8R A;  3NI9 A;  1OT9 A;  3RJU A;  4OLG A;  5HD5 A;  2ZC5 B;  3GRJ A;  2ZC4 B;  2IA2 A;  5FQI A;  1SKO A;  2MJ6 A;  1DP6 A;  1TVF A;  2QZ6 A;  5F1F A;  5FQM A;  1K57 A;  3OZH A;  3NHQ A;  3C5A A;  5HWV A;  5TBM B;  2J80 A;  2VK3 A;  1H3Q A;  4XT2 B;  4LV3 A;  1C3B A;  4MLL A;  1H0M A;  4OQG A;  3ZHH A;  4EW7 A;  1DP8 A;  3ZG8 B;  3T4K A;  4KZ6 A;  4P87 A;  4WEL A;  1K4F A;  2WAD A;  4PPR A;  4R3B A;  2WGI A;  3ZVT A;  1W8Y A;  4BBT A;  4MN5 A;  4LEN A;  3O5Y A;  1ES5 A;  5A92 A;  2VV8 A;  2C5W B;  4E3J A;  3VV4 A;  3O87 A;  3K3C A;  2ZBB A;  1H8Z A;  3M6B A;  1K55 C;  4WYY A;  1YQS A;  3VP2 A;  2RCX A;  5FQJ A;  5E2H A;  1KDW A;  2VGJ A;  2WYX A;  4H6J A;  3FYZ A;  3DAV A;  2L1M A;  2XR0 A;  3QHY A;  2QPN A;  2VZW A;  3JVU A;  5D3O A;  3ZG5 A;  2ZJ9 A;  4QY5 A;  3IBR A;  4BL3 A;  5TGF A;  4PKY A;  4N1H A;  5EEC A;  2JKG A;  1AWI A;  4B9O A;  2PD7 A;  1J3W A;  1XP4 A;  5CX7 A;  2V1A A;  5FAT A;  5FAS A;  4JF4 A;  1TEM A;  2EX8 A;  3CAX A;  2H0T A;  3F1N B;  5FDH A;  4S2N C;  3D4F A;  4I39 A;  1P0Z A;  5F5Y A;  3OCN A;  4GW9 A;  5CGX A;  2FFF B;  4DRT A;  4II7 A;  4Z1W A;  4FSF A;  1O07 A;  3VOL A;  1ES3 A;  4KQQ A;  3A0S A;  4EWF A;  4RX2 A;  4LV1 A;  5LBR A;  1HD8 A;  2PRF A;  1VET B;  5K5B A;  5FAO A;  3GTC A;  2XSS A;  3UE0 A;  4OQI A;  4NXE A;  4LFU A;  3UB8 A;  3VP3 A;  3IQA A;  3HLW A;  2PAV P;  1O7E A;  2EXB A;  3UO9 A;  3KO6 A;  4KZ9 A;  2QWS A;  2Z2M B;  4PM6 A;  3GV9 A;  1Y54 A;  3IXH A;  1LSV A;  2EA9 A;  3NDE A;  2YKF A;  3IH9 A;  4R1G A;  2WUQ A;  2P08 A;  2OLV A;  4L0L A;  4N92 A;  2XRN A;  3V39 A;  2XA7 S;  1YM1 A;  4OOL A;  1OTA A;  4GD6 A;  1VEU B;  1JWP A;  2A24 B;  4QD4 A;  2OWJ A;  1PIO A;  4WZ5 A;  5BOH A;  2C6W B;  2UV0 E;  3WS1 A;  4JXW A;  5G4Z A;  4FOF A;  5EE8 A;  2Y2P A;  3PBS A;  5EOO A;  2K7S A;  2ZQA A;  4KUK A;  1T1B A;  1ZG6 A;  3UDX A;  2WKE A;  3NIA A;  5E2E A;  5U47 A;  4OPZ A;  5L8M A;  1SKO B;  2XF3 A;  2IWC A;  5I94 A;  1BLC A;  2O99 A;  5I5L A;  1LL8 A;  1Y28 A;  3R4K A;  1F98 A;  4P6Z M;  2J3W A;  1OJ5 A;  1KVM A;  4EBN A;  4HY8 A;  1HVB A;  3CPT A;  1W79 A;  2O9B A;  1NZU A;  3N8S A;  1WE4 A;  3A3J A;  3HBR A;  4UHU A;  4Q0H A;  4HI4 A;  3QP4 A;  2PR5 A;  4IUH A;  2WKP A;  2XFT A;  1N9L A;  3NDG A;  2ZOH A;  1MWR A;  1W8Q A;  1YAX A;  2V8C A;  1BLP A;  3T1X A;  4KZ8 A;  4R3J A;  2VA0 A;  5GHX A;  4HNB A;  4PM5 A;  4QB8 A;  3DBA A;  4XXR A;  4S2K A;  5HPI A;  2W3E A;  4DN0 A;  4GZB A;  1G68 A;  4CLC D;  4EV4 A;  1V9Z A;  4PM8 A;  1XJ6 A;  3HVF A;  3T1R A;  2Y2N A;  1VB6 A;  3C4O A;  2O9C A;  4X1M A;  3IF6 A;  3QP8 A;  3S7O A;  4H6J B;  4GB7 A;  4Y0U A;  4C6Y A;  4B4Z A;  4G3K A;  2ZD8 A;  4R70 A;  2Z6D A;  2XLN A;  3KSI A;  2W0N A;  4MBH A;  4EQI A;  3MF0 A;  2XQZ A;  3MS6 A;  4RYE A;  2FH5 A;  4G3V A;  3D72 A;  1PW8 A;  1KE4 A;  1BTL A;  1XJ4 A;  2WKI A;  3WRT A;  1MBL A;  1S67 L;  3S4X A;  3ISG A;  2VEA A;  2HP6 A;  5EV0 A;  2ZLY A;  3S22 A;  3A0R A;  1T1A A;  3MXR A;  4U0T A;  3LR3 A;  2OLU A;  1EWZ A;  5HX9 A;  1GHI A;  1OPX A;  3NJA A;  4XT2 A;  3PAG A;  1H8M A;  5GHZ A;  3PXP A;  4Y2F A;  2XD5 A;  4WEJ A;  4JXG A;  1VHM A;  1PWD A;  3UB5 P;  4BEN A;  1K38 A;  1IYO A;  2ZC6 B;  2J9O A;  1DRM A;  4ZAM A;  3LY3 A;  2EWW A;  3ZQ5 A;  2HDQ A;  1PZP A;  1LHY A;  3AGE A;  1F2K A;  4N1X A;  5IU1 A;  3WS2 A;  2Q9N A;  5EVI C;  3UMD A;  1PWG A;  1JTD A;  5FEG A;  1MWS A;  4GJ4 A;  4LRX C;  4ESP A;  3W4P A;  2P04 A;  2P9V A;  3PBT A;  1FSY A;  4ME4 A;  3WWX A;  1NZO A;  4N9K A;  1KDS A;  4KZ7 A;  1XX2 A;  3HLC A;  1SKF A;  4HJ3 A;  3MFD A;  4ZDX A;  1E25 A;  2GZA A;  4IHQ A;  4EET B;  4IVK A;  4R38 A;  5CEC A;  3L7H A;  3LUQ A;  3C4P A;  1K54 A;  3QP6 A;  2XH9 A;  4DDY A;  4DE1 A;  1W63 M;  1UGU A;  2B95 A;  4HQA A;  1OTB A;  4OPY A;  3TOI A;  3MZF A;  3S1Y A;  3V3S A;  2ZM2 A;  3BLS A;  3ZCZ A;  4DXB A;  3BY9 A;  3M2K A;  4DJ3 A;  4I38 A;  3F1N A;  3IS2 A;  5M19 A;  3BFG A;  1E3U D;  2XA7 M;  3VP1 A;  1YMS A;  4KZ5 A;  3C30 A;  1PYY A;  1NLZ A;  3VFH A;  3EGX C;  4CLC E;  1XGJ A;  3ZYT A;  2J9P A;  1GSX A;  1ZHH B;  1G6O A;  1W63 Q;  4X69 A;  4E3K A;  3WS4 A;  4BD0 A;  3JVV A;  1YT4 A;  2WGV A;  4KZB A;  3SS3 A;  3SOI A;  2Y55 A;  2JKR M;  4OP8 A;  1VET A;  2Y2Q A;  1SDE A;  5GHY A;  4X1L A;  3PBQ A;  3G30 A;  1S1Y A;  3LIF A;  1MC0 A;  4Y0T A;  3A3E A;  1I5Q A;  3QP5 A;  1BYW A;  1P9R A;  1Q2P A;  3UPN A;  2V9A A;  3GQZ A;  3RXW A;  1K0K A;  1K6S A;  3AGD A;  3NBL A;  4RVA A;  1SZV A;  4CJN A;  3UPO A;  4R3A A;  1IEL A;  1FCO A;  5AVF A;  3OPP A;  3IBJ A;  3IWQ A;  4FCF A;  4HIA A;  3MZE A;  1TDL A;  4OQ0 A;  4MDZ A;  4OP5 A;  2PT7 A;  3LFV A;  3VOZ A;  3MFX A;  4DKI A;  2A24 A;  1QME A;  4BD1 A;  2YKH A;  3LI9 A;  2HDU A;  1FCN A;  5L2F A;  3G6O A;  2PD8 A;  4GS9 B;  3LR0 A;  3PR6 A;  3NY4 A;  3MZD A;  4JPM A;  1D06 A;  3FKW A;  1NJ4 A;  2ZMV A;  5CGW A;  4HJ6 A;  4NXF A;  3HLB A;  3UE6 A;  5DFY A;  3VFF A;  1L0E A;  3RFB A;  3LY4 A;  2O9A A;  2V1Z A;  2B02 A;  5FI2 A;  5CHU A;  5A91 A;  4L9F A;  3HJI A;  1HZO A;  3C7U A;  3KYQ A;  4WUJ A;  2WKR A;  5DFX A;  3FV7 A;  1K6R A;  1I2W A;  1PZO A;  1GA9 A;  1M6K A;  2PYR A;  3NOP C;  4M3K A;  3JYI A;  3S7P A;  2WZX A;  3H7W A;  4IED A;  2R78 A;  2DMW A;  1F5M A;  4Y7P A;  1CI9 A;  3LEQ A;  2J3T C;  1TDG A;  4E3I A;  4IVI A;  3CJM A;  2KDK A;  3LR4 A;  2AVX A;  3VSL A;  1S1Z A;  4WZ4 A;  4GD8 A;  2J8Y A;  4I3I A;  4HES A;  1XFQ A;  4BMW A;  3H82 B;  5EM1 A;  3VSK A;  4R4S A;  4LV2 A;  2Q0O A;  1N9B A;  2W3G A;  1VM1 A;  2XD1 A;  2P9V B;  2PHY A;  3BY8 A;  4D60 A;  4IBX A;  4F3L A;  4IJG A;  3TSG A;  2BAS A;  3KSG A;  3SH8 A;  5FSR A;  4CPK A;  5IHV A;  3UN7 A;  3HL9 A;  1XJ2 A;  2HJE A;  5IT5 A;  4ZRR A;  1XGI A;  4B4X A;  3FC7 A;  3VMA A;  4Q8I A;  5KZH A;  2EX9 A;  2A3U A;  3IXB A;  3T4O A;  2XDM A;  3E4Q A;  3OBF A;  1S4R A;  3LYX A;  2IWB A;  2WAE A;  4UQI S;  3NCK A;  4G3W A;  1CEG A;  4XUZ A;  1OTE A;  4NG2 A;  3IS2 B;  3O3V A;  2BG1 A;  5HAP A;  4HH2 A;  4BBV A;  4MCW A;  2H5S A;  5AQA A;  2WAF A;  1BSG A;  1FCM A;  5C5K A;  2BLS A;  1JVJ A;  3G35 A;  4OH0 A;  4NKP A;  4UA7 A;  2G7U A;  4MEZ A;  2E8I A;  2EWV A;  1RCJ A;  1JWV A;  3P7N A;  3DTK A;  5E2F A;  3UPP A;  3T4L A;  3N7W A;  4QPR A;  2VGL M;  5EVI A;  4LRY C;  4JXS A;  5FEF A;  4Q0J A;  5CTM A;  5AJG A;  1NYM A;  1ZKJ A;  2HV1 A;  5CEB A;  2HJ9 C;  2JKT M;  5EFW A;  1YKD A;  3BFE A;  4EER A;  3EQU A;  4EXO A;  2OV5 A;  2JCH A;  3MXQ A;  4LV0 A;  3CUE A;  4FUW A;  3IXG A;  1XXM A;  3W8K A;  4EQ1 A;  1CQA A;  3T4Q A;  1T1C A;  5HD3 A;  3UB9 A;  3B42 A;  3FZC A;  1A0K A;  5J7E A;  5CER A;  4MNR A;  2V0U A;  4KQD A;  4I3A A;  4EES A;  2Z2L B;  2ZM0 A;  4QY6 A;  4OPR A;  3RXX A;  4E04 A;  2WGW B;  2IWD A;  1WA9 A;  3FKV A;  5HAI A;  1LI0 A;  5HL1 A;  3V50 A;  1YLT A;  2HZ5 A;  2I72 A;  4HP9 A;  3LEZ A;  1L3L A;  5DJU A;  3PAE A;  4NXG A;  3IWI A;  2ZOI A;  4AFI A;  1GSW A;  2Y2L A;  5CHM A;  4GCZ A;  2ZC7 A;  1LSX A;  3HUM A;  4KUO A;  1YLJ A;  3QP1 A;  5CED A;  2JKF A;  5DF9 A;  4YNR A;  5HAQ A;  4UEY A;  3UE1 A;  3ZG7 B;  1HLU P;  2RL3 A;  3KSF A;  4HH3 A;  4JGQ A;  4EU0 A;  3H7W B;  4ZJ2 A;  4U0X A;  3QNC A;  5E2G A;  4KZ3 A;  4Y5F A;  3L9K A;  4QJG A;  3KX0 X;  2HDR A;  2R9X A;  1CEF A;  3ITB A;  2UWX A;  4DE2 A;  4HBU A;  4Y0O A;  4E3L A;  2DCF A;  4O7D A;  5EUA A;  3V67 A;  1K57 C;  3GMW A;  1LSW A;  2P74 A;  4DE3 A;  3K2N A;  4JGR A;  3SS4 A;  3U2A A;  2Y2I A;  4ZTK A;  4KZA A;  3I7J A;  2PDR A;  4GN2 A;  3SH7 A;  2EXA A;  5CRF A;  2JE5 A;  1OTD A;  1YMX A;  4OLD A;  1G6A A;  1TS8 A;  5HDD A;  2DNS A;  4YWZ A;  3OPR A;  4F3L B;  4ZBE A;  4BQM A;  1LI9 A;  2P7J A;  2BTF P;  2VV7 A;  4E6W A;  3CLO A;  1KGF A;  4GS9 A;  1L0G A;  1G28 A;  5L07 A;  1ERQ A;  5AQ7 A;  5FQ9 A;  1P97 A;  3EGD C;  3FPW A;  2INW A;  5FA7 A;  1YLZ A;  3NUL A;  4GKU A;  1XFN A;  3OC2 A;  4LGW A;  4HJ4 A;  3ICY A;  4GLQ A;  4GHI B;  2WZZ A;  4P6B A;  1MZU A;  4WLA A;  5CGS A;  2CC1 A;  4BL2 A;  3T4J A;  1HTZ A;  5FI6 A;  1GA0 A;  4EUZ A;  5IS1 A;  3QNB A;  5DTS A;  3E4O A;  1BUL A;  3VP0 A;  5GLA A;  5TFQ A;  5DJT A;  1ERO A;  1KGE A;  2EX6 A;  5DVA A;  2Y8H A;  1S0W A;  2VKS A;  3OCL A;  1ALQ A;  4UQI M;  1ACF A;  5HFO A;  3DWK A;  5TJJ A;  3VOY A;  2V8F A;  5EVL A;  1BLH A;  4GDN A;  4KZ4 A;  5EVI B;  1T19 A;  2I9V A;  1MKM A;  3B3X A;  4WBG A;  1P9W A;  3MKF A;  2PU4 A;  2PYP A;  4K91 A;  5G4Y A;  1D7E A;  1XKZ A;  2H28 A;  1K55 A;  5F82 A;  3H82 A;  2W1R A;  1L0F A;  5DKL A;  5JYP A;  1RGZ A;  3G32 A;  1SDN A;  3TRC A;  3N6I A;  4L9G A;  2GX5 A;  3Q07 A;  3ZNT A;  4EBL A;  1W5D A;  5KSC A;  4NK3 A;  3UNW A;  2B18 A;  3TE8 A;  1BLS A;  2JKR I;  1OT6 A;  1PRQ A;  1SCW A;  4KQR A;  5CHJ A;  4OKP A;  3SZT A;  3S7Q A;  1DY6 A;  3GR2 A;  1DJC A;  3PBO A;  4WF0 A;  4DMZ A;  2PU2 A;  2E8J A;  3GSG A;  3E2K A;  3DTE A;  3HLG A;  4RX3 A;  2M1C A;  2VV6 A;  4S2N A;  5CTN A;  3ZGA B;  1FR6 A;  1U60 A;  4MBF A;  4GNU A;  2Y2J A;  3CI6 A;  3P98 A;  1YSQ A;  2GDN A;  4ZJ1 A;  1BUE A;  4JXV A;  5GLC A;  1GSV A;  3ZDJ A;  3DTM A;  4WN5 A;  1GCE A;  4DDS A;  1H5X A;  4S2J A;  2EFU A;  4DF6 A;  3MSH A;  3NOU C;  1KOU A;  1S4S A;  3F1O B;  2ZM8 A;  3IWO A;  1JTG A;  2KX6 A;  2L4R A;  5AQ9 A;  3T4S A;  1STZ A;  1S66 L;  3MQ0 A;  4BWI A;  5EVE A;  2Q9M A;  3G4P A;  5HZH A;  3N4I A;  4KG5 A;  3CWF A;  1ES4 A;  1WYB A;  3BRM A;  4EEP A;  2DRW A;  4FH4 A;  2VX8 A;  3ZFZ A;  4S2I A;  2WK0 A;  3T1S A;  1KE3 A;  3OPH A;  4HP4 A;  3N8R A;  4E3N A;  3ZVW A;  2EX2 A;  3B33 A;  1NLY A;  1ESI A;  3T1Q B;  4ETZ A;  3LGO A;  4X68 A;  3Q7V A;  4P85 A;  1IFQ A;  2W3D A;  3MQQ A;  4S2P A;  1F9I A;  5FQK A;  3D9Y A;  2ZMA A;  5FAQ A;  2WGW A;  5HAR A;  3Q7Z A;  1QMF A;  4D2O A;  3LI8 A;  3BW6 A;  4ID4 A;  5HPF A;  2HPB A;  1FIL A;  1XJ3 A;  3FG8 A;  4E3O A;  2OAQ 1;  5FI7 A;  3IF6 C;  2QJ5 A;  1L2S A;  4I3J A;  1PWC A;  3B47 A;  2A49 A;  2H0Y A;  1W7F A;  4CLC C;  1TD5 A;  2J7V A;  3A3F A;  3O88 A;  2XK1 A;  4BLM A;  1WYC A;  4MBK A;  1OTI A;  3C2W A;  2ZC3 B;  5F6A A;  4JGO A;  3DW0 A;  2XFS A;  5EM0 A;  3KSH A;  5KSH A;  2FFY A;  1XA1 A;  3VE3 A;  2KOI A;  1RP5 A;  4EEU A;  3MBZ A;  4QHC A;  4B93 A;  4WL9 A;  1PW1 A;  3BFD A;  3Q1F A;  3EWK A;  1DJA A;  2WKQ A;  1X0O A;  1YLP A;  3R7W B;  1JNU A;  3KYZ A;  1PNE A;  5FQQ A;  1IYP A;  3G2Y A;  4PM9 A;  3WS0 A;  3PBN A;  4OOY A;  3MR0 A;  4OON A;  1DP9 A;  5KMW A;  1K56 D;  3KYE A;  1ONG A;  4X55 A;  2W1T B;  4YFM A;  1MPL A;  2D02 A;  5AVE A;  4X25 A;  1YSP A;  2EFX A;  4DJ2 A;  1K56 A;  4NET A;  1ZG4 A;  4PHT A;  3PHY A;  4JF6 A;  3SW1 A;  1T18 A;  3GVB A;  1ZTU A;  3TG9 A;  3N8L A;  1SHV A;  4YIN A;  4EBP A;  2KLI A;  3DTI A;  3PTE A;  4JF5 A;  2M7V A;  5FAP A;  5DF7 A;  2GJ3 A;  1M40 A;  2ZQ9 A;  2JKT I;  4K0W A;  5EPH A;  2Y2M A;  2VGK A;  3W4Q A;  2QMI A;  5TR7 A;  3VP4 A;  1GHP A;  2HP9 A;  2H10 A;  5HSQ A;  4GHI A;  1OJG A;  1FOF A;  1CK3 A;  5GL9 A;  1PI4 A;  1H8Y A;  4OPQ A;  1ZC2 A;  5DF8 A;  4MMN A;  4ETX A;  3UDF A;  3UDI A;  5HW3 A;  4HEF A;  4Y15 A;  4KG2 A;  2Y4A A;  1K54 C;  3UY6 A;  1KE0 A;  5EVI D;  1ES2 A;  3HLF A;  4E6X A;  3D3O A;  4I5S A;  5J8X A;  1FSW A;  4NXB A;  1MKI A;  2QKP A;  2NUP C;  3G2Z A;  2A2L A;  4O8G A;  3CZD A;  1Z6F A;  3E4P A;  4S2O A;  3E0Y A;  4C3Q A;  3BWL A;  4PKY G;  2LB5 A;  3AGF A;  4K08 A;  4Y13 A;  3OOV A;  3G31 A;  4DE0 A;  4GOG A;  2XGN A;  4P0M A;  2QJ7 A;  3IX4 A;  1FR1 A;  3LO7 A;  4ARZ A;  3V5M A;  1Y4O A;  4X53 A;  4FTX A;  5GLD A;  3PBR A;  3IX8 A;  3BYD A;  5HDC A;  2Y2G A;  3Q7V B;  4LCL A;  5F68 A;  1TS6 A;  3LCE A;  4RA7 A;  1FQG A;  2WKH A;  1I2S A;  3C7V A;  4O01 A;  2X71 A;  2M7U A;  4HHD A;  1GHM A;  2Y91 A;  3BEC A;  4JKT A;  4Z9Q A;  3HCY A;  1RGY A;  3HUO A;  2V2F F;  2ACG A;  3OLO A;  4EUV A;  4LLO B;  3NOT C;  2K31 A;  3IXD A;  1NRF A;  5KIZ A;  3FPV A;  2LB9 A;  2QHK A;  4JLF A;  1DJB A;  3GDI A;  4X56 A;  4Y17 A;  4MN6 A;  1BT5 A;  4KEN B;  3DWZ A;  5FDS A;  2W3F A;  1LLB A;  3F1O A;  2PR6 A;  3IT9 A;  5HDS A;  2O0Y A;  1LL9 A;  1IYS A;  3IHB A;  2VLG A;  2K2N A;  4R23 A;  4OQH A;  1L0D A;  2ZL1 A;  3F1P A;  5A90 A;  4S2M A;  4PAU A;  3LIB A;  1LT0 A;  1XA7 A;  4WMC D;  4R4R A;  1TS0 A;  5A8B A;  3NC8 A;  3IX3 A;  3G34 A;  3T12 B;  4N9L A;  4PMA A;  3HRE A;  3ULF A;  5L10 A;  4OVD A;  3V3R A;  3P01 A;  3Q81 A;  4WMC A;  1ERM A;  4L9E A;  3ITA A;  5HL6 A;  2W27 A;  4K0X A;  1MWT A;  3HJK A;  3E98 A;  3HLE A;  3W4O A;  4U3T A;  1Q2Q A;  4NEE D;  5HWW A;  1YLW A;  3S7N A;  2QYB A;  3HUN A;  1N9N A;  4XUX A;  2ZQ7 A;  3W2Z A;  1TS7 A;  2V20 A;  3H9W A;  2Y79 A;  2JHE A;  5DTK A;  5AQB A;  2G2U A;  5CXW A;  4FH2 A;  2OOL A;  3A3D A;  2X01 A;  4KQO A;  4CLC A;  4Y3I A;  3LIC A;  4MN7 A;  1XPB A;  3RH8 B;  1IOU A;  3EEA A;  2HDS A;  3M6H A;  4ZJ3 A;  1VQQ A;  3K3D A;  1YPR A;  3WS5 A;  2X02 A;  1KVL A;  3EEH A;  1BZA A;  2J3T D;  1UWP X;  1ODV A;  4C75 A;  2Z6C A;  1E4D A;  1EI5 A;  1PFL A;  3P09 A;  1NY0 A;  1OME A;  3UE3 A;  5M18 A;  1Z09 A;  3O86 A;  5F1G A;  3QP2 A;  2Y59 A;  1CJF A;  5J3W A;  1J9M A;  4UA9 A;  4O0P A;  1ONH A;  3BFC A;  3R7W A;  5TBM A;  3MQO A;  2HF6 A;  1YLY A;  3LIA A;  4KG6 A;  5L09 A;  2V0W A;  1JWZ A;  2OSU A;  3MMH A;  3CG5 A;  2XEP A;  4YOF A;  2Y2H A;  2HP5 A;  4HOI A;  3T50 A;  5J4E A;  4E3M A;  2W1T A;  4LPZ A;  1N9O A;  3ZNY A;  1AXB A;  3BFF A;  4ARZ B;  3LID A;  2XRO A;  5DTT A;  2W3H A;  3C38 A;  4CQH A;  4OOM A;  4A5R A;  2NUT C;  1IEM A;  3T4T A;  3PYP A;  5HWT A;  4X6T A;  2ZMF A;  2OWH A;  1TF1 A;  4F94 A;  5EOE A;  2R9W A;  1S6R A;  5G18 A;  1V9Y A;  2VJW A;  2JBF A;  3CUE C;  3Q82 A;  3RTY A;  4BJP A;  4UA6 A;  3A3I A;  3IHA A;  4DXC A;  1NWZ A;  3CMZ A;  1N4O A;  5A93 A;  5DKK A;  5JYO A;  2JC7 A;  3BQA A;  1MWU A;  1D1J A;  3M2J A;  1EW0 A;  2ZQ8 A;  4WEK A;  3NEC A;  4QWO A;  4IUK A;  3CHW P;  4R6L A;  4WZ5 C;  2D01 A;  3CIT A;  3FWL A;  4BBU A;  4UAA A;  2VGL S;  1G5U A;  3JPU A;  1IYQ A;  3WRZ A;  3UME A;  3VE4 A;  2ZL1 B;  4RQ9 A;  3F1P B;  3UB6 A;  3HLD A;  1FIK A;  1PI5 A;  2Y2O A;  1IKG A;  2B5R A;  3EQV A;  1NXY A;  4QU3 A;  3BLM A;  4S2L A;  3C8C A;  3MJQ A;  1E3U A;  4JGP A;  1CI8 A;  4Q0I A;  1UWN X;  1MXO A;  2L0W A;  5GLB A;  5F83 A;  5MC7 A;  3BQ8 A;  1K4E A;  3CPT B;  3OPL A;  3UB7 A;  3SH9 A;  2PBD P;  2CMN A;  4M4X A;  1LL5 A;  3BM6 A;  1MY8 A;  4HBT A;  1NYY A;  1CF0 A;  3EOI A;  4R0Q A;  3U4L P;  2FZ0 A;  3MXS A;  3BJN A;  5F69 A;  2ZQD A;  4LRZ E;  3TW8 A;  2ZQC A;  4IBR A;  3ZG0 A;  3TJZ C;  4WM9 A;  3ZG9 B;  4LCM A;  2OAP 1;  3A0V A;  4JBF A;  2HGV A;  5FL3 A;  5E43 A;  3E2L A;  3IH8 A;  3LIE A;  3GEC A;  1NRJ A; 
#chains in the Genus database with same CATH homology
 4UEY A;  3ZQ5 A;  1OJG A;  3KSF A;  4HH3 A;  4JGQ A;  5IU1 A;  4EU0 A;  3UMD A;  3H7W B;  3LR5 A;  4MMN A;  2V1B A;  4ETX A;  4CLC B;  2GNX A;  4GJ4 A;  4Y5F A;  3KX0 X;  4P6Z S;  4LRX C;  2P04 A;  3PBT A;  2JN7 A;  3V67 A;  4ME4 A;  1LSW A;  3K2N A;  4JGR A;  3U2A A;  3D3O A;  4I5S A;  4NXB A;  2PDR A;  1OT9 A;  2QKP A;  2NUP C;  4HJ3 A;  2A2L A;  5HD5 A;  4O8G A;  2GZA A;  4IHQ A;  4EET B;  4R38 A;  2IA2 A;  3E4P A;  2MJ6 A;  3LUQ A;  1OTD A;  3E0Y A;  1DP6 A;  1TS8 A;  5HDD A;  3BWL A;  4YWZ A;  4PKY G;  2LB5 A;  1W63 M;  4K08 A;  1UGU A;  4HQA A;  3NHQ A;  1OTB A;  4F3L B;  3OOV A;  2QJ7 A;  5HWV A;  5TBM B;  2P7J A;  2J80 A;  1H3Q A;  4XT2 B;  3BY9 A;  4DJ3 A;  4ARZ A;  2VV7 A;  3F1N A;  3IS2 A;  4I38 A;  3CLO A;  4GS9 A;  1G28 A;  4EW7 A;  1DP8 A;  3T4K A;  1P97 A;  2XA7 M;  3PBR A;  3EGD C;  3FPW A;  5HDC A;  2INW A;  4WEL A;  3C30 A;  1XFN A;  3OC2 A;  1NLZ A;  3EGX C;  4CLC E;  3ZYT A;  4HJ4 A;  1GSX A;  1ZHH B;  1G6O A;  1W63 Q;  3ICY A;  4GLQ A;  1TS6 A;  4GHI B;  5F68 A;  4BBT A;  4MN5 A;  3O5Y A;  3JVV A;  1MZU A;  4WLA A;  4O01 A;  3T4J A;  2M7U A;  4HHD A;  5IS1 A;  2JKR M;  2VV8 A;  3E4O A;  3HCY A;  3VV4 A;  3K3C A;  2ZBB A;  3OLO A;  4EUV A;  3PBQ A;  4LLO B;  5DJT A;  3NOT C;  1S1Y A;  2K31 A;  3LIF A;  1MC0 A;  2Y8H A;  5KIZ A;  2VKS A;  3FPV A;  2LB9 A;  4H6J A;  2QHK A;  3GDI A;  3OCL A;  2L1M A;  4MN6 A;  4UQI M;  1BYW A;  1P9R A;  5TJJ A;  2W3F A;  2V9A A;  3F1O A;  2VZW A;  1T19 A;  2I9V A;  1MKM A;  2PR6 A;  3JVU A;  5HDS A;  2O0Y A;  4R3A A;  1P9W A;  2VLG A;  2PYP A;  2K2N A;  3IBR A;  5G4Y A;  5AVF A;  1D7E A;  2H28 A;  3IBJ A;  3F1P A;  4PKY A;  3H82 A;  4HIA A;  2W1R A;  5DKL A;  4MDZ A;  4PAU A;  4B9O A;  2PD7 A;  3LIB A;  1LT0 A;  2PT7 A;  3LFV A;  3MFX A;  1TS0 A;  5CX7 A;  5A8B A;  3TRC A;  2A24 A;  2V1A A;  4L9G A;  2GX5 A;  2YKH A;  3LI9 A;  3CAX A;  3ULF A;  3F1N B;  3G6O A;  3P01 A;  2B18 A;  2PD8 A;  3TE8 A;  4GS9 B;  4I39 A;  1P0Z A;  5F5Y A;  3LR0 A;  3PR6 A;  2JKR I;  4L9E A;  3OCN A;  5HL6 A;  1OT6 A;  2W27 A;  1D06 A;  2ZMV A;  4HJ6 A;  4NXF A;  4GW9 A;  3HJK A;  3UE6 A;  3E98 A;  5DFY A;  4II7 A;  3S7Q A;  4Z1W A;  4FSF A;  3RFB A;  2O9A A;  3PBO A;  4WF0 A;  3VOL A;  4DMZ A;  2B02 A;  3A0S A;  4NEE D;  5HWW A;  4L9F A;  3HJI A;  3S7N A;  2QYB A;  3KYQ A;  2M1C A;  2WKR A;  4WUJ A;  5LBR A;  1N9N A;  2VV6 A;  5DFX A;  3W2Z A;  1TS7 A;  5K5B A;  2XSS A;  3H9W A;  2Y79 A;  2JHE A;  3CI6 A;  4NXE A;  1YSQ A;  2PYR A;  3NOP C;  3S7P A;  2OOL A;  3UB8 A;  3H7W A;  2R78 A;  1GSV A;  4KQO A;  2DMW A;  1F5M A;  4CLC A;  4Y3I A;  3LIC A;  4WN5 A;  4MN7 A;  2J3T C;  3KO6 A;  3RH8 B;  1IOU A;  3EEA A;  2QWS A;  2KDK A;  3NOU C;  3LR4 A;  3K3D A;  1KOU A;  1S1Z A;  1S4S A;  3F1O B;  2KX6 A;  2L4R A;  1LSV A;  3EEH A;  2EA9 A;  2J3T D;  4I3I A;  2YKF A;  3T4S A;  1UWP X;  1ODV A;  1STZ A;  1XFQ A;  4BMW A;  2P08 A;  2Z6C A;  3H82 B;  1S66 L;  3MQ0 A;  4BWI A;  4L0L A;  2XRN A;  4GHI A;  2XA7 S;  3UE3 A;  2W3G A;  5HZH A;  4OOL A;  1OTA A;  2A24 B;  2OWJ A;  3CWF A;  2PHY A;  5J3W A;  3BY8 A;  4EEP A;  4O0P A;  4F3L A;  2VX8 A;  5G4Z A;  4FOF A;  4IJG A;  3R7W A;  3PBS A;  2K7S A;  3MQO A;  2HF6 A;  5TBM A;  3LIA A;  4KUK A;  2BAS A;  1T1B A;  3KSG A;  4HP4 A;  2EWW A;  2V0W A;  3MMH A;  4YOF A;  1XJ2 A;  2HJE A;  5IT5 A;  3B33 A;  5L8M A;  4ZRR A;  1NLY A;  3FC7 A;  2O99 A;  3T4O A;  5I5L A;  1LL8 A;  1Y28 A;  4HOI A;  4ETZ A;  3R4K A;  1F98 A;  3E4Q A;  4P6Z M;  3T50 A;  5J4E A;  2W1T A;  3OBF A;  2J3W A;  4LPZ A;  1OJ5 A;  1N9O A;  1S4R A;  3LYX A;  1IFQ A;  4UQI S;  2W3D A;  3MQQ A;  4HY8 A;  1F9I A;  4G3W A;  1OTE A;  2O9B A;  4ARZ B;  3IS2 B;  3LID A;  3LI8 A;  2XRO A;  4Q0H A;  3BW6 A;  4HI4 A;  5HPF A;  4HH2 A;  4BBV A;  4MCW A;  1XJ3 A;  2PR5 A;  2W3H A;  4IUH A;  3C38 A;  4CQH A;  2WKP A;  4OOM A;  5C5K A;  1N9L A;  4NKP A;  3FG8 A;  2OAQ 1;  2QJ5 A;  2G7U A;  2NUT C;  2ZOH A;  4I3J A;  3T4T A;  3PYP A;  1YAX A;  3B47 A;  5HWT A;  2EWV A;  2ZMF A;  4CLC C;  2OWH A;  2VA0 A;  1TD5 A;  1TF1 A;  4HNB A;  3P7N A;  1OTI A;  3C2W A;  3T4L A;  3DBA A;  1V9Y A;  2VJW A;  5F6A A;  2W3E A;  5HPI A;  4JGO A;  4DN0 A;  4QPR A;  3CUE C;  3RTY A;  2VGL M;  3KSH A;  4CLC D;  5KSH A;  4LRY C;  4BJP A;  3VE3 A;  2KOI A;  1V9Z A;  4Q0J A;  5AJG A;  1XJ6 A;  4EEU A;  1NWZ A;  4B93 A;  2HV1 A;  5DKK A;  1VB6 A;  2O9C A;  4WL9 A;  3BQA A;  2HJ9 C;  2JKT M;  5EFW A;  1YKD A;  3S7O A;  1EW0 A;  4H6J B;  4EER A;  5HSQ A;  3EWK A;  4WEK A;  3EQU A;  4EXO A;  2WKQ A;  1X0O A;  4G3K A;  4IUK A;  4R6L A;  3R7W B;  4R70 A;  1JNU A;  3KYZ A;  2Z6D A;  3KSI A;  2W0N A;  2D01 A;  3MXQ A;  3CIT A;  3CUE A;  4BBU A;  2VGL S;  3MF0 A;  3PBN A;  4EQ1 A;  2FH5 A;  4G3V A;  3T4Q A;  3UME A;  3MR0 A;  1T1C A;  3D72 A;  5HD3 A;  3UB9 A;  3VE4 A;  1DP9 A;  4RQ9 A;  3F1P B;  3UB6 A;  3B42 A;  5J7E A;  1XJ4 A;  2W1T B;  3EQV A;  1S67 L;  2V0U A;  4I3A A;  4KQD A;  4EES A;  2D02 A;  3C8C A;  3MJQ A;  4JGP A;  5AVE A;  2VEA A;  4Q0I A;  1UWN X;  1YSP A;  2L0W A;  3A0R A;  4DJ2 A;  5MC7 A;  1T1A A;  3BQ8 A;  4PHT A;  3PHY A;  4E04 A;  3UB7 A;  3SW1 A;  1T18 A;  2CMN A;  3LR3 A;  1ZTU A;  1WA9 A;  4M4X A;  4HP9 A;  1OPX A;  2KLI A;  3NJA A;  5DJU A;  4XT2 A;  1H8M A;  2M7V A;  3EOI A;  2FZ0 A;  4NXG A;  3BJN A;  5F69 A;  2ZOI A;  4AFI A;  1GSW A;  4GCZ A;  3PXP A;  4Y2F A;  4LRZ E;  2GJ3 A;  4WEJ A;  3TW8 A;  1LSX A;  2JKT I;  4KUO A;  1VHM A;  3TJZ C;  2OAP 1;  3A0V A;  2HGV A;  5FL3 A;  1DRM A;  3LIE A;  5DF9 A;  4YNR A;  3GEC A;  1NRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...