4NETA

Crystal structure of adc-1 beta-lactamase
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
359
structure length
357
Chain Sequence
b'NTPKDQEIKKLVDQNFKPLLEKYDVPGMAVGVIQNNKKYEMYYGLQSVQDKKAVNSSTIFELGSVSKLFTATAGGYAKNKGKISFDDTPGKYWKELKNTPIDQVNLLQLATYTSGNLALQFPDEVKTDQQVLTFFKDWKPKNSIGEYRQYSNPSIGLFGKVVALSMNKPFDQVLEKTIFPALGLKHSYVNVPKTQMQNYAFGYNQENQPIRVNPGPLGAPAYGVKSTLPDMLSFIHANLNPQKYPADIQRAINETHQGRYQVNTMYQALGWEEFSYPATLQTLLDSNSEQIVMKPNKVTAISKEPSVKMYHKTGNRFGTYVVFIPKENIGLVMLTNKRIPNEERIKAAYAVLNAIKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AmpC
publication title Structure of the extended-spectrum class C beta-lactamase ADC-1 from Acinetobacter baumannii.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
total genus 124
structure length 357
sequence length 359
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4netA00
1YQSA 4N9KA 4KZAA 5D3OA 3MBZA 5F1GA 5CERA 1RCJA 2Y2NA 4H8RA 4OQIA 1Q2PA 5FI2A 4EV4A 3S1YA 3IWQA 4K0XA 3NIAA 2OV5A 1ES4A 2EX9A 2H5SA 4Y0TA 1DY6A 4LV0A 3UO9A 1EROA 3FWLA 1YLJA 4JBFA 4PM7A 4DDSA 4EQIA 1ESUA 1K4EA 2WKEA 3G34A 3MKFA 2EX6A 3V5MA 4DE3A 3EQVA 4N1HA 3BM6A 5JYPA 3PBRA 4XUXA 1GHIA 5CEBA 3N8SA 2A3UA 1NYMA 3QHYA 3N4IA 4U0TA 2XK1A 2ZQ7A 5J8XA 3VP4A 3WWXA 4S2KA 1GA0A 4KG2A 1ES5A 3VMAA 3SOIA 4B4ZA 4BENA 1W79A 1BLPA 3M2JA 5F82A 1DJCA 3PBNA 4BD1A 1I2SA 2Y2MA 5FI7A 4JF4A 3RXXA 4PPRA 4OP5A 2XEPA 3FV7A 3G35A 4KZ9A 2XLNA 4KQQA 3DW0A 5I94A 5DVAA 1ONGA 2C5WB 2JCHA 4GN2A 4UA9A 3NCKA 4MBFA 4KZ7A 3TSGA 1K38A 5KZHA 3BFEA 3PAEA 4QB8A 3OCNA 4GOGA 1XGJA 1MWUA 3NC8A 2A49A 3MXRA 1BSGA 1MY8A 1PYYA 4CJNA 1PI5A 5HL1A 1JTDA 3D4FA 3IHAA 5A91A 3OPPA 5FSRA 4BL2A 3C4OA 4UAAA 1FCMA 1K25A 4X55A 4DE1A 4LV1A 4ZDXA 1L0EA 3A3JA 4OKPA 3P09A 3C7VA 3ISGA 4IBXA 1NJ4A 1FSYA 2Y91A 4HBUA 4S2NA 4WZ5A 5AQBA 4A5RA 5EOEA 4FH4A 4HBTA 3HLFA 3Q82A 4OLDA 3IXDA 4U0XA 2PBYA 2Y4AA 5DTSA 5AQ9A 3SS5A 3V3SA 3Q81A 2Y2OA 1BT5A 1ZG6A 2XFSA 2RL3A 2ZLYA 3IXBA 1JVJA 4GD6A 4O7DA 4R1GA 1LL5A 1U60A 3NDGA 1MWTA 4MNRA 5CXWA 1BZAA 4NETA 3CJMA 4C6YA 5GLDA 4BQMA 2ZD8A 4S2OA 4PM9A 2WGWB 3LEZA 1PIOA 1IEMA 1BLSA 4X53A 5HARA 4ZJ1A 1K57A 1L2SA 4E3OA 5JYOA 3WS5A 3DWKA 2IWDA 5EVIA 4Q8IA 3W8KA 1N4OA 4GNUA 4IVIA 3BFFA 4KQOA 1BTLA 4JLFA 1L0DA 1H8YA 3BLMA 4OQHA 2J8YA 4UA7A 4N1XA 4DE0A 4F94A 3TG9A 4DE2A 3VP2A 3E2KA 4E3NA 3SH9A 2X02A 2EXBA 1FR1A 2P9VA 3AGDA 3P98A 4OPZA 1K4FA 1FR6A 3MZEA 4X69A 3W4OA 3PBOA 1LI0A 2WUQA 3WS1A 1KGGA 3LY4A 3ZG8B 5CHMA 4R0QA 1XPBA 3BYDA 3LO7A 3V50A 2CC1A 4DRTA 1ALQA 1CI9A 3NBLA 4FD8A 5FI6A 4L0LA 1RP5A 3OZHA 2XD5A 1W8QA 3S4XA 4Y0UA 4RVAA 3V39A 3ZG9B 4DXCA 2J9PA 2Y2PA 4ID4A 4S2NC 4WZ5C 4X56A 5HAIA 3WRTA 5GL9A 3LY3A 1NZUA 4OOYA 4JXWA 1LL9A 2QMIA 4OH0A 4R4SA 1YLTA 4S2LA 1PZOA 2J9OA 3BRMA 3BLSA 1TEMA 3IT9A 2J7VA 2RCXA 4R3JA 2V1ZA 4BJPA 3JYIA 1K6SA 3AGEA 5EVID 3DWZA 5E2GA 4S2PA 1CK3A 3QNBA 2OSUA 3G2ZA 4KZ8A 4R23A 3N8LA 4JXSA 2BLSA 4C75A 1WYBA 2OLUA 3LCEA 3SH8A 3EQUA 1K57C 3IXHA 4ZAMA 3OPLA 5EVIC 1I5QA 4OOMA 2Z2LB 4UA6A 3GMWA 5CGXA 1SKFA 4U3TA 1XP4A 2WYXA 3C5AA 1HD8A 4P85A 4LENA 3TOIA 4OOLA 3GTCA 2XFTA 1SCWA 5G18A 5FQIA 5HAPA 1E25A 2Y2KA 2HP9A 4OP8A 2Y2JA 2WADA 1MWSA 5DF9A 3VP1A 1XX2A 5GLBA 3UDFA 4JF6A 3ZHHA 2ZQ9A 5EPHA 3WS0A 4EBNA 1J9MA 4FCFA 4XUZA 1S6RA 3ZFZA 4OVDA 2DRWA 3CMZA 1TVFA 2Z2MB 3Q07A 2HDRA 5TFQA 1W7FA 3IF6C 4DXBA 4OQGA 3VOYA 1JWPA 4EUZA 2E8IA 1NZOA 3Q7VA 4KQRA 1ERMA 5CGWA 3IQAA 3WS4A 5GHZA 1ES3A 4E3LA 3O87A 3O3VA 4WBGA 1KVLA 1GHPA 2ZC4B 3UPOA 2HDSA 4FSFA 4HESA 3GR2A 2H0YA 3N8RA 3CG5A 3A3FA 2G2UA 2JC7A 4E6XA 3GRJA 4N9LA 4UHUA 1OMEA 2XF3A 1XXMA 2V20A 2WAFA 4DF6A 5KSHA 2HPBA 1EWZA 5TGFA 4QHCA 1RGYA 1KDSA 4EBLA 5EUAA 3SH7A 3ITAA 4BLMA 1W5DA 5DTKA 3GV9A 4KZ4A 2WZZA 3FZCA 4CPKA 4PM8A 4PM5A 2EFUA 2ZQAA 3MXSA 2V2FF 5CRFA 1S0WA 2Q9NA 2EX8A 1PW8A 3WRZA 1ZC2A 2VGKA 1LI9A 2Y2QA 1G68A 2P74A 1K55A 2WK0A 3UE0A 1O7EA 2X71A 3IH9A 4WELA 4X6TA 4GKUA 3M6HA 2Y2IA 1AXBA 4RX3A 1KE0A 4GDBA 4K0WA 3A3EA 1YLYA 3W4PA 5GLAA 3MFDA 2C6WB 1MBLA 2WAEA 4LCMA 3OCLA 5FAOA 2Q9MA 4WM9A 3VSLA 3UDXA 3HUOA 3N7WA 4N92A 5M19A 4WMCA 4NK3A 4P87A 4OPQA 3SS3A 1WE4A 2UWXA 2P9VB 2DCFA 2WKIA 5HFOA 5A92A 4LV2A 5HW3A 1KVMA 3PBSA 2XH9A 5FDHA 4PMAA 2HDUA 1NRFA 1SHVA 4JXVA 2HDQA 3VP3A 1JWZA 3A3IA 3IF6A 2DNSA 4GZBA 1GCEA 4QU3A 4EBPA 3PBTA 1IKIA 2X01A 3B3XA 4JKTA 1CI8A 5GHXA 3FKWA 1BUEA 4E3MA 3N6IA 2WGIA 1M40A 1PWGA 2EXAA 3IH8A 4RX2A 2FFFB 1PW1A 4JXGA 4C3QA 4E3KA 3CZDA 4JPMA 1FSWA 1Z6FA 4Y7PA 2IWBA 2QPNA 3MZDA 1L0GA 4M3KA 5FAPA 3VP0A 1YM1A 3W4QA 1PZPA 4ZJ3A 1HZOA 1YLWA 3PAGA 5IHVA 1NY0A 3IWOA 3HLCA 2ZMAA 3BFGA 4QJGA 3HLGA 3V3RA 4ZJ2A 3VFHA 5M18A 3G30A 3UN7A 1NXYA 2XD1A 4KZ6A 1K55C 1NYYA 4X68A 1K56A 4WEKA 1M6KA 1Q2QA 3ZG7B 3ZDJA 2Y2GA 4IBRA 4WMCD 4ZBEA 3BFDA 4K91A 5GHYA 5CGSA 5FQMA 1IELA 1IYQA 1VQQA 5KSCA 2HP6A 1E3UD 1CEGA 1HTZA 2ZQCA 3PTEA 3ZG0A 5CTNA 1WYCA 3G31A 3O88A 4B88A 1E4DA 1YMXA 3HLBA 1W8YA 3G4PA 3C7UA 4BL3A 3ZNYA 1CEFA 2ZC5B 5FAQA 2ZJ9A 5AQAA 5L2FA 4B4XA 1PWDA 4JF5A 3ZVTA 4KZBA 4YFMA 4MBHA 2G2WA 2EFXA 5HX9A 2H0TA 3NDEA 3UPNA 4GDNA 1YLPA 4WYYA 5EOOA 2JE5A 1Y54A 1MPLA 2I72A 1RGZA 4OQ0A 3RJUA 5E2HA 5BOHA 2B5RA 4YINA 2H10A 5E43A 3IF5A 2WZXA 4R4RA 1QMFA 1YLZA 4KG6A 2OLVA 5FQKA 3FKVA 3UY6A 4DKIA 1KE4A 2Y59A 1FCOA 4MLLA 4S2JA 5CEDA 2PU2A 3FYZA 3HUMA 3DTMA 3BECA 2QZ6A 3A3DA 1TDGA 3I7JA 3Q7VB 2ZM0A 3IXGA 3O86A 1K56D 4RA7A 4S2IA 4WZ4A 3S22A 3M6BA 3UPPA 1TDLA 1EI5A 1LHYA 3RXWA 4Y0OA 3GSGA 4OLGA 1LLBA 3IHBA 3Q7ZA 4WEJA 3UE3A 2GDNA 3GVBA 4BD0A 1BLCA 1IYPA 2XGNA 4KG5A 4OPRA 3IWIA 4P0MA 3G2YA 1I2WA 3MZFA 2HP5A 2Y55A 1XA1A 1H8ZA 1DJBA 4P6BA 4KENB 1MKIA 1DJAA 1N9BA 4LV3A 4QD4A 3UNWA 4QY5A 1XA7A 1VM1A 3HLEA 5M1AA 1O07A 4E6WA 2ZQ8A 3ZCZA 1XGIA 1KDWA 4IVKA 5FATA 1K54A 1ES2A 3BFCA 1MXOA 2ZM2A 3GQZA 2JBFA 1GA9A 2WGWA 2XQZA 4R3BA 4XXRA 5FQQA 3M2KA 1MWRA 5E2FA 1BLHA 5FASA 1KE3A 2ZM8A 5CECA 5EE8A 5EVLA 4DDYA 4QY6A 5EVIB 4S2MA 3WS2A 5FQJA 3HUNA 3VSKA 3MKEA 4OPYA 5FQ9A 3NI9A 3ZGAB 2Y2LA 2XR0A 3HLWA 1KGFA 3E2LA 5CHJA 4ZTKA 4D2OA 1ESIA 1C3BA 4GB7A 3OPHA 4OONA 1GHMA 2WKHA 4LCLA 5F1FA 1ZKJA 1H5XA 1E3UA 1FOFA 2ZC3B 5GLCA 1PWCA 4HEFA 3NY4A 5CTMA 5KMWA 2R9WA 5AQ7A 3HREA 3Q1FA 2PU4A 4Z9QA 3C4PA 3UDIA 5DF7A 1K6RA 1FCNA 1YMSA 5EECA 1JTGA 3HVFA 2R9XA 1IYOA 2ZC7A 4KZ5A 1G6AA 1L0FA 2Y2HA 5E2EA 4PM6A 1ZG4A 1XKZA 2WGVA 3SS4A 1PI4A 1ERQA 3HBRA 3PBQA 3IF6B 4FH2A 2VGJA 1BULA 5U47A 2BG1A 2EX2A 3AGFA 3VOZA 4RYEA 1JWVA 4E3JA 5TR7A 5HAQA 3ZNTA 3ZG5A 2FFYA 4KZ3A 5CHUA 5DF8A 3ZVWA 1FQGA 1KGEA 3UE1A 3BEBA 3HL9A 1HVBA 1SDEA 1SDNA 2ZQDA 5A93A 3VFFA 5A90A 3ITBA 3OC2A 1ONHA 3OPRA 3QNCA 1QMEA 2ZC6B 2IWCA 2XDMA 3HLDA 5FA7A 1K54C 4MBKA 1IKGA 4IEDA 4E3IA 1YT4A 5DTTA 3G32A 4GD8A 5F83A 4EWFA 1IYSA 4MEZA
chains in the Genus database with same CATH superfamily
2O9BA 2W3GA 3MBZA 4EQ1A 4H8RA 3S1YA 3NIAA 5DKKA 1DY6A 3G6OA 3FWLA 4PM7A 4WLAA 3F1OB 2EX6A 4N1HA 3BM6A 4GS9A 1GHIA 3MJQA 3QHYA 3MXQA 5J8XA 4S2KA 1ES5A 3VMAA 3SOIA 2A24B 4BENA 3MQQA 1I2SA 2Y2MA 1GSWA 4PPRA 4OP5A 2KDKA 2XLNA 2OAP1 4BBVA 1ONGA 2C5WB 2ZMFA 3NCKA 4MBFA 4KZ7A 1K38A 3BFEA 3PXPA 3DTKA 3OPPA 1DP9A 3H82B 3ICYA 1K25A 4ZDXA 3CAXA 3A3JA 4OKPA 5EOEA 4FH4A 3W4PA 3HLFA 4U0XA 3LR3A 5AQ9A 2Y2OA 1BT5A 4WN5A 2ZLYA 3IXBA 2M7UA 1JVJA 4GD6A 4O7DA 4R1GA 1MWTA 3CJMA 2QJ5A 4BQMA 2ZD8A 4PM9A 2WGWB 1XJ4A 1PIOA 4E3OA 3VE4A 1L2SA 3WS5A 4HH2A 5EVIA 3W8KA 4IVIA 3BFFA 1BTLA 1OTDA 2OOLA 4DE2A 3E2KA 2B95A 3SH9A 2P9VA 1FR1A 5C5KA 4OPZA 4RQ9A 5FL3A 1A0KA 1LI0A 3JVVA 2WUQA 3ZG8B 3MFXA 4Y13A 3CPTA 1ALQA 3UMDA 1W8QA 3CUEA 3LIFA 4Y0UA 4HJ3A 1P9WA 3V39A 2J9PA 2Y2PA 3T4TA 4S2NC 4MDZA 4X56A 5HDSA 2YKHA 3T4OA 5GL9A 1NZUA 2AVXA 1YLTA 1G28A 2V1ZA 3JYIA 5E2GA 3VOLA 2OSUA 4GJ4A 3IX8A 2W1RA 1LL8A 5AJGA 4C75A 3MF0A 3LCEA 1S66L 4FTXA 1I5QA 4OOMA 5CX7A 2Z2LB 5KIZA 4E04A 4UA6A 3T12B 3UB9A 1XP4A 4ETXA 2DMWA 3TOIA 2XFTA 3DTEA 5HAPA 4H6JB 2Y2JA 2WADA 3LICA 4ARZB 3ZHHA 2ZQ9A 3WS0A 4XUZA 5K5BA 3ZFZA 4OVDA 1TVFA 3Q07A 4XT2B 2ZL1A 2V1AA 3IF6C 3VOYA 1NZOA 1XFNA 4LGWA 2R78A 2VLGA 2V8FA 3KSGA 3C2WA 4Y2FA 1UGUA 3A3FA 2G2UA 3GRJA 3H82A 4N9LA 4GW9A 2XF3A 4QHCA 2J3TC 3UB8A 1KDSA 4EBLA 5EUAA 1W5DA 1VETB 5DTKA 3GV9A 3LGOA 2WZZA 2ZBBA 1P0ZA 4PM5A 2V2FF 1S0WA 2Q9NA 1K55A 2WK0A 3UE0A 2X71A 2EA9A 1STZA 3M6HA 4MN6A 1AXBA 1YLYA 3CITA 3A0VA 4LCMA 3OCLA 2Q9MA 2PBDP 2JN7A 2JKTI 2UWXA 2WKIA 5A92A 4CLCE 2VEAA 1OTAA 2HDQA 3MSHA 2DNSA 3PBTA 3B3XA 4JKTA 5HSQA 1LSXA 1BUEA 1M40A 1PWGA 2FFFB 3CZDA 2IWBA 4Y7PA 1L0GA 3NULA 3VP0A 1YM1A 1DRMA 1PZPA 3T50A 1NY0A 4HY8A 1VEUB 3G30A 1NXYA 2XRNA 4KZ6A 4WMCD 3FG8A 4ZBEA 4G3WA 1T1BA 5FQMA 1IYQA 1VQQA 5KSCA 1E3UD 1WA9A 3PTEA 4JGQA 2XA7M 3DTIA 4B88A 4BL3A 4PAUA 3E4OA 5FAQA 2ZJ9A 4HJ6A 1PWDA 3T4QA 2FH5A 5HD5A 2MJ6A 1YLPA 3JVUA 3MR0A 1MPLA 3RJUA 5BOHA 2B5RA 1AWIA 5E43A 4XT2A 3IF5A 2P04A 1QMFA 2OLVA 4DKIA 3UY6A 2Y59A 4MLLA 2PU2A 3HUMA 4BBTA 3I7JA 2ZM0A 4HP4A 1K56D 4S2IA 3UPPA 4IJGA 5F6AA 1LHYA 3RXWA 3IHBA 1VHMA 3VE3A 2H28A 5F5YA 1XA1A 5L10A 3F1NB 1MKIA 4LV3A 4QY5A 1O07A 5FATA 1KDWA 3BFCA 2JBFA 3M2KA 1MWRA 5E2FA 5FASA 4PHTA 2ZM8A 5CECA 5FQJA 3MKEA 4OPYA 1D06A 5CHJA 3E2LA 1TS7A 1ESIA 1C3BA 5L09A 2W3EA 2EWVA 1ZKJA 4EUVA 1H5XA 1PWCA 5KMWA 4Z9QA 3C4PA 3KO6A 1FCNA 5EECA 2ZC7A 4KZ5A 2Y2HA 4PM6A 1ZG4A 2WGVA 3SS4A 1XJ3A 3BWLA 3EEHA 3AGFA 4Q0JA 4RYEA 1JWVA 5TR7A 4DJ2A 1FQGA 2UV0E 3OC2A 3QNCA 2XDMA 5DFYA 4MBKA 3DBAA 4IEDA 5IU1A 1VEUA 1Y28A 3OBFA 1IYSA 4MEZA 1YQSA 2QJ7A 4I38A 5F1GA 5G4YA 4EV4A 5FI2A 2OV5A 4K0XA 1ES4A 1EROA 4DDSA 4EQIA 3G34A 2W3DA 3PBRA 4XUXA 2A3UA 2PYPA 2O9CA 3C30A 3BQAA 4LLOB 1GA0A 5FDSA 1W63Q 3EGXC 4O8GA 5F82A 1DJCA 3PBNA 5FI7A 2D02A 3RXXA 2VJWA 2XEPA 3UMEA 3T1SA 4KZ9A 4MMNA 3GDIA 5I94A 1NLYA 5KZHA 3CUEC 4NXFA 4QB8A 3NC8A 3MXRA 1BSGA 1MY8A 4CJNA 1PI5A 1JTDA 2W0NA 2B18A 5J7EA 4DE1A 2PAVP 3L7HA 3P09A 4IBXA 1VB6A 3QP4A 3TRCA 4A5RA 2Y91A 4WZ5A 5AQBA 4IHQA 4HBTA 4OLDA 1IOUA 2PBYA 5DTSA 3SS5A 3LR0A 3Q81A 1PRQA 4FOFA 1FILA 3LIDA 5HD3A 1ODVA 1LL5A 1U60A 4UQIM 1TS0A 1ACFA 4I3JA 4NETA 4C6YA 2PD7A 1TF1A 4S2OA 2FZ0A 1IEMA 5HARA 1K57A 5JYOA 3RTYA 4GNUA 1H8YA 4OQHA 2J8YA 4DE0A 2Q0OA 3HJKA 3IS2B 2LB9A 3PBOA 4B9OA 4DN0A 4MN7A 3WS1A 3LY4A 4R0QA 3BYDA 2CC1A 4DRTA 3NBLA 3OZHA 3S4XA 1W63M 3ZG9B 3LR5A 4DXCA 4P6ZM 1TD5A 3P01A 5HAIA 4R4SA 2QMIA 4OH0A 4S2LA 2J9OA 3BRMA 1XJ2A 2J7VA 4BJPA 3DWZA 5AVEA 4L9GA 2ZMVA 2BLSA 2LB5A 1G5UA 4IUKA 3EQUA 3LYXA 2PT7A 5HPFA 1OJ5A 1SKOB 3SZTA 3GMWA 1J3WA 1SKFA 3U2AA 4K08A 2PYRA 4PKYG 4LENA 1H8MA 5G18A 5FQIA 1T19A 4Z1WA 1E25A 2Y2KA 4OP8A 1S1YA 3KYZA 3VP1A 1XX2A 5EPHA 1J9MA 4FCFA 1LT0A 2HDRA 3KSFA 1W7FA 5HDDA 4DXBA 1ERMA 1P97A 3IQAA 3WS4A 5GHZA 3DAVA 5DJUA 4YWZA 3S7QA 1GHPA 2HDSA 4FSFA 4HESA 3UB6A 2H0YA 3N8RA 3CG5A 1MC0A 4UHUA 1XJ6A 1EWZA 4CLCB 1RGYA 3K3DA 2GNXA 1LSVA 3ITAA 4BLMA 1D1JA 4F3LB 1TS8A 4CPKA 2K2NA 2EFUA 2ZQAA 3MXSA 5CRFA 1LI9A 2Y2QA 5EM0A 3T4JA 3P7NA 1O7EA 4WELA 4X6TA 2Y2IA 2C6WB 2WAEA 5FAOA 3T4SA 5M19A 2ACGA 3LIEA 3LEQA 5HW3A 3PBSA 3B47A 4HJ4A 5FDHA 4PMAA 2HDUA 4JXVA 5F69A 1YAXA 5GHXA 4E3MA 2EXAA 4C3QA 4JPMA 1FSWA 4M3KA 5FAPA 3S7OA 2QYBA 3PAGA 3NOTC 4ZJ2A 3VFHA 5M18A 3UN7A 2XD1A 3ZG7B 3C38A 3ZDJA 5EVEA 3F1OA 3BFDA 3F1PB 5HWTA 1SKOA 3ZG0A 5CTNA 5DFXA 3KSIA 2A24A 3HLBA 1H0MA 3C7UA 1N9LA 3ZNYA 2ZC5B 2PRFA 2VGLM 3ZVTA 4R70A 4MBHA 2G2WA 5EOOA 1N9OA 2O99A 2VX8A 2I72A 1NLZA 5E2HA 4R4RA 2WZXA 1EW0A 2J3TD 1FCOA 4S2JA 5CEDA 3FYZA 3BECA 3T4LA 5HZHA 3Q7VB 3IXGA 1G6OA 3M6BA 1EI5A 3GSGA 4Y17A 4OLGA 1LLBA 2E8JA 1BLCA 1IYPA 2HF6A 2XGNA 4KG5A 2BASA 4OPRA 2W27A 3G2YA 4QD4A 3UNWA 1XA7A 3HLEA 5M1AA 2ZQ8A 3ZCZA 4IVKA 1K54A 2ZM2A 4II7A 2WGWA 2XQZA 4R3BA 3NECA 4LRZE 3LUQA 5EE8A 5EVLA 2M1CA 4QY6A 4G3VA 3WS2A 3HUNA 4HNBA 2Y2LA 2IA2A 2L4RA 4D2OA 4OONA 2W3FA 1FOFA 2ZC3B 5GLCA 3NY4A 1OT9A 2W3HA 3HREA 3UDIA 2VV8A 4O01A 4I5SA 3IF6B 1BULA 2P08A 4R6LA 2M7VA 4KZ3A 3LIAA 3ZVWA 3BEBA 3HL9A 1HVBA 2JKTM 4HH3A 5A90A 4QPRA 2ZC6B 1CJFA 4E3IA 1YT4A 2VK3A 4EWFA 3KSHA 4KZAA 5D3OA 5CERA 2Y2NA 3QP2A 4EERA 2EX9A 4LV0A 3UO9A 1YLJA 3V5MA 1K4EA 3MKFA 4DE3A 5JYPA 4NXGA 2XA7S 4H6JA 3N8SA 5CEBA 1NYMA 3N4IA 2J3WA 4U0TA 2XK1A 3WWXA 4ARZA 4KG2A 5EM1A 5G4ZA 3D72A 1T1AA 4JF4A 4R38A 3FV7A 1KOUA 1PFLA 1L3LA 4ME4A 3H7WB 3PAEA 3W2ZA 2CMNA 1PYYA 2KOIA 3KYQA 1YPRA 3D4FA 3IHAA 2PHYA 5FSRA 4BL2A 3FPWA 4UAAA 2WKPA 4NKPA 3ISGA 1NJ4A 1FSYA 4S2NA 4YOFA 4HQAA 1LSWA 1VETA 3ZQ5A 2X01A 3Q82A 2JKFA 3IXDA 2O0YA 2Y4AA 4G3KA 1OPXA 2XFSA 2Y79A 5LBRA 4MNRA 1BZAA 3SW1A 3LEZA 1BLSA 4X53A 4ZJ1A 4Q8IA 2XSSA 4M4XA 4KQOA 4JLFA 1L0DA 2JKGA 4N1XA 5HPIA 3TG9A 4E3NA 2X02A 1K4FA 1FR6A 3QP1A 3W4OA 5AVFA 5L07A 2VV6A 5CHMA 1XPBA 3LO7A 5TBMB 1CI9A 4FD8A 5FI6A 4L0LA 1RP5A 4GHIB 4RVAA 4DMZA 4MN5A 4ID4A 4JGRA 1F9IA 3WRTA 3T1QB 3LY3A 4OOYA 3BLSA 1TEMA 3IT9A 4R3JA 5EVID 1GSVA 3G2ZA 4R23A 3N8LA 4B93A 5F68A 3TE8A 3E4PA 3IXHA 4ZAMA 3OPLA 5EVIC 1PNEA 3GECA 4U3TA 3C5AA 5HWWA 1HD8A 4GS9B 1SCWA 3D3OA 5FEGA 2B02A 1MWSA 5DF9A 4WF0A 4EBNA 3BJNA 4KUOA 3B33A 2JKRI 3CMZA 2Z2MB 4OQGA 4EUZA 2E8IA 3CHWP 3C8CA 5CGWA 4NG2A 4WBGA 3IBRA 1KVLA 1X0OA 4R3AA 2J80A 2ZC4B 3UPOA 3GR2A 4EETB 4E6XA 1D7EA 1XXMA 2V20A 4JGPA 2HPBA 3F1NA 3ULFA 3LI9A 4PM8A 4UQIS 1TS6A 3S7PA 2EX8A 1PW8A 3WRZA 2P74A 1OTEA 3OOVA 3A0RA 3OLOA 3T1RA 3IH9A 4GKUA 3TW8A 4JGOA 1KE0A 1N9NA 4GDBA 1MZUA 4K0WA 2ZOIA 3A3EA 5GLAA 1MBLA 4PKYA 4X25A 2V0UA 4WM9A 3VSLA 3N7WA 4IUHA 4WMCA 4P87A 4CQHA 4OPQA 1WE4A 1NRJA 2P9VB 3QP8A 5HFOA 4EESA 3LIBA 2HJ9C 2XH9A 3ZYTA 1JWZA 3A3IA 5TBMA 1GCEA 4EBPA 1FIKA 2V0WA 4GHIA 2WGIA 4L9FA 3IH8A 2I9VA 4RX2A 4P6ZS 2VKSA 1PW1A 4JXGA 4E3KA 3H9WA 3MZDA 3IBJA 1P9RA 1YLWA 1YKDA 2Z6CA 2ZMAA 4QJGA 2WKRA 4EEPA 3HLGA 1OTIA 2L0WA 2VZWA 3TJZC 1K55C 1NYYA 4X68A 1K56A 4WEKA 1Q2QA 4ZRRA 2Y2GA 5TJJA 4LFUA 2D01A 4K91A 5J4EA 1CEGA 2ZQCA 3O88A 1YMXA 1CEFA 2L1MA 1Y4OA 4GCZA 4B4XA 3PYPA 4JF5A 4KZBA 4YFMA 2EFXA 4LRYC 3UPNA 4GDNA 3FPVA 4WYYA 2JE5A 3IX4A 1Y54A 4OQ0A 4X1LA 4YINA 5J3WA 2H10A 1YLZA 4KG6A 3FKVA 1KE4A 2ZL1B 3DTMA 2QZ6A 1TDGA 3T4KA 4WZ4A 4RA7A 3UB7A 3S22A 2WKQA 4WEJA 1GSXA 5FEFA 3GVBA 4BD0A 4BMWA 4P0MA 2G7UA 3MZFA 2HP5A 2Y55A 4P6BA 1DJBA 4KENB 1VM1A 3NOUC 1XGIA 1MXOA 1V9YA 5FQQA 2OWJA 3KYEA 2Z6DA 4DDYA 4S2MA 5FQ9A 3IS2A 1KGFA 3R4KA 3HCYA 4GB7A 3OPHA 3QP5A 2BTFP 4LCLA 5F1FA 3BQ8A 1T18A 3RFBA 5CTMA 2ZOHA 3MMHA 5DF7A 1YMSA 1JTGA 1ZHHB 3JPUA 1G6AA 1OJGA 1L0FA 1K0KA 1ERQA 4Y15A 5IT5A 2BG1A 3K3CA 2PR6A 3ZNTA 3ZG5A 2FFYA 5CHUA 4HOIA 3UE1A 3L9KA 2QKPA 1SDEA 3OPRA 3B42A 3HLDA 3NHQA 1S4SA 3G32A 1MKMA 4N9KA 1RCJA 4OQIA 1Q2PA 3IWQA 4Y0TA 2H5SA 5EV0A 4JBFA 1ESUA 2WKEA 3EQVA 2W1TB 4D60A 2ZQ7A 3VP4A 2VGLS 4B4ZA 1BYWA 1W79A 1BLPA 3M2JA 1DP6A 4BD1A 4LPZA 3G35A 4LRXC 4KQQA 3DW0A 1OT6A 2HZ5A 5DVAA 1ZTUA 2JCHA 4GN2A 4MCWA 4UA9A 3TSGA 2OAQ1 1H3QA 2PR5A 3OCNA 4HIAA 3PR6A 4GOGA 1XGJA 1MWUA 2A49A 5HL1A 5A91A 3C4OA 1FCMA 4X55A 4X1MA 4LV1A 5A8BA 4CLCA 1L0EA 4I39A 3C7VA 5HDCA 4HBUA 2QHKA 4F3LA 3V3SA 1DP8A 1ZG6A 2JHEA 2RL3A 3NDGA 3HJIA 5CXWA 5IS1A 5GLDA 1CQAA 4HP9A 3DWKA 2IWDA 3NOPC 4UEYA 1N4OA 3BLMA 4UA7A 1NWZA 4F94A 3VP2A 4EW7A 2EXBA 3AGDA 3P98A 3MZEA 4X69A 3K2NA 4HHDA 3UB5P 1KGGA 3EOIA 3V50A 4NXBA 4HI4A 5EFWA 2GJ3A 2XD5A 2A2LA 3RH8B 4WZ5C 1S1ZA 4JXWA 1LL9A 4O0PA 1PZOA 2V9AA 2RCXA 1K6SA 3AGEA 1S67L 4S2PA 1CK3A 3QNBA 1Z09A 4KZ8A 4JXSA 1UWNX 3F1PA 1WYBA 4BWIA 2OLUA 3SH8A 1K57C 4KQDA 3S7NA 2Y8HA 5CGXA 4NXEA 2W1TA 2GZAA 2WYXA 4P85A 2VA0A 3E4QA 4OOLA 3GTCA 1IFQA 4I3AA 2HP9A 4Y5FA 2XROA 5GLBA 3UDFA 4JF6A 3VV4A 1S6RA 2DRWA 5I5LA 1SZVA 5TFQA 4EXOA 3MQ0A 1JWPA 3Q7VA 4KQRA 4FUWA 4E3LA 1ES3A 3R7WB 3O87A 3O3VA 3A0SA 4DJ3A 3MQOA 3BW6A 2JC7A 4KUKA 4ETZA 1OMEA 2WAFA 4DF6A 5KSHA 3UE6A 5TGFA 2INWA 3SH7A 1JNUA 4KZ4A 3FZCA 1T1CA 1ZC2A 2VGKA 1G68A 1V9ZA 4EU0A 2YKFA 4AFIA 4RX3A 3MFDA 2PD8A 3MS6A 3LI8A 2K7SA 3UDXA 3HUOA 1YSPA 4N92A 4NK3A 3SS3A 3E98A 2DCFA 4WL9A 4LV2A 1KVMA 1NRFA 1SHVA 3VP3A 1HLUP 3IF6A 4GZBA 2HJEA 4QU3A 1IKIA 1UWPX 1CF0A 1CI8A 3FKWA 3N6IA 3BY9A 1Z6FA 2QPNA 3EGDC 3W4QA 4ZJ3A 1HZOA 5IHVA 3IWOA 3HLCA 4Y3IA 3BFGA 4NEED 3V3RA 5DJTA 3O5YA 3U4LP 1M6KA 4Q0IA 4IBRA 5GHYA 5CGSA 1IELA 2HP6A 2KX6A 1HTZA 1WYCA 3G31A 1E4DA 2VV7A 1W8YA 3G4PA 3D9YA 2P7JA 5AQAA 5L2FA 5HX9A 2H0TA 3NDEA 1S4RA 2HV1A 3PHYA 1RGZA 5DKLA 3H7WA 2QWSA 1F5MA 4ESPA 3LR4A 2PDRA 2EWWA 3BY8A 4QWOA 3IX3A 5FQKA 3A3DA 2GX5A 3R7WA 5L8MA 3O86A 2K31A 1TDLA 1F98A 4Y0OA 3UE3A 3Q7ZA 2GDNA 1YSQA 3IWIA 3EEAA 1I2WA 2V8CA 2JKRM 1H8ZA 3CI6A 2O9AA 1DJAA 1N9BA 3CLOA 4E6WA 1ES2A 3GQZA 1GA9A 3E0YA 4XXRA 4BBUA 1BLHA 3NJAA 1KE3A 5EVIB 2V1BA 3QP6A 2NUPC 3VSKA 3NI9A 3ZGAB 4GLQA 3HLWA 2XR0A 3LFVA 4ZTKA 4L9EA 3KX0X 1GHMA 2WKHA 2HGVA 5HWVA 4WUJA 1E3UA 4Q0HA 4HEFA 2R9WA 5AQ7A 5MC7A 3Q1FA 2PU4A 1F2KA 1K6RA 2NUTC 3CWFA 4I3IA 3CPTB 3HVFA 2R9XA 1IYOA 3FC7A 1OTBA 4CLCD 5E2EA 1XKZA 1PI4A 3HBRA 4FH2A 3PBQA 2VGJA 5U47A 2EX2A 3VOZA 4E3JA 5HAQA 2KLIA 5DF8A 1XFQA 4CLCC 1KGEA 2OWHA 1SDNA 2ZQDA 3EWKA 5A93A 4YNRA 3VFFA 5HL6A 3ITBA 1ONHA 1QMEA 2IWCA 5FA7A 4EEUA 1K54C 1IKGA 3V67A 5DTTA 3T1XA 4GD8A 5F83A
chains in the Genus database with same CATH topology
1YQSA 4N9KA 4KZAA 5D3OA 3MBZA 5F1GA 5CERA 1RCJA 2Y2NA 4H8RA 4OQIA 1Q2PA 5FI2A 4EV4A 3S1YA 3IWQA 4K0XA 3NIAA 2OV5A 1ES4A 2EX9A 2H5SA 4Y0TA 1DY6A 4LV0A 3UO9A 1EROA 3FWLA 1YLJA 4JBFA 4PM7A 4DDSA 4EQIA 1ESUA 1K4EA 2WKEA 3G34A 3MKFA 2EX6A 3V5MA 4DE3A 3EQVA 4N1HA 3BM6A 5JYPA 3PBRA 4XUXA 1GHIA 5CEBA 3N8SA 2A3UA 1NYMA 3QHYA 3N4IA 4U0TA 2XK1A 2ZQ7A 5J8XA 3VP4A 3WWXA 4S2KA 1GA0A 4KG2A 1ES5A 3VMAA 3SOIA 4B4ZA 4BENA 1W79A 1BLPA 3M2JA 5F82A 1DJCA 3PBNA 4BD1A 1I2SA 2Y2MA 5FI7A 4JF4A 3RXXA 4PPRA 4OP5A 2XEPA 3FV7A 3G35A 4KZ9A 2XLNA 4KQQA 3DW0A 5I94A 5DVAA 1ONGA 2C5WB 2JCHA 4GN2A 4UA9A 3NCKA 4MBFA 4KZ7A 3TSGA 1K38A 5KZHA 3BFEA 3PAEA 4QB8A 3OCNA 4GOGA 1XGJA 1MWUA 3NC8A 2A49A 3MXRA 1BSGA 1MY8A 1PYYA 4CJNA 1PI5A 5HL1A 1JTDA 3D4FA 3IHAA 5A91A 3OPPA 5FSRA 4BL2A 3C4OA 4UAAA 1FCMA 1K25A 4X55A 4DE1A 4LV1A 4ZDXA 1L0EA 3A3JA 4OKPA 3P09A 3C7VA 3ISGA 4IBXA 1NJ4A 1FSYA 2Y91A 4HBUA 4S2NA 4WZ5A 5AQBA 4A5RA 5EOEA 4FH4A 4HBTA 3HLFA 3Q82A 4OLDA 3IXDA 4U0XA 2PBYA 2Y4AA 5DTSA 5AQ9A 3SS5A 3V3SA 3Q81A 2Y2OA 1BT5A 1ZG6A 2XFSA 2RL3A 2ZLYA 3IXBA 1JVJA 4GD6A 4O7DA 4R1GA 1LL5A 1U60A 3NDGA 1MWTA 4MNRA 5CXWA 1BZAA 4NETA 3CJMA 4C6YA 5GLDA 4BQMA 2ZD8A 4S2OA 4PM9A 2WGWB 3LEZA 1PIOA 1IEMA 1BLSA 4X53A 5HARA 4ZJ1A 1K57A 1L2SA 4E3OA 5JYOA 3WS5A 3DWKA 2IWDA 5EVIA 4Q8IA 3W8KA 1N4OA 4GNUA 4IVIA 3BFFA 4KQOA 1BTLA 4JLFA 1L0DA 1H8YA 3BLMA 4OQHA 2J8YA 4UA7A 4N1XA 4DE0A 4F94A 3TG9A 4DE2A 3VP2A 3E2KA 4E3NA 3SH9A 2X02A 2EXBA 1FR1A 2P9VA 3AGDA 3P98A 4OPZA 1K4FA 1FR6A 3MZEA 4X69A 3W4OA 3PBOA 1LI0A 2WUQA 3WS1A 1KGGA 3LY4A 3ZG8B 5CHMA 4R0QA 1XPBA 3BYDA 3LO7A 3V50A 2CC1A 4DRTA 1ALQA 1CI9A 3NBLA 4FD8A 5FI6A 4L0LA 1RP5A 3OZHA 2XD5A 1W8QA 3S4XA 4Y0UA 4RVAA 3V39A 3ZG9B 4DXCA 2J9PA 2Y2PA 4ID4A 4S2NC 4WZ5C 4X56A 5HAIA 3WRTA 5GL9A 3LY3A 1NZUA 4OOYA 4JXWA 1LL9A 2QMIA 4OH0A 4R4SA 1YLTA 4S2LA 1PZOA 2J9OA 3BRMA 3BLSA 1TEMA 3IT9A 2J7VA 2RCXA 4R3JA 2V1ZA 4BJPA 3JYIA 1K6SA 3AGEA 5EVID 3DWZA 5E2GA 4S2PA 1CK3A 3QNBA 2OSUA 3G2ZA 4KZ8A 4R23A 3N8LA 4JXSA 2BLSA 4C75A 1WYBA 2OLUA 3LCEA 3SH8A 3EQUA 1K57C 3IXHA 4ZAMA 3OPLA 5EVIC 1I5QA 4OOMA 2Z2LB 4UA6A 3GMWA 5CGXA 1SKFA 4U3TA 1XP4A 2WYXA 3C5AA 1HD8A 4P85A 4LENA 3TOIA 4OOLA 3GTCA 2XFTA 1SCWA 5G18A 5FQIA 5HAPA 1E25A 2Y2KA 2HP9A 4OP8A 2Y2JA 2WADA 1MWSA 5DF9A 3VP1A 1XX2A 5GLBA 3UDFA 4JF6A 3ZHHA 2ZQ9A 5EPHA 3WS0A 4EBNA 1J9MA 4FCFA 4XUZA 1S6RA 3ZFZA 4OVDA 2DRWA 3CMZA 1TVFA 2Z2MB 3Q07A 2HDRA 5TFQA 1W7FA 3IF6C 4DXBA 4OQGA 3VOYA 1JWPA 4EUZA 2E8IA 1NZOA 3Q7VA 4KQRA 1ERMA 5CGWA 3IQAA 3WS4A 5GHZA 1ES3A 4E3LA 3O87A 3O3VA 4WBGA 1KVLA 1GHPA 2ZC4B 3UPOA 2HDSA 4FSFA 4HESA 3GR2A 2H0YA 3N8RA 3CG5A 3A3FA 2G2UA 2JC7A 4E6XA 3GRJA 4N9LA 4UHUA 1OMEA 2XF3A 1XXMA 2V20A 2WAFA 4DF6A 5KSHA 2HPBA 1EWZA 5TGFA 4QHCA 1RGYA 1KDSA 4EBLA 5EUAA 3SH7A 3ITAA 4BLMA 1W5DA 5DTKA 3GV9A 4KZ4A 2WZZA 3FZCA 4CPKA 4PM8A 4PM5A 2EFUA 2ZQAA 3MXSA 2V2FF 5CRFA 1S0WA 2Q9NA 2EX8A 1PW8A 3WRZA 1ZC2A 2VGKA 1LI9A 2Y2QA 1G68A 2P74A 1K55A 2WK0A 3UE0A 1O7EA 2X71A 3IH9A 4WELA 4X6TA 4GKUA 3M6HA 2Y2IA 1AXBA 4RX3A 1KE0A 4GDBA 4K0WA 3A3EA 1YLYA 3W4PA 5GLAA 3MFDA 2C6WB 1MBLA 2WAEA 4LCMA 3OCLA 5FAOA 2Q9MA 4WM9A 3VSLA 3UDXA 3HUOA 3N7WA 4N92A 5M19A 4WMCA 4NK3A 4P87A 4OPQA 3SS3A 1WE4A 2UWXA 2P9VB 2DCFA 2WKIA 5HFOA 5A92A 4LV2A 5HW3A 1KVMA 3PBSA 2XH9A 5FDHA 4PMAA 2HDUA 1NRFA 1SHVA 4JXVA 2HDQA 3VP3A 1JWZA 3A3IA 3IF6A 2DNSA 4GZBA 1GCEA 4QU3A 4EBPA 3PBTA 1IKIA 2X01A 3B3XA 4JKTA 1CI8A 5GHXA 3FKWA 1BUEA 4E3MA 3N6IA 2WGIA 1M40A 1PWGA 2EXAA 3IH8A 4RX2A 2FFFB 1PW1A 4JXGA 4C3QA 4E3KA 3CZDA 4JPMA 1FSWA 1Z6FA 4Y7PA 2IWBA 2QPNA 3MZDA 1L0GA 4M3KA 5FAPA 3VP0A 1YM1A 3W4QA 1PZPA 4ZJ3A 1HZOA 1YLWA 3PAGA 5IHVA 1NY0A 3IWOA 3HLCA 2ZMAA 3BFGA 4QJGA 3HLGA 3V3RA 4ZJ2A 3VFHA 5M18A 3G30A 3UN7A 1NXYA 2XD1A 4KZ6A 1K55C 1NYYA 4X68A 1K56A 4WEKA 1M6KA 1Q2QA 3ZG7B 3ZDJA 2Y2GA 4IBRA 4WMCD 4ZBEA 3BFDA 4K91A 5GHYA 5CGSA 5FQMA 1IELA 1IYQA 1VQQA 5KSCA 2HP6A 1E3UD 1CEGA 1HTZA 2ZQCA 3PTEA 3ZG0A 5CTNA 1WYCA 3G31A 3O88A 4B88A 1E4DA 1YMXA 3HLBA 1W8YA 3G4PA 3C7UA 4BL3A 3ZNYA 1CEFA 2ZC5B 5FAQA 2ZJ9A 5AQAA 5L2FA 4B4XA 1PWDA 4JF5A 3ZVTA 4KZBA 4YFMA 4MBHA 2G2WA 2EFXA 5HX9A 2H0TA 3NDEA 3UPNA 4GDNA 1YLPA 4WYYA 5EOOA 2JE5A 1Y54A 1MPLA 2I72A 1RGZA 4OQ0A 3RJUA 5E2HA 5BOHA 2B5RA 4YINA 2H10A 5E43A 3IF5A 2WZXA 4R4RA 1QMFA 1YLZA 4KG6A 2OLVA 5FQKA 3FKVA 3UY6A 4DKIA 1KE4A 2Y59A 1FCOA 4MLLA 4S2JA 5CEDA 2PU2A 3FYZA 3HUMA 3DTMA 3BECA 2QZ6A 3A3DA 1TDGA 3I7JA 3Q7VB 2ZM0A 3IXGA 3O86A 1K56D 4RA7A 4S2IA 4WZ4A 3S22A 3M6BA 3UPPA 1TDLA 1EI5A 1LHYA 3RXWA 4Y0OA 3GSGA 4OLGA 1LLBA 3IHBA 3Q7ZA 4WEJA 3UE3A 2GDNA 3GVBA 4BD0A 1BLCA 1IYPA 2XGNA 4KG5A 4OPRA 3IWIA 4P0MA 3G2YA 1I2WA 3MZFA 2HP5A 2Y55A 1XA1A 1H8ZA 1DJBA 4P6BA 4KENB 1MKIA 1DJAA 1N9BA 4LV3A 4QD4A 3UNWA 4QY5A 1XA7A 1VM1A 3HLEA 5M1AA 1O07A 4E6WA 2ZQ8A 3ZCZA 1XGIA 1KDWA 4IVKA 5FATA 1K54A 1ES2A 3BFCA 1MXOA 2ZM2A 3GQZA 2JBFA 1GA9A 2WGWA 2XQZA 4R3BA 4XXRA 5FQQA 3M2KA 1MWRA 5E2FA 1BLHA 5FASA 1KE3A 2ZM8A 5CECA 5EE8A 5EVLA 4DDYA 4QY6A 5EVIB 4S2MA 3WS2A 5FQJA 3HUNA 3VSKA 3MKEA 4OPYA 5FQ9A 3NI9A 3ZGAB 2Y2LA 2XR0A 3HLWA 1KGFA 3E2LA 5CHJA 4ZTKA 4D2OA 1ESIA 1C3BA 4GB7A 3OPHA 4OONA 1GHMA 2WKHA 4LCLA 5F1FA 1ZKJA 1H5XA 1E3UA 1FOFA 2ZC3B 5GLCA 1PWCA 4HEFA 3NY4A 5CTMA 5KMWA 2R9WA 5AQ7A 3HREA 3Q1FA 2PU4A 4Z9QA 3C4PA 3UDIA 5DF7A 1K6RA 1FCNA 1YMSA 5EECA 1JTGA 3HVFA 2R9XA 1IYOA 2ZC7A 4KZ5A 1G6AA 1L0FA 2Y2HA 5E2EA 4PM6A 1ZG4A 1XKZA 2WGVA 3SS4A 1PI4A 1ERQA 3HBRA 3PBQA 3IF6B 4FH2A 2VGJA 1BULA 5U47A 2BG1A 2EX2A 3AGFA 3VOZA 4RYEA 1JWVA 4E3JA 5TR7A 5HAQA 3ZNTA 3ZG5A 2FFYA 4KZ3A 5CHUA 5DF8A 3ZVWA 1FQGA 1KGEA 3UE1A 3BEBA 3HL9A 1HVBA 1SDEA 1SDNA 2ZQDA 5A93A 3VFFA 5A90A 3ITBA 3OC2A 1ONHA 3OPRA 3QNCA 1QMEA 2ZC6B 2IWCA 2XDMA 3HLDA 5FA7A 1K54C 4MBKA 1IKGA 4IEDA 4E3IA 1YT4A 5DTTA 3G32A 4GD8A 5F83A 4EWFA 1IYSA 4MEZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQS A;  4N9K A;  4KZA A;  5D3O A;  3MBZ A;  5F1G A;  5CER A;  1RCJ A;  2Y2N A;  4H8R A;  4OQI A;  1Q2P A;  5FI2 A;  4EV4 A;  3S1Y A;  3IWQ A;  4K0X A;  3NIA A;  2OV5 A;  1ES4 A;  2EX9 A;  2H5S A;  4Y0T A;  1DY6 A;  4LV0 A;  3UO9 A;  1ERO A;  3FWL A;  1YLJ A;  4JBF A;  4PM7 A;  4DDS A;  4EQI A;  1ESU A;  1K4E A;  2WKE A;  3G34 A;  3MKF A;  2EX6 A;  3V5M A;  4DE3 A;  3EQV A;  4N1H A;  3BM6 A;  5JYP A;  3PBR A;  4XUX A;  1GHI A;  5CEB A;  3N8S A;  2A3U A;  1NYM A;  3QHY A;  3N4I A;  4U0T A;  2XK1 A;  2ZQ7 A;  5J8X A;  3VP4 A;  3WWX A;  4S2K A;  1GA0 A;  4KG2 A;  1ES5 A;  3VMA A;  3SOI A;  4B4Z A;  4BEN A;  1W79 A;  1BLP A;  3M2J A;  5F82 A;  1DJC A;  3PBN A;  4BD1 A;  1I2S A;  2Y2M A;  5FI7 A;  4JF4 A;  3RXX A;  4PPR A;  4OP5 A;  2XEP A;  3FV7 A;  3G35 A;  4KZ9 A;  2XLN A;  4KQQ A;  3DW0 A;  5I94 A;  5DVA A;  1ONG A;  2C5W B;  2JCH A;  4GN2 A;  4UA9 A;  3NCK A;  4MBF A;  4KZ7 A;  3TSG A;  1K38 A;  5KZH A;  3BFE A;  3PAE A;  4QB8 A;  3OCN A;  4GOG A;  1XGJ A;  1MWU A;  3NC8 A;  2A49 A;  3MXR A;  1BSG A;  1MY8 A;  1PYY A;  4CJN A;  1PI5 A;  5HL1 A;  1JTD A;  3D4F A;  3IHA A;  5A91 A;  3OPP A;  5FSR A;  4BL2 A;  3C4O A;  4UAA A;  1FCM A;  1K25 A;  4X55 A;  4DE1 A;  4LV1 A;  4ZDX A;  1L0E A;  3A3J A;  4OKP A;  3P09 A;  3C7V A;  3ISG A;  4IBX A;  1NJ4 A;  1FSY A;  2Y91 A;  4HBU A;  4S2N A;  4WZ5 A;  5AQB A;  4A5R A;  5EOE A;  4FH4 A;  4HBT A;  3HLF A;  3Q82 A;  4OLD A;  3IXD A;  4U0X A;  2PBY A;  2Y4A A;  5DTS A;  5AQ9 A;  3SS5 A;  3V3S A;  3Q81 A;  2Y2O A;  1BT5 A;  1ZG6 A;  2XFS A;  2RL3 A;  2ZLY A;  3IXB A;  1JVJ A;  4GD6 A;  4O7D A;  4R1G A;  1LL5 A;  1U60 A;  3NDG A;  1MWT A;  4MNR A;  5CXW A;  1BZA A;  4NET A;  3CJM A;  4C6Y A;  5GLD A;  4BQM A;  2ZD8 A;  4S2O A;  4PM9 A;  2WGW B;  3LEZ A;  1PIO A;  1IEM A;  1BLS A;  4X53 A;  5HAR A;  4ZJ1 A;  1K57 A;  1L2S A;  4E3O A;  5JYO A;  3WS5 A;  3DWK A;  2IWD A;  5EVI A;  4Q8I A;  3W8K A;  1N4O A;  4GNU A;  4IVI A;  3BFF A;  4KQO A;  1BTL A;  4JLF A;  1L0D A;  1H8Y A;  3BLM A;  4OQH A;  2J8Y A;  4UA7 A;  4N1X A;  4DE0 A;  4F94 A;  3TG9 A;  4DE2 A;  3VP2 A;  3E2K A;  4E3N A;  3SH9 A;  2X02 A;  2EXB A;  1FR1 A;  2P9V A;  3AGD A;  3P98 A;  4OPZ A;  1K4F A;  1FR6 A;  3MZE A;  4X69 A;  3W4O A;  3PBO A;  1LI0 A;  2WUQ A;  3WS1 A;  1KGG A;  3LY4 A;  3ZG8 B;  5CHM A;  4R0Q A;  1XPB A;  3BYD A;  3LO7 A;  3V50 A;  2CC1 A;  4DRT A;  1ALQ A;  1CI9 A;  3NBL A;  4FD8 A;  5FI6 A;  4L0L A;  1RP5 A;  3OZH A;  2XD5 A;  1W8Q A;  3S4X A;  4Y0U A;  4RVA A;  3V39 A;  3ZG9 B;  4DXC A;  2J9P A;  2Y2P A;  4ID4 A;  4S2N C;  4WZ5 C;  4X56 A;  5HAI A;  3WRT A;  5GL9 A;  3LY3 A;  1NZU A;  4OOY A;  4JXW A;  1LL9 A;  2QMI A;  4OH0 A;  4R4S A;  1YLT A;  4S2L A;  1PZO A;  2J9O A;  3BRM A;  3BLS A;  1TEM A;  3IT9 A;  2J7V A;  2RCX A;  4R3J A;  2V1Z A;  4BJP A;  3JYI A;  1K6S A;  3AGE A;  5EVI D;  3DWZ A;  5E2G A;  4S2P A;  1CK3 A;  3QNB A;  2OSU A;  3G2Z A;  4KZ8 A;  4R23 A;  3N8L A;  4JXS A;  2BLS A;  4C75 A;  1WYB A;  2OLU A;  3LCE A;  3SH8 A;  3EQU A;  1K57 C;  3IXH A;  4ZAM A;  3OPL A;  5EVI C;  1I5Q A;  4OOM A;  2Z2L B;  4UA6 A;  3GMW A;  5CGX A;  1SKF A;  4U3T A;  1XP4 A;  2WYX A;  3C5A A;  1HD8 A;  4P85 A;  4LEN A;  3TOI A;  4OOL A;  3GTC A;  2XFT A;  1SCW A;  5G18 A;  5FQI A;  5HAP A;  1E25 A;  2Y2K A;  2HP9 A;  4OP8 A;  2Y2J A;  2WAD A;  1MWS A;  5DF9 A;  3VP1 A;  1XX2 A;  5GLB A;  3UDF A;  4JF6 A;  3ZHH A;  2ZQ9 A;  5EPH A;  3WS0 A;  4EBN A;  1J9M A;  4FCF A;  4XUZ A;  1S6R A;  3ZFZ A;  4OVD A;  2DRW A;  3CMZ A;  1TVF A;  2Z2M B;  3Q07 A;  2HDR A;  5TFQ A;  1W7F A;  3IF6 C;  4DXB A;  4OQG A;  3VOY A;  1JWP A;  4EUZ A;  2E8I A;  1NZO A;  3Q7V A;  4KQR A;  1ERM A;  5CGW A;  3IQA A;  3WS4 A;  5GHZ A;  1ES3 A;  4E3L A;  3O87 A;  3O3V A;  4WBG A;  1KVL A;  1GHP A;  2ZC4 B;  3UPO A;  2HDS A;  4FSF A;  4HES A;  3GR2 A;  2H0Y A;  3N8R A;  3CG5 A;  3A3F A;  2G2U A;  2JC7 A;  4E6X A;  3GRJ A;  4N9L A;  4UHU A;  1OME A;  2XF3 A;  1XXM A;  2V20 A;  2WAF A;  4DF6 A;  5KSH A;  2HPB A;  1EWZ A;  5TGF A;  4QHC A;  1RGY A;  1KDS A;  4EBL A;  5EUA A;  3SH7 A;  3ITA A;  4BLM A;  1W5D A;  5DTK A;  3GV9 A;  4KZ4 A;  2WZZ A;  3FZC A;  4CPK A;  4PM8 A;  4PM5 A;  2EFU A;  2ZQA A;  3MXS A;  2V2F F;  5CRF A;  1S0W A;  2Q9N A;  2EX8 A;  1PW8 A;  3WRZ A;  1ZC2 A;  2VGK A;  1LI9 A;  2Y2Q A;  1G68 A;  2P74 A;  1K55 A;  2WK0 A;  3UE0 A;  1O7E A;  2X71 A;  3IH9 A;  4WEL A;  4X6T A;  4GKU A;  3M6H A;  2Y2I A;  1AXB A;  4RX3 A;  1KE0 A;  4GDB A;  4K0W A;  3A3E A;  1YLY A;  3W4P A;  5GLA A;  3MFD A;  2C6W B;  1MBL A;  2WAE A;  4LCM A;  3OCL A;  5FAO A;  2Q9M A;  4WM9 A;  3VSL A;  3UDX A;  3HUO A;  3N7W A;  4N92 A;  5M19 A;  4WMC A;  4NK3 A;  4P87 A;  4OPQ A;  3SS3 A;  1WE4 A;  2UWX A;  2P9V B;  2DCF A;  2WKI A;  5HFO A;  5A92 A;  4LV2 A;  5HW3 A;  1KVM A;  3PBS A;  2XH9 A;  5FDH A;  4PMA A;  2HDU A;  1NRF A;  1SHV A;  4JXV A;  2HDQ A;  3VP3 A;  1JWZ A;  3A3I A;  3IF6 A;  2DNS A;  4GZB A;  1GCE A;  4QU3 A;  4EBP A;  3PBT A;  1IKI A;  2X01 A;  3B3X A;  4JKT A;  1CI8 A;  5GHX A;  3FKW A;  1BUE A;  4E3M A;  3N6I A;  2WGI A;  1M40 A;  1PWG A;  2EXA A;  3IH8 A;  4RX2 A;  2FFF B;  1PW1 A;  4JXG A;  4C3Q A;  4E3K A;  3CZD A;  4JPM A;  1FSW A;  1Z6F A;  4Y7P A;  2IWB A;  2QPN A;  3MZD A;  1L0G A;  4M3K A;  5FAP A;  3VP0 A;  1YM1 A;  3W4Q A;  1PZP A;  4ZJ3 A;  1HZO A;  1YLW A;  3PAG A;  5IHV A;  1NY0 A;  3IWO A;  3HLC A;  2ZMA A;  3BFG A;  4QJG A;  3HLG A;  3V3R A;  4ZJ2 A;  3VFH A;  5M18 A;  3G30 A;  3UN7 A;  1NXY A;  2XD1 A;  4KZ6 A;  1K55 C;  1NYY A;  4X68 A;  1K56 A;  4WEK A;  1M6K A;  1Q2Q A;  3ZG7 B;  3ZDJ A;  2Y2G A;  4IBR A;  4WMC D;  4ZBE A;  3BFD A;  4K91 A;  5GHY A;  5CGS A;  5FQM A;  1IEL A;  1IYQ A;  1VQQ A;  5KSC A;  2HP6 A;  1E3U D;  1CEG A;  1HTZ A;  2ZQC A;  3PTE A;  3ZG0 A;  5CTN A;  1WYC A;  3G31 A;  3O88 A;  4B88 A;  1E4D A;  1YMX A;  3HLB A;  1W8Y A;  3G4P A;  3C7U A;  4BL3 A;  3ZNY A;  1CEF A;  2ZC5 B;  5FAQ A;  2ZJ9 A;  5AQA A;  5L2F A;  4B4X A;  1PWD A;  4JF5 A;  3ZVT A;  4KZB A;  4YFM A;  4MBH A;  2G2W A;  2EFX A;  5HX9 A;  2H0T A;  3NDE A;  3UPN A;  4GDN A;  1YLP A;  4WYY A;  5EOO A;  2JE5 A;  1Y54 A;  1MPL A;  2I72 A;  1RGZ A;  4OQ0 A;  3RJU A;  5E2H A;  5BOH A;  2B5R A;  4YIN A;  2H10 A;  5E43 A;  3IF5 A;  2WZX A;  4R4R A;  1QMF A;  1YLZ A;  4KG6 A;  2OLV A;  5FQK A;  3FKV A;  3UY6 A;  4DKI A;  1KE4 A;  2Y59 A;  1FCO A;  4MLL A;  4S2J A;  5CED A;  2PU2 A;  3FYZ A;  3HUM A;  3DTM A;  3BEC A;  2QZ6 A;  3A3D A;  1TDG A;  3I7J A;  3Q7V B;  2ZM0 A;  3IXG A;  3O86 A;  1K56 D;  4RA7 A;  4S2I A;  4WZ4 A;  3S22 A;  3M6B A;  3UPP A;  1TDL A;  1EI5 A;  1LHY A;  3RXW A;  4Y0O A;  3GSG A;  4OLG A;  1LLB A;  3IHB A;  3Q7Z A;  4WEJ A;  3UE3 A;  2GDN A;  3GVB A;  4BD0 A;  1BLC A;  1IYP A;  2XGN A;  4KG5 A;  4OPR A;  3IWI A;  4P0M A;  3G2Y A;  1I2W A;  3MZF A;  2HP5 A;  2Y55 A;  1XA1 A;  1H8Z A;  1DJB A;  4P6B A;  4KEN B;  1MKI A;  1DJA A;  1N9B A;  4LV3 A;  4QD4 A;  3UNW A;  4QY5 A;  1XA7 A;  1VM1 A;  3HLE A;  5M1A A;  1O07 A;  4E6W A;  2ZQ8 A;  3ZCZ A;  1XGI A;  1KDW A;  4IVK A;  5FAT A;  1K54 A;  1ES2 A;  3BFC A;  1MXO A;  2ZM2 A;  3GQZ A;  2JBF A;  1GA9 A;  2WGW A;  2XQZ A;  4R3B A;  4XXR A;  5FQQ A;  3M2K A;  1MWR A;  5E2F A;  1BLH A;  5FAS A;  1KE3 A;  2ZM8 A;  5CEC A;  5EE8 A;  5EVL A;  4DDY A;  4QY6 A;  5EVI B;  4S2M A;  3WS2 A;  5FQJ A;  3HUN A;  3VSK A;  3MKE A;  4OPY A;  5FQ9 A;  3NI9 A;  3ZGA B;  2Y2L A;  2XR0 A;  3HLW A;  1KGF A;  3E2L A;  5CHJ A;  4ZTK A;  4D2O A;  1ESI A;  1C3B A;  4GB7 A;  3OPH A;  4OON A;  1GHM A;  2WKH A;  4LCL A;  5F1F A;  1ZKJ A;  1H5X A;  1E3U A;  1FOF A;  2ZC3 B;  5GLC A;  1PWC A;  4HEF A;  3NY4 A;  5CTM A;  5KMW A;  2R9W A;  5AQ7 A;  3HRE A;  3Q1F A;  2PU4 A;  4Z9Q A;  3C4P A;  3UDI A;  5DF7 A;  1K6R A;  1FCN A;  1YMS A;  5EEC A;  1JTG A;  3HVF A;  2R9X A;  1IYO A;  2ZC7 A;  4KZ5 A;  1G6A A;  1L0F A;  2Y2H A;  5E2E A;  4PM6 A;  1ZG4 A;  1XKZ A;  2WGV A;  3SS4 A;  1PI4 A;  1ERQ A;  3HBR A;  3PBQ A;  3IF6 B;  4FH2 A;  2VGJ A;  1BUL A;  5U47 A;  2BG1 A;  2EX2 A;  3AGF A;  3VOZ A;  4RYE A;  1JWV A;  4E3J A;  5TR7 A;  5HAQ A;  3ZNT A;  3ZG5 A;  2FFY A;  4KZ3 A;  5CHU A;  5DF8 A;  3ZVW A;  1FQG A;  1KGE A;  3UE1 A;  3BEB A;  3HL9 A;  1HVB A;  1SDE A;  1SDN A;  2ZQD A;  5A93 A;  3VFF A;  5A90 A;  3ITB A;  3OC2 A;  1ONH A;  3OPR A;  3QNC A;  1QME A;  2ZC6 B;  2IWC A;  2XDM A;  3HLD A;  5FA7 A;  1K54 C;  4MBK A;  1IKG A;  4IED A;  4E3I A;  1YT4 A;  5DTT A;  3G32 A;  4GD8 A;  5F83 A;  4EWF A;  1IYS A;  4MEZ A; 
#chains in the Genus database with same CATH topology
 2O9B A;  2W3G A;  3MBZ A;  4EQ1 A;  4H8R A;  3S1Y A;  3NIA A;  5DKK A;  1DY6 A;  3G6O A;  3FWL A;  4PM7 A;  4WLA A;  3F1O B;  2EX6 A;  4N1H A;  3BM6 A;  4GS9 A;  1GHI A;  3MJQ A;  3QHY A;  3MXQ A;  5J8X A;  4S2K A;  1ES5 A;  3VMA A;  3SOI A;  2A24 B;  4BEN A;  3MQQ A;  1I2S A;  2Y2M A;  1GSW A;  4PPR A;  4OP5 A;  2KDK A;  2XLN A;  2OAP 1;  4BBV A;  1ONG A;  2C5W B;  2ZMF A;  3NCK A;  4MBF A;  4KZ7 A;  1K38 A;  3BFE A;  3PXP A;  3DTK A;  3OPP A;  1DP9 A;  3H82 B;  3ICY A;  1K25 A;  4ZDX A;  3CAX A;  3A3J A;  4OKP A;  5EOE A;  4FH4 A;  3W4P A;  3HLF A;  4U0X A;  3LR3 A;  5AQ9 A;  2Y2O A;  1BT5 A;  4WN5 A;  2ZLY A;  3IXB A;  2M7U A;  1JVJ A;  4GD6 A;  4O7D A;  4R1G A;  1MWT A;  3CJM A;  2QJ5 A;  4BQM A;  2ZD8 A;  4PM9 A;  2WGW B;  1XJ4 A;  1PIO A;  4E3O A;  3VE4 A;  1L2S A;  3WS5 A;  4HH2 A;  5EVI A;  3W8K A;  4IVI A;  3BFF A;  1BTL A;  1OTD A;  2OOL A;  4DE2 A;  3E2K A;  2B95 A;  3SH9 A;  2P9V A;  1FR1 A;  5C5K A;  4OPZ A;  4RQ9 A;  5FL3 A;  1A0K A;  1LI0 A;  3JVV A;  2WUQ A;  3ZG8 B;  3MFX A;  4Y13 A;  3CPT A;  1ALQ A;  3UMD A;  1W8Q A;  3CUE A;  3LIF A;  4Y0U A;  4HJ3 A;  1P9W A;  3V39 A;  2J9P A;  2Y2P A;  3T4T A;  4S2N C;  4MDZ A;  4X56 A;  5HDS A;  2YKH A;  3T4O A;  5GL9 A;  1NZU A;  2AVX A;  1YLT A;  1G28 A;  2V1Z A;  3JYI A;  5E2G A;  3VOL A;  2OSU A;  4GJ4 A;  3IX8 A;  2W1R A;  1LL8 A;  5AJG A;  4C75 A;  3MF0 A;  3LCE A;  1S66 L;  4FTX A;  1I5Q A;  4OOM A;  5CX7 A;  2Z2L B;  5KIZ A;  4E04 A;  4UA6 A;  3T12 B;  3UB9 A;  1XP4 A;  4ETX A;  2DMW A;  3TOI A;  2XFT A;  3DTE A;  5HAP A;  4H6J B;  2Y2J A;  2WAD A;  3LIC A;  4ARZ B;  3ZHH A;  2ZQ9 A;  3WS0 A;  4XUZ A;  5K5B A;  3ZFZ A;  4OVD A;  1TVF A;  3Q07 A;  4XT2 B;  2ZL1 A;  2V1A A;  3IF6 C;  3VOY A;  1NZO A;  1XFN A;  4LGW A;  2R78 A;  2VLG A;  2V8F A;  3KSG A;  3C2W A;  4Y2F A;  1UGU A;  3A3F A;  2G2U A;  3GRJ A;  3H82 A;  4N9L A;  4GW9 A;  2XF3 A;  4QHC A;  2J3T C;  3UB8 A;  1KDS A;  4EBL A;  5EUA A;  1W5D A;  1VET B;  5DTK A;  3GV9 A;  3LGO A;  2WZZ A;  2ZBB A;  1P0Z A;  4PM5 A;  2V2F F;  1S0W A;  2Q9N A;  1K55 A;  2WK0 A;  3UE0 A;  2X71 A;  2EA9 A;  1STZ A;  3M6H A;  4MN6 A;  1AXB A;  1YLY A;  3CIT A;  3A0V A;  4LCM A;  3OCL A;  2Q9M A;  2PBD P;  2JN7 A;  2JKT I;  2UWX A;  2WKI A;  5A92 A;  4CLC E;  2VEA A;  1OTA A;  2HDQ A;  3MSH A;  2DNS A;  3PBT A;  3B3X A;  4JKT A;  5HSQ A;  1LSX A;  1BUE A;  1M40 A;  1PWG A;  2FFF B;  3CZD A;  2IWB A;  4Y7P A;  1L0G A;  3NUL A;  3VP0 A;  1YM1 A;  1DRM A;  1PZP A;  3T50 A;  1NY0 A;  4HY8 A;  1VEU B;  3G30 A;  1NXY A;  2XRN A;  4KZ6 A;  4WMC D;  3FG8 A;  4ZBE A;  4G3W A;  1T1B A;  5FQM A;  1IYQ A;  1VQQ A;  5KSC A;  1E3U D;  1WA9 A;  3PTE A;  4JGQ A;  2XA7 M;  3DTI A;  4B88 A;  4BL3 A;  4PAU A;  3E4O A;  5FAQ A;  2ZJ9 A;  4HJ6 A;  1PWD A;  3T4Q A;  2FH5 A;  5HD5 A;  2MJ6 A;  1YLP A;  3JVU A;  3MR0 A;  1MPL A;  3RJU A;  5BOH A;  2B5R A;  1AWI A;  5E43 A;  4XT2 A;  3IF5 A;  2P04 A;  1QMF A;  2OLV A;  4DKI A;  3UY6 A;  2Y59 A;  4MLL A;  2PU2 A;  3HUM A;  4BBT A;  3I7J A;  2ZM0 A;  4HP4 A;  1K56 D;  4S2I A;  3UPP A;  4IJG A;  5F6A A;  1LHY A;  3RXW A;  3IHB A;  1VHM A;  3VE3 A;  2H28 A;  5F5Y A;  1XA1 A;  5L10 A;  3F1N B;  1MKI A;  4LV3 A;  4QY5 A;  1O07 A;  5FAT A;  1KDW A;  3BFC A;  2JBF A;  3M2K A;  1MWR A;  5E2F A;  5FAS A;  4PHT A;  2ZM8 A;  5CEC A;  5FQJ A;  3MKE A;  4OPY A;  1D06 A;  5CHJ A;  3E2L A;  1TS7 A;  1ESI A;  1C3B A;  5L09 A;  2W3E A;  2EWV A;  1ZKJ A;  4EUV A;  1H5X A;  1PWC A;  5KMW A;  4Z9Q A;  3C4P A;  3KO6 A;  1FCN A;  5EEC A;  2ZC7 A;  4KZ5 A;  2Y2H A;  4PM6 A;  1ZG4 A;  2WGV A;  3SS4 A;  1XJ3 A;  3BWL A;  3EEH A;  3AGF A;  4Q0J A;  4RYE A;  1JWV A;  5TR7 A;  4DJ2 A;  1FQG A;  2UV0 E;  3OC2 A;  3QNC A;  2XDM A;  5DFY A;  4MBK A;  3DBA A;  4IED A;  5IU1 A;  1VEU A;  1Y28 A;  3OBF A;  1IYS A;  4MEZ A;  1YQS A;  2QJ7 A;  4I38 A;  5F1G A;  5G4Y A;  4EV4 A;  5FI2 A;  2OV5 A;  4K0X A;  1ES4 A;  1ERO A;  4DDS A;  4EQI A;  3G34 A;  2W3D A;  3PBR A;  4XUX A;  2A3U A;  2PYP A;  2O9C A;  3C30 A;  3BQA A;  4LLO B;  1GA0 A;  5FDS A;  1W63 Q;  3EGX C;  4O8G A;  5F82 A;  1DJC A;  3PBN A;  5FI7 A;  2D02 A;  3RXX A;  2VJW A;  2XEP A;  3UME A;  3T1S A;  4KZ9 A;  4MMN A;  3GDI A;  5I94 A;  1NLY A;  5KZH A;  3CUE C;  4NXF A;  4QB8 A;  3NC8 A;  3MXR A;  1BSG A;  1MY8 A;  4CJN A;  1PI5 A;  1JTD A;  2W0N A;  2B18 A;  5J7E A;  4DE1 A;  2PAV P;  3L7H A;  3P09 A;  4IBX A;  1VB6 A;  3QP4 A;  3TRC A;  4A5R A;  2Y91 A;  4WZ5 A;  5AQB A;  4IHQ A;  4HBT A;  4OLD A;  1IOU A;  2PBY A;  5DTS A;  3SS5 A;  3LR0 A;  3Q81 A;  1PRQ A;  4FOF A;  1FIL A;  3LID A;  5HD3 A;  1ODV A;  1LL5 A;  1U60 A;  4UQI M;  1TS0 A;  1ACF A;  4I3J A;  4NET A;  4C6Y A;  2PD7 A;  1TF1 A;  4S2O A;  2FZ0 A;  1IEM A;  5HAR A;  1K57 A;  5JYO A;  3RTY A;  4GNU A;  1H8Y A;  4OQH A;  2J8Y A;  4DE0 A;  2Q0O A;  3HJK A;  3IS2 B;  2LB9 A;  3PBO A;  4B9O A;  4DN0 A;  4MN7 A;  3WS1 A;  3LY4 A;  4R0Q A;  3BYD A;  2CC1 A;  4DRT A;  3NBL A;  3OZH A;  3S4X A;  1W63 M;  3ZG9 B;  3LR5 A;  4DXC A;  4P6Z M;  1TD5 A;  3P01 A;  5HAI A;  4R4S A;  2QMI A;  4OH0 A;  4S2L A;  2J9O A;  3BRM A;  1XJ2 A;  2J7V A;  4BJP A;  3DWZ A;  5AVE A;  4L9G A;  2ZMV A;  2BLS A;  2LB5 A;  1G5U A;  4IUK A;  3EQU A;  3LYX A;  2PT7 A;  5HPF A;  1OJ5 A;  1SKO B;  3SZT A;  3GMW A;  1J3W A;  1SKF A;  3U2A A;  4K08 A;  2PYR A;  4PKY G;  4LEN A;  1H8M A;  5G18 A;  5FQI A;  1T19 A;  4Z1W A;  1E25 A;  2Y2K A;  4OP8 A;  1S1Y A;  3KYZ A;  3VP1 A;  1XX2 A;  5EPH A;  1J9M A;  4FCF A;  1LT0 A;  2HDR A;  3KSF A;  1W7F A;  5HDD A;  4DXB A;  1ERM A;  1P97 A;  3IQA A;  3WS4 A;  5GHZ A;  3DAV A;  5DJU A;  4YWZ A;  3S7Q A;  1GHP A;  2HDS A;  4FSF A;  4HES A;  3UB6 A;  2H0Y A;  3N8R A;  3CG5 A;  1MC0 A;  4UHU A;  1XJ6 A;  1EWZ A;  4CLC B;  1RGY A;  3K3D A;  2GNX A;  1LSV A;  3ITA A;  4BLM A;  1D1J A;  4F3L B;  1TS8 A;  4CPK A;  2K2N A;  2EFU A;  2ZQA A;  3MXS A;  5CRF A;  1LI9 A;  2Y2Q A;  5EM0 A;  3T4J A;  3P7N A;  1O7E A;  4WEL A;  4X6T A;  2Y2I A;  2C6W B;  2WAE A;  5FAO A;  3T4S A;  5M19 A;  2ACG A;  3LIE A;  3LEQ A;  5HW3 A;  3PBS A;  3B47 A;  4HJ4 A;  5FDH A;  4PMA A;  2HDU A;  4JXV A;  5F69 A;  1YAX A;  5GHX A;  4E3M A;  2EXA A;  4C3Q A;  4JPM A;  1FSW A;  4M3K A;  5FAP A;  3S7O A;  2QYB A;  3PAG A;  3NOT C;  4ZJ2 A;  3VFH A;  5M18 A;  3UN7 A;  2XD1 A;  3ZG7 B;  3C38 A;  3ZDJ A;  5EVE A;  3F1O A;  3BFD A;  3F1P B;  5HWT A;  1SKO A;  3ZG0 A;  5CTN A;  5DFX A;  3KSI A;  2A24 A;  3HLB A;  1H0M A;  3C7U A;  1N9L A;  3ZNY A;  2ZC5 B;  2PRF A;  2VGL M;  3ZVT A;  4R70 A;  4MBH A;  2G2W A;  5EOO A;  1N9O A;  2O99 A;  2VX8 A;  2I72 A;  1NLZ A;  5E2H A;  4R4R A;  2WZX A;  1EW0 A;  2J3T D;  1FCO A;  4S2J A;  5CED A;  3FYZ A;  3BEC A;  3T4L A;  5HZH A;  3Q7V B;  3IXG A;  1G6O A;  3M6B A;  1EI5 A;  3GSG A;  4Y17 A;  4OLG A;  1LLB A;  2E8J A;  1BLC A;  1IYP A;  2HF6 A;  2XGN A;  4KG5 A;  2BAS A;  4OPR A;  2W27 A;  3G2Y A;  4QD4 A;  3UNW A;  1XA7 A;  3HLE A;  5M1A A;  2ZQ8 A;  3ZCZ A;  4IVK A;  1K54 A;  2ZM2 A;  4II7 A;  2WGW A;  2XQZ A;  4R3B A;  3NEC A;  4LRZ E;  3LUQ A;  5EE8 A;  5EVL A;  2M1C A;  4QY6 A;  4G3V A;  3WS2 A;  3HUN A;  4HNB A;  2Y2L A;  2IA2 A;  2L4R A;  4D2O A;  4OON A;  2W3F A;  1FOF A;  2ZC3 B;  5GLC A;  3NY4 A;  1OT9 A;  2W3H A;  3HRE A;  3UDI A;  2VV8 A;  4O01 A;  4I5S A;  3IF6 B;  1BUL A;  2P08 A;  4R6L A;  2M7V A;  4KZ3 A;  3LIA A;  3ZVW A;  3BEB A;  3HL9 A;  1HVB A;  2JKT M;  4HH3 A;  5A90 A;  4QPR A;  2ZC6 B;  1CJF A;  4E3I A;  1YT4 A;  2VK3 A;  4EWF A;  3KSH A;  4KZA A;  5D3O A;  5CER A;  2Y2N A;  3QP2 A;  4EER A;  2EX9 A;  4LV0 A;  3UO9 A;  1YLJ A;  3V5M A;  1K4E A;  3MKF A;  4DE3 A;  5JYP A;  4NXG A;  2XA7 S;  4H6J A;  3N8S A;  5CEB A;  1NYM A;  3N4I A;  2J3W A;  4U0T A;  2XK1 A;  3WWX A;  4ARZ A;  4KG2 A;  5EM1 A;  5G4Z A;  3D72 A;  1T1A A;  4JF4 A;  4R38 A;  3FV7 A;  1KOU A;  1PFL A;  1L3L A;  4ME4 A;  3H7W B;  3PAE A;  3W2Z A;  2CMN A;  1PYY A;  2KOI A;  3KYQ A;  1YPR A;  3D4F A;  3IHA A;  2PHY A;  5FSR A;  4BL2 A;  3FPW A;  4UAA A;  2WKP A;  4NKP A;  3ISG A;  1NJ4 A;  1FSY A;  4S2N A;  4YOF A;  4HQA A;  1LSW A;  1VET A;  3ZQ5 A;  2X01 A;  3Q82 A;  2JKF A;  3IXD A;  2O0Y A;  2Y4A A;  4G3K A;  1OPX A;  2XFS A;  2Y79 A;  5LBR A;  4MNR A;  1BZA A;  3SW1 A;  3LEZ A;  1BLS A;  4X53 A;  4ZJ1 A;  4Q8I A;  2XSS A;  4M4X A;  4KQO A;  4JLF A;  1L0D A;  2JKG A;  4N1X A;  5HPI A;  3TG9 A;  4E3N A;  2X02 A;  1K4F A;  1FR6 A;  3QP1 A;  3W4O A;  5AVF A;  5L07 A;  2VV6 A;  5CHM A;  1XPB A;  3LO7 A;  5TBM B;  1CI9 A;  4FD8 A;  5FI6 A;  4L0L A;  1RP5 A;  4GHI B;  4RVA A;  4DMZ A;  4MN5 A;  4ID4 A;  4JGR A;  1F9I A;  3WRT A;  3T1Q B;  3LY3 A;  4OOY A;  3BLS A;  1TEM A;  3IT9 A;  4R3J A;  5EVI D;  1GSV A;  3G2Z A;  4R23 A;  3N8L A;  4B93 A;  5F68 A;  3TE8 A;  3E4P A;  3IXH A;  4ZAM A;  3OPL A;  5EVI C;  1PNE A;  3GEC A;  4U3T A;  3C5A A;  5HWW A;  1HD8 A;  4GS9 B;  1SCW A;  3D3O A;  5FEG A;  2B02 A;  1MWS A;  5DF9 A;  4WF0 A;  4EBN A;  3BJN A;  4KUO A;  3B33 A;  2JKR I;  3CMZ A;  2Z2M B;  4OQG A;  4EUZ A;  2E8I A;  3CHW P;  3C8C A;  5CGW A;  4NG2 A;  4WBG A;  3IBR A;  1KVL A;  1X0O A;  4R3A A;  2J80 A;  2ZC4 B;  3UPO A;  3GR2 A;  4EET B;  4E6X A;  1D7E A;  1XXM A;  2V20 A;  4JGP A;  2HPB A;  3F1N A;  3ULF A;  3LI9 A;  4PM8 A;  4UQI S;  1TS6 A;  3S7P A;  2EX8 A;  1PW8 A;  3WRZ A;  2P74 A;  1OTE A;  3OOV A;  3A0R A;  3OLO A;  3T1R A;  3IH9 A;  4GKU A;  3TW8 A;  4JGO A;  1KE0 A;  1N9N A;  4GDB A;  1MZU A;  4K0W A;  2ZOI A;  3A3E A;  5GLA A;  1MBL A;  4PKY A;  4X25 A;  2V0U A;  4WM9 A;  3VSL A;  3N7W A;  4IUH A;  4WMC A;  4P87 A;  4CQH A;  4OPQ A;  1WE4 A;  1NRJ A;  2P9V B;  3QP8 A;  5HFO A;  4EES A;  3LIB A;  2HJ9 C;  2XH9 A;  3ZYT A;  1JWZ A;  3A3I A;  5TBM A;  1GCE A;  4EBP A;  1FIK A;  2V0W A;  4GHI A;  2WGI A;  4L9F A;  3IH8 A;  2I9V A;  4RX2 A;  4P6Z S;  2VKS A;  1PW1 A;  4JXG A;  4E3K A;  3H9W A;  3MZD A;  3IBJ A;  1P9R A;  1YLW A;  1YKD A;  2Z6C A;  2ZMA A;  4QJG A;  2WKR A;  4EEP A;  3HLG A;  1OTI A;  2L0W A;  2VZW A;  3TJZ C;  1K55 C;  1NYY A;  4X68 A;  1K56 A;  4WEK A;  1Q2Q A;  4ZRR A;  2Y2G A;  5TJJ A;  4LFU A;  2D01 A;  4K91 A;  5J4E A;  1CEG A;  2ZQC A;  3O88 A;  1YMX A;  1CEF A;  2L1M A;  1Y4O A;  4GCZ A;  4B4X A;  3PYP A;  4JF5 A;  4KZB A;  4YFM A;  2EFX A;  4LRY C;  3UPN A;  4GDN A;  3FPV A;  4WYY A;  2JE5 A;  3IX4 A;  1Y54 A;  4OQ0 A;  4X1L A;  4YIN A;  5J3W A;  2H10 A;  1YLZ A;  4KG6 A;  3FKV A;  1KE4 A;  2ZL1 B;  3DTM A;  2QZ6 A;  1TDG A;  3T4K A;  4WZ4 A;  4RA7 A;  3UB7 A;  3S22 A;  2WKQ A;  4WEJ A;  1GSX A;  5FEF A;  3GVB A;  4BD0 A;  4BMW A;  4P0M A;  2G7U A;  3MZF A;  2HP5 A;  2Y55 A;  4P6B A;  1DJB A;  4KEN B;  1VM1 A;  3NOU C;  1XGI A;  1MXO A;  1V9Y A;  5FQQ A;  2OWJ A;  3KYE A;  2Z6D A;  4DDY A;  4S2M A;  5FQ9 A;  3IS2 A;  1KGF A;  3R4K A;  3HCY A;  4GB7 A;  3OPH A;  3QP5 A;  2BTF P;  4LCL A;  5F1F A;  3BQ8 A;  1T18 A;  3RFB A;  5CTM A;  2ZOH A;  3MMH A;  5DF7 A;  1YMS A;  1JTG A;  1ZHH B;  3JPU A;  1G6A A;  1OJG A;  1L0F A;  1K0K A;  1ERQ A;  4Y15 A;  5IT5 A;  2BG1 A;  3K3C A;  2PR6 A;  3ZNT A;  3ZG5 A;  2FFY A;  5CHU A;  4HOI A;  3UE1 A;  3L9K A;  2QKP A;  1SDE A;  3OPR A;  3B42 A;  3HLD A;  3NHQ A;  1S4S A;  3G32 A;  1MKM A;  4N9K A;  1RCJ A;  4OQI A;  1Q2P A;  3IWQ A;  4Y0T A;  2H5S A;  5EV0 A;  4JBF A;  1ESU A;  2WKE A;  3EQV A;  2W1T B;  4D60 A;  2ZQ7 A;  3VP4 A;  2VGL S;  4B4Z A;  1BYW A;  1W79 A;  1BLP A;  3M2J A;  1DP6 A;  4BD1 A;  4LPZ A;  3G35 A;  4LRX C;  4KQQ A;  3DW0 A;  1OT6 A;  2HZ5 A;  5DVA A;  1ZTU A;  2JCH A;  4GN2 A;  4MCW A;  4UA9 A;  3TSG A;  2OAQ 1;  1H3Q A;  2PR5 A;  3OCN A;  4HIA A;  3PR6 A;  4GOG A;  1XGJ A;  1MWU A;  2A49 A;  5HL1 A;  5A91 A;  3C4O A;  1FCM A;  4X55 A;  4X1M A;  4LV1 A;  5A8B A;  4CLC A;  1L0E A;  4I39 A;  3C7V A;  5HDC A;  4HBU A;  2QHK A;  4F3L A;  3V3S A;  1DP8 A;  1ZG6 A;  2JHE A;  2RL3 A;  3NDG A;  3HJI A;  5CXW A;  5IS1 A;  5GLD A;  1CQA A;  4HP9 A;  3DWK A;  2IWD A;  3NOP C;  4UEY A;  1N4O A;  3BLM A;  4UA7 A;  1NWZ A;  4F94 A;  3VP2 A;  4EW7 A;  2EXB A;  3AGD A;  3P98 A;  3MZE A;  4X69 A;  3K2N A;  4HHD A;  3UB5 P;  1KGG A;  3EOI A;  3V50 A;  4NXB A;  4HI4 A;  5EFW A;  2GJ3 A;  2XD5 A;  2A2L A;  3RH8 B;  4WZ5 C;  1S1Z A;  4JXW A;  1LL9 A;  4O0P A;  1PZO A;  2V9A A;  2RCX A;  1K6S A;  3AGE A;  1S67 L;  4S2P A;  1CK3 A;  3QNB A;  1Z09 A;  4KZ8 A;  4JXS A;  1UWN X;  3F1P A;  1WYB A;  4BWI A;  2OLU A;  3SH8 A;  1K57 C;  4KQD A;  3S7N A;  2Y8H A;  5CGX A;  4NXE A;  2W1T A;  2GZA A;  2WYX A;  4P85 A;  2VA0 A;  3E4Q A;  4OOL A;  3GTC A;  1IFQ A;  4I3A A;  2HP9 A;  4Y5F A;  2XRO A;  5GLB A;  3UDF A;  4JF6 A;  3VV4 A;  1S6R A;  2DRW A;  5I5L A;  1SZV A;  5TFQ A;  4EXO A;  3MQ0 A;  1JWP A;  3Q7V A;  4KQR A;  4FUW A;  4E3L A;  1ES3 A;  3R7W B;  3O87 A;  3O3V A;  3A0S A;  4DJ3 A;  3MQO A;  3BW6 A;  2JC7 A;  4KUK A;  4ETZ A;  1OME A;  2WAF A;  4DF6 A;  5KSH A;  3UE6 A;  5TGF A;  2INW A;  3SH7 A;  1JNU A;  4KZ4 A;  3FZC A;  1T1C A;  1ZC2 A;  2VGK A;  1G68 A;  1V9Z A;  4EU0 A;  2YKF A;  4AFI A;  4RX3 A;  3MFD A;  2PD8 A;  3MS6 A;  3LI8 A;  2K7S A;  3UDX A;  3HUO A;  1YSP A;  4N92 A;  4NK3 A;  3SS3 A;  3E98 A;  2DCF A;  4WL9 A;  4LV2 A;  1KVM A;  1NRF A;  1SHV A;  3VP3 A;  1HLU P;  3IF6 A;  4GZB A;  2HJE A;  4QU3 A;  1IKI A;  1UWP X;  1CF0 A;  1CI8 A;  3FKW A;  3N6I A;  3BY9 A;  1Z6F A;  2QPN A;  3EGD C;  3W4Q A;  4ZJ3 A;  1HZO A;  5IHV A;  3IWO A;  3HLC A;  4Y3I A;  3BFG A;  4NEE D;  3V3R A;  5DJT A;  3O5Y A;  3U4L P;  1M6K A;  4Q0I A;  4IBR A;  5GHY A;  5CGS A;  1IEL A;  2HP6 A;  2KX6 A;  1HTZ A;  1WYC A;  3G31 A;  1E4D A;  2VV7 A;  1W8Y A;  3G4P A;  3D9Y A;  2P7J A;  5AQA A;  5L2F A;  5HX9 A;  2H0T A;  3NDE A;  1S4R A;  2HV1 A;  3PHY A;  1RGZ A;  5DKL A;  3H7W A;  2QWS A;  1F5M A;  4ESP A;  3LR4 A;  2PDR A;  2EWW A;  3BY8 A;  4QWO A;  3IX3 A;  5FQK A;  3A3D A;  2GX5 A;  3R7W A;  5L8M A;  3O86 A;  2K31 A;  1TDL A;  1F98 A;  4Y0O A;  3UE3 A;  3Q7Z A;  2GDN A;  1YSQ A;  3IWI A;  3EEA A;  1I2W A;  2V8C A;  2JKR M;  1H8Z A;  3CI6 A;  2O9A A;  1DJA A;  1N9B A;  3CLO A;  4E6W A;  1ES2 A;  3GQZ A;  1GA9 A;  3E0Y A;  4XXR A;  4BBU A;  1BLH A;  3NJA A;  1KE3 A;  5EVI B;  2V1B A;  3QP6 A;  2NUP C;  3VSK A;  3NI9 A;  3ZGA B;  4GLQ A;  3HLW A;  2XR0 A;  3LFV A;  4ZTK A;  4L9E A;  3KX0 X;  1GHM A;  2WKH A;  2HGV A;  5HWV A;  4WUJ A;  1E3U A;  4Q0H A;  4HEF A;  2R9W A;  5AQ7 A;  5MC7 A;  3Q1F A;  2PU4 A;  1F2K A;  1K6R A;  2NUT C;  3CWF A;  4I3I A;  3CPT B;  3HVF A;  2R9X A;  1IYO A;  3FC7 A;  1OTB A;  4CLC D;  5E2E A;  1XKZ A;  1PI4 A;  3HBR A;  4FH2 A;  3PBQ A;  2VGJ A;  5U47 A;  2EX2 A;  3VOZ A;  4E3J A;  5HAQ A;  2KLI A;  5DF8 A;  1XFQ A;  4CLC C;  1KGE A;  2OWH A;  1SDN A;  2ZQD A;  3EWK A;  5A93 A;  4YNR A;  3VFF A;  5HL6 A;  3ITB A;  1ONH A;  1QME A;  2IWC A;  5FA7 A;  4EEU A;  1K54 C;  1IKG A;  3V67 A;  5DTT A;  3T1X A;  4GD8 A;  5F83 A; 
#chains in the Genus database with same CATH homology
 1YQS A;  4N9K A;  4KZA A;  5D3O A;  3MBZ A;  5F1G A;  5CER A;  1RCJ A;  2Y2N A;  4H8R A;  4OQI A;  1Q2P A;  5FI2 A;  4EV4 A;  3S1Y A;  3IWQ A;  4K0X A;  3NIA A;  2OV5 A;  1ES4 A;  2EX9 A;  2H5S A;  4Y0T A;  1DY6 A;  4LV0 A;  3UO9 A;  1ERO A;  3FWL A;  1YLJ A;  4JBF A;  4PM7 A;  4DDS A;  4EQI A;  1ESU A;  1K4E A;  2WKE A;  3G34 A;  3MKF A;  2EX6 A;  3V5M A;  4DE3 A;  3EQV A;  4N1H A;  3BM6 A;  5JYP A;  3PBR A;  4XUX A;  1GHI A;  5CEB A;  3N8S A;  2A3U A;  1NYM A;  3QHY A;  3N4I A;  4U0T A;  2XK1 A;  2ZQ7 A;  5J8X A;  3VP4 A;  3WWX A;  4S2K A;  1GA0 A;  4KG2 A;  1ES5 A;  3VMA A;  3SOI A;  4B4Z A;  4BEN A;  1W79 A;  1BLP A;  3M2J A;  5F82 A;  1DJC A;  3PBN A;  4BD1 A;  1I2S A;  2Y2M A;  5FI7 A;  4JF4 A;  3RXX A;  4PPR A;  4OP5 A;  2XEP A;  3FV7 A;  3G35 A;  4KZ9 A;  2XLN A;  4KQQ A;  3DW0 A;  5I94 A;  5DVA A;  1ONG A;  2C5W B;  2JCH A;  4GN2 A;  4UA9 A;  3NCK A;  4MBF A;  4KZ7 A;  3TSG A;  1K38 A;  5KZH A;  3BFE A;  3PAE A;  4QB8 A;  3OCN A;  4GOG A;  1XGJ A;  1MWU A;  3NC8 A;  2A49 A;  3MXR A;  1BSG A;  1MY8 A;  1PYY A;  4CJN A;  1PI5 A;  5HL1 A;  1JTD A;  3D4F A;  3IHA A;  5A91 A;  3OPP A;  5FSR A;  4BL2 A;  3C4O A;  4UAA A;  1FCM A;  1K25 A;  4X55 A;  4DE1 A;  4LV1 A;  4ZDX A;  1L0E A;  3A3J A;  4OKP A;  3P09 A;  3C7V A;  3ISG A;  4IBX A;  1NJ4 A;  1FSY A;  2Y91 A;  4HBU A;  4S2N A;  4WZ5 A;  5AQB A;  4A5R A;  5EOE A;  4FH4 A;  4HBT A;  3HLF A;  3Q82 A;  4OLD A;  3IXD A;  4U0X A;  2PBY A;  2Y4A A;  5DTS A;  5AQ9 A;  3SS5 A;  3V3S A;  3Q81 A;  2Y2O A;  1BT5 A;  1ZG6 A;  2XFS A;  2RL3 A;  2ZLY A;  3IXB A;  1JVJ A;  4GD6 A;  4O7D A;  4R1G A;  1LL5 A;  1U60 A;  3NDG A;  1MWT A;  4MNR A;  5CXW A;  1BZA A;  4NET A;  3CJM A;  4C6Y A;  5GLD A;  4BQM A;  2ZD8 A;  4S2O A;  4PM9 A;  2WGW B;  3LEZ A;  1PIO A;  1IEM A;  1BLS A;  4X53 A;  5HAR A;  4ZJ1 A;  1K57 A;  1L2S A;  4E3O A;  5JYO A;  3WS5 A;  3DWK A;  2IWD A;  5EVI A;  4Q8I A;  3W8K A;  1N4O A;  4GNU A;  4IVI A;  3BFF A;  4KQO A;  1BTL A;  4JLF A;  1L0D A;  1H8Y A;  3BLM A;  4OQH A;  2J8Y A;  4UA7 A;  4N1X A;  4DE0 A;  4F94 A;  3TG9 A;  4DE2 A;  3VP2 A;  3E2K A;  4E3N A;  3SH9 A;  2X02 A;  2EXB A;  1FR1 A;  2P9V A;  3AGD A;  3P98 A;  4OPZ A;  1K4F A;  1FR6 A;  3MZE A;  4X69 A;  3W4O A;  3PBO A;  1LI0 A;  2WUQ A;  3WS1 A;  1KGG A;  3LY4 A;  3ZG8 B;  5CHM A;  4R0Q A;  1XPB A;  3BYD A;  3LO7 A;  3V50 A;  2CC1 A;  4DRT A;  1ALQ A;  1CI9 A;  3NBL A;  4FD8 A;  5FI6 A;  4L0L A;  1RP5 A;  3OZH A;  2XD5 A;  1W8Q A;  3S4X A;  4Y0U A;  4RVA A;  3V39 A;  3ZG9 B;  4DXC A;  2J9P A;  2Y2P A;  4ID4 A;  4S2N C;  4WZ5 C;  4X56 A;  5HAI A;  3WRT A;  5GL9 A;  3LY3 A;  1NZU A;  4OOY A;  4JXW A;  1LL9 A;  2QMI A;  4OH0 A;  4R4S A;  1YLT A;  4S2L A;  1PZO A;  2J9O A;  3BRM A;  3BLS A;  1TEM A;  3IT9 A;  2J7V A;  2RCX A;  4R3J A;  2V1Z A;  4BJP A;  3JYI A;  1K6S A;  3AGE A;  5EVI D;  3DWZ A;  5E2G A;  4S2P A;  1CK3 A;  3QNB A;  2OSU A;  3G2Z A;  4KZ8 A;  4R23 A;  3N8L A;  4JXS A;  2BLS A;  4C75 A;  1WYB A;  2OLU A;  3LCE A;  3SH8 A;  3EQU A;  1K57 C;  3IXH A;  4ZAM A;  3OPL A;  5EVI C;  1I5Q A;  4OOM A;  2Z2L B;  4UA6 A;  3GMW A;  5CGX A;  1SKF A;  4U3T A;  1XP4 A;  2WYX A;  3C5A A;  1HD8 A;  4P85 A;  4LEN A;  3TOI A;  4OOL A;  3GTC A;  2XFT A;  1SCW A;  5G18 A;  5FQI A;  5HAP A;  1E25 A;  2Y2K A;  2HP9 A;  4OP8 A;  2Y2J A;  2WAD A;  1MWS A;  5DF9 A;  3VP1 A;  1XX2 A;  5GLB A;  3UDF A;  4JF6 A;  3ZHH A;  2ZQ9 A;  5EPH A;  3WS0 A;  4EBN A;  1J9M A;  4FCF A;  4XUZ A;  1S6R A;  3ZFZ A;  4OVD A;  2DRW A;  3CMZ A;  1TVF A;  2Z2M B;  3Q07 A;  2HDR A;  5TFQ A;  1W7F A;  3IF6 C;  4DXB A;  4OQG A;  3VOY A;  1JWP A;  4EUZ A;  2E8I A;  1NZO A;  3Q7V A;  4KQR A;  1ERM A;  5CGW A;  3IQA A;  3WS4 A;  5GHZ A;  1ES3 A;  4E3L A;  3O87 A;  3O3V A;  4WBG A;  1KVL A;  1GHP A;  2ZC4 B;  3UPO A;  2HDS A;  4FSF A;  4HES A;  3GR2 A;  2H0Y A;  3N8R A;  3CG5 A;  3A3F A;  2G2U A;  2JC7 A;  4E6X A;  3GRJ A;  4N9L A;  4UHU A;  1OME A;  2XF3 A;  1XXM A;  2V20 A;  2WAF A;  4DF6 A;  5KSH A;  2HPB A;  1EWZ A;  5TGF A;  4QHC A;  1RGY A;  1KDS A;  4EBL A;  5EUA A;  3SH7 A;  3ITA A;  4BLM A;  1W5D A;  5DTK A;  3GV9 A;  4KZ4 A;  2WZZ A;  3FZC A;  4CPK A;  4PM8 A;  4PM5 A;  2EFU A;  2ZQA A;  3MXS A;  2V2F F;  5CRF A;  1S0W A;  2Q9N A;  2EX8 A;  1PW8 A;  3WRZ A;  1ZC2 A;  2VGK A;  1LI9 A;  2Y2Q A;  1G68 A;  2P74 A;  1K55 A;  2WK0 A;  3UE0 A;  1O7E A;  2X71 A;  3IH9 A;  4WEL A;  4X6T A;  4GKU A;  3M6H A;  2Y2I A;  1AXB A;  4RX3 A;  1KE0 A;  4GDB A;  4K0W A;  3A3E A;  1YLY A;  3W4P A;  5GLA A;  3MFD A;  2C6W B;  1MBL A;  2WAE A;  4LCM A;  3OCL A;  5FAO A;  2Q9M A;  4WM9 A;  3VSL A;  3UDX A;  3HUO A;  3N7W A;  4N92 A;  5M19 A;  4WMC A;  4NK3 A;  4P87 A;  4OPQ A;  3SS3 A;  1WE4 A;  2UWX A;  2P9V B;  2DCF A;  2WKI A;  5HFO A;  5A92 A;  4LV2 A;  5HW3 A;  1KVM A;  3PBS A;  2XH9 A;  5FDH A;  4PMA A;  2HDU A;  1NRF A;  1SHV A;  4JXV A;  2HDQ A;  3VP3 A;  1JWZ A;  3A3I A;  3IF6 A;  2DNS A;  4GZB A;  1GCE A;  4QU3 A;  4EBP A;  3PBT A;  1IKI A;  2X01 A;  3B3X A;  4JKT A;  1CI8 A;  5GHX A;  3FKW A;  1BUE A;  4E3M A;  3N6I A;  2WGI A;  1M40 A;  1PWG A;  2EXA A;  3IH8 A;  4RX2 A;  2FFF B;  1PW1 A;  4JXG A;  4C3Q A;  4E3K A;  3CZD A;  4JPM A;  1FSW A;  1Z6F A;  4Y7P A;  2IWB A;  2QPN A;  3MZD A;  1L0G A;  4M3K A;  5FAP A;  3VP0 A;  1YM1 A;  3W4Q A;  1PZP A;  4ZJ3 A;  1HZO A;  1YLW A;  3PAG A;  5IHV A;  1NY0 A;  3IWO A;  3HLC A;  2ZMA A;  3BFG A;  4QJG A;  3HLG A;  3V3R A;  4ZJ2 A;  3VFH A;  5M18 A;  3G30 A;  3UN7 A;  1NXY A;  2XD1 A;  4KZ6 A;  1K55 C;  1NYY A;  4X68 A;  1K56 A;  4WEK A;  1M6K A;  1Q2Q A;  3ZG7 B;  3ZDJ A;  2Y2G A;  4IBR A;  4WMC D;  4ZBE A;  3BFD A;  4K91 A;  5GHY A;  5CGS A;  5FQM A;  1IEL A;  1IYQ A;  1VQQ A;  5KSC A;  2HP6 A;  1E3U D;  1CEG A;  1HTZ A;  2ZQC A;  3PTE A;  3ZG0 A;  5CTN A;  1WYC A;  3G31 A;  3O88 A;  4B88 A;  1E4D A;  1YMX A;  3HLB A;  1W8Y A;  3G4P A;  3C7U A;  4BL3 A;  3ZNY A;  1CEF A;  2ZC5 B;  5FAQ A;  2ZJ9 A;  5AQA A;  5L2F A;  4B4X A;  1PWD A;  4JF5 A;  3ZVT A;  4KZB A;  4YFM A;  4MBH A;  2G2W A;  2EFX A;  5HX9 A;  2H0T A;  3NDE A;  3UPN A;  4GDN A;  1YLP A;  4WYY A;  5EOO A;  2JE5 A;  1Y54 A;  1MPL A;  2I72 A;  1RGZ A;  4OQ0 A;  3RJU A;  5E2H A;  5BOH A;  2B5R A;  4YIN A;  2H10 A;  5E43 A;  3IF5 A;  2WZX A;  4R4R A;  1QMF A;  1YLZ A;  4KG6 A;  2OLV A;  5FQK A;  3FKV A;  3UY6 A;  4DKI A;  1KE4 A;  2Y59 A;  1FCO A;  4MLL A;  4S2J A;  5CED A;  2PU2 A;  3FYZ A;  3HUM A;  3DTM A;  3BEC A;  2QZ6 A;  3A3D A;  1TDG A;  3I7J A;  3Q7V B;  2ZM0 A;  3IXG A;  3O86 A;  1K56 D;  4RA7 A;  4S2I A;  4WZ4 A;  3S22 A;  3M6B A;  3UPP A;  1TDL A;  1EI5 A;  1LHY A;  3RXW A;  4Y0O A;  3GSG A;  4OLG A;  1LLB A;  3IHB A;  3Q7Z A;  4WEJ A;  3UE3 A;  2GDN A;  3GVB A;  4BD0 A;  1BLC A;  1IYP A;  2XGN A;  4KG5 A;  4OPR A;  3IWI A;  4P0M A;  3G2Y A;  1I2W A;  3MZF A;  2HP5 A;  2Y55 A;  1XA1 A;  1H8Z A;  1DJB A;  4P6B A;  4KEN B;  1MKI A;  1DJA A;  1N9B A;  4LV3 A;  4QD4 A;  3UNW A;  4QY5 A;  1XA7 A;  1VM1 A;  3HLE A;  5M1A A;  1O07 A;  4E6W A;  2ZQ8 A;  3ZCZ A;  1XGI A;  1KDW A;  4IVK A;  5FAT A;  1K54 A;  1ES2 A;  3BFC A;  1MXO A;  2ZM2 A;  3GQZ A;  2JBF A;  1GA9 A;  2WGW A;  2XQZ A;  4R3B A;  4XXR A;  5FQQ A;  3M2K A;  1MWR A;  5E2F A;  1BLH A;  5FAS A;  1KE3 A;  2ZM8 A;  5CEC A;  5EE8 A;  5EVL A;  4DDY A;  4QY6 A;  5EVI B;  4S2M A;  3WS2 A;  5FQJ A;  3HUN A;  3VSK A;  3MKE A;  4OPY A;  5FQ9 A;  3NI9 A;  3ZGA B;  2Y2L A;  2XR0 A;  3HLW A;  1KGF A;  3E2L A;  5CHJ A;  4ZTK A;  4D2O A;  1ESI A;  1C3B A;  4GB7 A;  3OPH A;  4OON A;  1GHM A;  2WKH A;  4LCL A;  5F1F A;  1ZKJ A;  1H5X A;  1E3U A;  1FOF A;  2ZC3 B;  5GLC A;  1PWC A;  4HEF A;  3NY4 A;  5CTM A;  5KMW A;  2R9W A;  5AQ7 A;  3HRE A;  3Q1F A;  2PU4 A;  4Z9Q A;  3C4P A;  3UDI A;  5DF7 A;  1K6R A;  1FCN A;  1YMS A;  5EEC A;  1JTG A;  3HVF A;  2R9X A;  1IYO A;  2ZC7 A;  4KZ5 A;  1G6A A;  1L0F A;  2Y2H A;  5E2E A;  4PM6 A;  1ZG4 A;  1XKZ A;  2WGV A;  3SS4 A;  1PI4 A;  1ERQ A;  3HBR A;  3PBQ A;  3IF6 B;  4FH2 A;  2VGJ A;  1BUL A;  5U47 A;  2BG1 A;  2EX2 A;  3AGF A;  3VOZ A;  4RYE A;  1JWV A;  4E3J A;  5TR7 A;  5HAQ A;  3ZNT A;  3ZG5 A;  2FFY A;  4KZ3 A;  5CHU A;  5DF8 A;  3ZVW A;  1FQG A;  1KGE A;  3UE1 A;  3BEB A;  3HL9 A;  1HVB A;  1SDE A;  1SDN A;  2ZQD A;  5A93 A;  3VFF A;  5A90 A;  3ITB A;  3OC2 A;  1ONH A;  3OPR A;  3QNC A;  1QME A;  2ZC6 B;  2IWC A;  2XDM A;  3HLD A;  5FA7 A;  1K54 C;  4MBK A;  1IKG A;  4IED A;  4E3I A;  1YT4 A;  5DTT A;  3G32 A;  4GD8 A;  5F83 A;  4EWF A;  1IYS A;  4MEZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...