4NEXA

Structure of the n-acetyltransferase domain of x. fastidiosa nags/k
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
157
structure length
157
Chain Sequence
SSGLVPRGSHMVIRATTWKDLDLPRLQHLIQSSFRRTLIPHYFETTPLLRAYVSENYRAAVILTKLGNVPYLDKFAVLDDAQGEGLGRAVWSIMREETPQLFWRSRHNNQANAFYYAESDGYYKQDHWKIFWNGLHHFQQIQQCVAHCTQHPPTLID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of the N-acetyltransferase domain of Xylella fastidiosaN-acetyl-L-glutamate synthase/kinase with and without a His tag bound to N-acetyl-L-glutamate.
pubmed doi rcsb
source organism Xylella fastidiosa temecula1
molecule tags Transferase
molecule keywords Acetylglutamate kinase
total genus 48
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature ec 2.7.2.8: Acetylglutamate kinase.
pdb deposition date 2013-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4nexA00
2VZZA 5EC4A 1MJAA 3H4QA 2Q44A 2BL1A 5JQ4A 1KZFA 5JPHA 5H84A 2VEZA 2HV2A 3FB3A 1XMTA 5F46A 4L89A 1RXTA 2B58A 1IB1E 3BJ7A 3VWEA 4B5OA 4KOTA 1QSRA 3LODA 1I12A 1YVOA 3R9EA 1CJWA 2R8VA 1B6BA 4AG7A 3S6KA 2ZW4A 4KVME 2CNTA 4FD7A 4J3GA 5KTDA 2RC4A 1VKCA 2VZYA 4UWIA 3IWGA 2Q4VA 2ARHA 3G8WA 4KOSA 4MY0A 1N71A 2OU2A 3EFAA 3PZJA 3EY5A 2I00A 4MJ8A 4YFJA 1S3ZA 1Z4EA 3D3SA 1BOBA 4RI1A 1L0CA 1XE4A 4HKFA 4QC6A 1LRZA 1KUYA 3F5BA 4B5PA 5HMNA 2O28A 3FXTA 4BMHA 1S60A 3VWDA 2FCKA 4IF5A 2CNSA 4II9A 3SHPA 1WK4A 1S7FA 3F0AA 2Q0YA 3QAHA 1YGHA 4NEXA 2Q7BA 4H6UA 1NSLA 4PSXA 4KOYA 3TO7A 4KOWA 5F49A 4U9ZA 4OAEA 2GIVA 4OLLA 2PQ8A 4KVOE 5F47A 3ZJ0A 2FIAA 2D4OA 1IIDA 2PR8A 4NCZA 1QSOA 3N7ZA 1TIQA 4XPLA 1YVKA 4R87A 2QMLA 4B5PB 1U6MA 1M1DA 3S6HA 2FSRA 1Q2DA 2ZW5A 3OWCA 4HNXB 4H89A 2D4PA 2R98A 3V8IA 2Z11A 1P4NA 3DSBA 5F48A 2OZHA 2JLMA 2Q04A 2Z0ZA 1NMTA 1WWZA 3EO4A 3W6XA 3S6FA 3FRMA 4JXQA 4AVCA 4JLYA 5IB0A 3EC4A 4YGOA 5H86A 4HNWB 1QSNA 2HUZA 5J8CA 1XIXA 2OH1A 4NXYA 1PU9A 1XF8A 4R3LA 2GE3A 2Z10A 3TCVA 2PDOA 3TO6A 1M44A 2CNMA 3I3GA 4FD6A 2AE6A 2B3VA 5DWMA 4AB7A 4E0AA 3MGDA 4E8OA 1B87A 2EUIA 4L8AA 1NE9A 1Z9UA 2ATRA 2AJ6A 2B4DB 4KUBA 4XPKA 1MJBA 4KOXA 3DNSA 4PK3A 1CM0A 2J8MA 2PC1A 3SXNA 1Q2CA 4CRZB 3TO9A 2FT0A 4KUAA 3I9SA 1S7NA 2JEVA 4UA3A 4MY3A 4PSWA 5FVJA 4OADA 3FIXA 2R7HA 2I79A 3TOBA 2P6FA 3W6SA 2FXFA 5CNPA 2VI7A 1XEBA 1M4IA 2ZXVA 2OZGA 1I1DA 4JXRA 1M4GA 4DNCA 4U9YA 4K30A 4EVYA 4R57A 2VBQA 3R9FA 3GKRA 3T90A 2REEA 5J8FA 3D2MA 1K4JA 1Y9KA 2P6EA 3LD2A 3CXSA 3JUWA 3D2PA 2B4DA 4XNHB 4HNYB 5C82A 3DR6A 4GS4A 4MBUA 2OB0A 1IYKA 2HQYA 4ZBGA 3FYNA 3E0KA 3UY5A 3C26A 1IYLA 3NE7A 3P2HA 4F0YA 1GHEA 2F5IA 2FL4A 4QUSA 4R3KA 3D8PA 3CXPA 2Y0MA 4I49A 5E96A 4IUSA 4Y49C 2EVNA 2G3AA 4XPDB 2WPXA 5ISVA 2FS5A 4CAVA 4KLWA 2GANA 1BO4A 1YLEA 2B5GA 4UBRA 2NMTA 5KTCA 2VQYA 3BJ8A 2OZUA 2P6GA 1SQHA 5C88A 3FBUA 2PSWA 2B4BA 4XNHC 3K9UA 2A4NA 3CXQA 2G0BA 4M3SA 3TFYA 5IV0A 2KCWA 2CY2A 2ZPAA 2JDCA 1YR0A 2G3TA 1MJ9A 4CS0B 3ZZIA 2FIWA 4ONUA 4Y49B 5I0CA 2BSWA 1S7LA 5IX3A 4CRYB 3W91A 3TOAA 1YREA 1IICA 1ON0A 1QSTA 5HH1A 3R9GA 3IGRA 2Q4YA 1QSMA 3DDDA 3R95A 4NF1A 4F6AA 1Q2YA 2H5MA 2B5GB 3SXOA 1PUAA 4KLVA 4PK2A 2P0WA 3PGPA 4E2AA 1M4DA 3WR7A 4RS2A 2ZW7A 3QB8A 5DWNA 2BEIA 2QECA 2IL4A 2PRBA 3TT2A 1Y9WA 4FD5A 3F8KA 1S5KA 2R1IA 3TTHA 2BUEA 2REFA 4KVXA 4U5YA 3TE4A 4ORFA 4MHDA 1R57A 3PP9A 3G3SA 1MK4A 2QIRA 4KOVA 4PV6A 1UFHA 4H6ZA 2ZW6A 3FNCA 4YRHA 3R96A 3P2FA 4QBJA 1Y7RA 1S7KA 4AVBA 4LX9A 2X7BA 1YX0A 1YK3A 3DR8A 4JD6A 4AG9A 1V0CA 3JVNA 4R9MA 5GCNA 5EBVA 4KZTA 4FD4A 3KKWA 3S6GA 3T9YA 1KUVA 3RYOA 4NSQA 4JWPA 3B8GA 2J8NA 4LUAA 1RO5A 2B3UA 4JJXA 4QVTA 2K5TA 2DXQA 4CAWA 3BLNA 1P0HA 2C27A 3GYAA 4MI4A 4KORA 5KTAA 1OZPA 2JDDA 4XPDC 1VHSA 4KOUA 1I21A 2VXKA 4UWJA 3R1KA 1Z4RA 2PR1A 1KUXA 4M85A 4CAXA 2WPWA 4QB9A 2FE7A 3GY9A 1J4JA 3EXNA 4AVAA 1FY7A 4X5KA 2J8RA
chains in the Genus database with same CATH superfamily
2VZZA 1X12A 5EC4A 1MJAA 1R3NA 3D7FA 2PIYA 3H4QA 3SI0A 4BBHA 2Q44A 2BL1A 1CP6A 3D7DA 4NGPA 5JQ4A 4P4IA 4ZX8A 1KZFA 3KR4A 5JPHA 2QYVA 5H84A 2VEZA 3FEDA 2HV2A 1XOVA 3PB4X 3FB3A 1XMTA 5F46A 4L89A 1RXTA 1ZLHA 2PJ2A 2B58A 2QJ8A 1IB1E 2EK9A 2V8VA 3PB6X 3BJ7A 3JRUA 3KHZA 1ZG7A 5LYIA 1ZG9A 3VWEA 4R76A 4UIAA 4B5OA 4KOTA 1QSRA 3LODA 4UEFA 1JWQA 1VGYA 4P6YA 2EWBA 1I12A 1YVOA 4M6GA 2J9AA 3R9EA 3V38A 1CJWA 2R8VA 2GLFA 3IU2A 1B6BA 2PRQA 2V8HA 2C1CA 4AG7A 3S6KA 4WJBA 2ZW4A 3S9NA 4KVME 3D4UA 2Z3LA 2CF4A 2CNTA 4MRIA 4FD7A 4J3GA 2ZOFA 5KTDA 4KSAA 1TXRA 2RC4A 1VKCA 1Z2LA 2VZYA 2XEGA 1IGBA 4CYPA 4UWIA 3IWGA 5HVFA 4P4DA 2Q4VA 4TNUA 4YU9A 1QQ9A 2ARHA 3G8WA 2AFOA 4KOSA 4MY0A 3V7ZA 1N71A 2OU2A 3EFAA 2GU2A 3PZJA 5ELYA 4OC4A 4UFWA 1LOKA 3EY5A 2I00A 3WC7A 4MJ8A 4YFJA 1S3ZA 1LANA 4CYOA 1Z4EA 3D3SA 1BOBA 2PJBA 2PCUA 2PJ6A 4RI1A 4ZX9A 1L0CA 1XE4A 4HKFA 1XRYA 5AG7A 1LFWA 5K8NA 1GYTA 2Q4ZA 1HEEA 1LRZA 4QC6A 4C7HA 1KUYA 3F5BA 3D66A 1F2PA 4B5PA 4A31A 3KGQA 2C6CA 5HMNA 2Z3NA 3B7IA 2BOAA 2O28A 3FXTA 2DEAA 4BMHA 1Z8LA 2ZENA 4P4EA 3QAYA 1AYEA 1OBRA 1S60A 1CBXA 3VWDA 2FCKA 4IF5A 4P4BA 2CNSA 4II9A 2V8GA 3SHPA 4Q7AA 4PXBA 1WK4A 4PXDA 4UCNA 1LAMA 1S7FA 3F0AA 2ODFA 2Q0YA 3QAHA 4R7MA 2PE3A 4NJQA 4P45A 1YGHA 2GLJA 3B3SA 4NEXA 2YNCA 3KHXA 4FBEA 3IO1A 2Z3OA 4PPZA 3KQZA 3FF3A 2Q7BA 4H6UA 4A37A 1F57A 2AFZA 1NSLA 4PSXA 3PBEA 4KOYA 1YW6A 2WUUA 3ISXA 1IOIA 4KOWA 3BI0A 2RB7A 3TO7A 6CPAA 5F49A 4U9ZA 1ZO0A 2PJ4A 4OAEA 3S9MA 2GIVA 1HDUA 4OLLA 2VL1A 1FT7A 2PQ8A 4KVOE 1DTDA 1VHEA 3BXMA 3PEIA 3NH8A 4A95A 5AG5A 5F47A 3ZJ0A 4EFDA 2FIAA 3LMSA 1YSJA 1R43A 2D4OA 1IIDA 4BINA 5A27A 2PR8A 4G1PA 1PYTB 3IIBA 4NCZA 2O53A 3CT9A 1QSOA 1ELMP 3H8EA 3N7ZA 4UFVA 2AFWA 3WC5A 1TIQA 4Q36A 1YVKA 4M6HA 2WSAA 4XPLA 4R87A 2QMLA 4B5PB 3B3TA 4UF4A 1U6MA 4NGTA 1M1DA 3S6HA 2FSRA 1Q2DA 2ZW5A 3OWCA 4NGQA 4HNXB 4H89A 4UCMA 3RBUA 1JQGA 2D4PA 2I3CA 2R98A 1H8LA 2Z11A 3V8IA 4DJLA 1P4NA 3DSBA 1YLOA 4NGRA 5F48A 3FVLA 4X2TA 2OZHA 2JLMA 2Q04A 2Z0ZA 4RN7A 1NMTA 1WWZA 3EO4A 2ZEPA 4MCRA 3W6XA 2PJAA 3S6FA 3FRMA 4JXQA 1EE3P 2IMOA 3KASA 4PQAA 4AVCA 2C6GA 4JLYA 3EC4A 4OKOA 5IB0A 3FJUA 2O4HA 3BI1A 4YGOA 3NA6A 2EO8A 5H86A 3VH9A 3SJXA 3NE8A 4HNWB 1QSNA 2IQ6A 2HUZA 5J8CA 1XIXA 2OH1A 4NXYA 4R6TA 1PU9A 3IWEA 4A38A 1XF8A 4R3LA 4A32A 2GE3A 2Z3MA 5J1QA 4GM5A 2Z10A 3TCVA 2PDOA 4MFZA 3TO6A 1M44A 3T8WA 4CGMA 2CNMA 3I3GA 4FD6A 2AE6A 2B3VA 4MCSA 4OC1A 5AG6A 4B11A 5DWMA 4B10A 4MCQA 4AB7A 4E0AA 1RTQA 4CAFA 3MGDA 4C2ZA 2CTCA 4E8OA 1B87A 2PJ9A 5HVHA 2EUIA 2BCOA 4GXHA 4L8AA 7CPAA 1NE9A 5HVGA 1Z9UA 3GLJA 3PBBA 5G1ZA 4HPSA 1F2OA 4EMEA 2ATRA 3NFZA 1Z8XA 1LAPA 2AJ6A 4OP4A 2B4DB 4KUBA 2JBJA 4XPKA 3DLJA 1MJBA 4KOXA 2F8HA 3DNSA 1HDQA 3WABA 3WT4A 8CPAA 4A30A 4PK3A 1CM0A 2J8MA 3ISZA 2PJ7A 4DYOA 1TKHA 3IJ3A 2Z3PA 2PC1A 3CZXA 3IEHA 4MXUA 3SXNA 1Q2CA 4P44A 1VIXA 2PJ8A 2F7VA 2JEWA 3B3VA 3TO9A 4CRZB 2FT0A 2Q7SA 4RUHA 3IC1A 2AFSA 1XMBA 4KUAA 2DPTA 1S7NA 1IY7A 2JEVA 2IJZA 3I9SA 4MY3A 4PSWA 4UA3A 4F8ZA 4OC3A 3B2YA 3WC6A 3CDXA 4OMEA 2OOTA 4CYNA 5FVJA 2AFMA 3MRUA 2CXAA 4OADA 2AFUA 3FIXA 2R7HA 2I79A 3TOBA 2P6FA 1BLLE 1TF8A 2NSMA 2ZEDA 1ZLIA 2FXFA 3FEEA 3W6SA 5K8MA 5CNPA 4UEEA 5LYDA 2VI7A 5K8PA 1XEBA 4IHMA 4OC5A 1M4IA 2ZEGA 2OZGA 1I1DA 2ZXVA 1M4GA 4JXRA 2ZEEA 4K30A 2PJ1A 4U9YA 4DNCA 4EVYA 4R57A 2VBQA 3R9FA 3GKRA 3T90A 2REEA 5J8FA 4NGSA 2YNCC 4PXCA 3D2MA 2XEJA 1K4JA 4JZ0A 4OC0A 3GB0A 1Y9KA 1BAVA 2P6EA 2YNEA 3LD2A 5D8NA 3CXSA 2ANPA 3GUXA 3JUWA 4FWUA 4CGPA 4BD9A 3D2PA 4ONWA 1XBUA 4NFRA 5G22A 2B4DA 3D7GA 5F09A 3FH4A 4LQ6A 2C6PA 2Q43A 4XNHB 4HNYB 2HB6A 3FECA 5C82A 3DR6A 5LRKA 4GS4A 4P4FA 3TX8A 4MBUA 2OB0A 4NGNA 1IYKA 1LCPA 2GFQA 2HQYA 3B3WA 3FX6A 4ZBGA 4Z65A 1Z8TA 3FYNA 1Y7EA 3E0KA 4MHPA 3UY5A 1BPNA 3C26A 1IYLA 2EK8A 3NE7A 3P2HA 4F0YA 1GHEA 2F5IA 2RFHA 2AFXA 2FL4A 4QUSA 4R3KA 4UFXA 3D8PA 4ZYQA 3CXPA 2Y0MA 4FUUA 1YW4A 2PJ0A 4I49A 4KS9A 1Y0RA 2Q51A 3FMCA 4Q38A 5E96A 3NH5A 3KI9A 2ZELA 3CPAA 4AXVA 4IUSA 1QMUA 3RNZA 4Y49C 2EVNA 4CGNA 3H8FA 2G3AA 2XEIA 2WPXA 4XPDB 2EBJA 3VATA 5ISVA 2FS5A 4CAVA 4KLWA 1YMEA 2GANA 1BO4A 1YLEA 2B5GA 4UBRA 2NMTA 5KTCA 1ARMA 4A33A 2VQYA 1CPXA 3BJ8A 3IWWA 2OZUA 2P6GA 4MFPA 1SQHA 3VARA 5C88A 3FBUA 1ARLA 2PSWA 2B4BA 4XNHC 3KZWA 3K9UA 3DGVA 2A4NA 3KQXA 5A28A 1NSAA 4OIDA 5HXDA 1BPMA 5CPAA 3LACA 4MFLA 2YGWA 3PFEA 3SI2A 4IAVA 4X8IA 3CXQA 2DPSA 2G0BA 4M3SA 3TFYA 2V8DA 4UIBA 3H5ZA 4B6ZA 2KCWA 3PB8X 2PVVA 2ZEOA 4B12A 2CY2A 1YQEA 4MFQA 5IV0A 2ZPAA 2BO9A 2JDCA 5AG4A 1AMPA 1DE4C 1YR0A 3PB9X 3RZAA 2G3TA 1MJ9A 2ZEMA 4C2YA 4CS0B 3I1UA 3ZZIA 1IOFA 2ABZA 3SJGA 4H2KA 2FIWA 4ONUA 2QVPA 4Y49B 4ZY0A 5I0CA 1PCAA 2PJCA 2CTBA 3B35A 4JYWA 2BSWA 1S7LA 3GIUA 5IX3A 1KWMA 4CRYB 3SI1A 4MFKA 5AGEA 3W91A 3TOAA 1YREA 5G20A 1IICA 1ON0A 1TF9A 1Z8WA 1QSTA 5HH1A 3R9GA 2DF5A 1M4LA 4YWYA 3IGRA 5I4MA 4NGMA 4C68A 2Q4YA 3L2NA 1QSMA 3DDDA 3R95A 2PVWA 4NF1A 2PIZA 5BWAB 4F6AA 4CAEA 1Q2YA 2H5MA 2HC9A 2B5GB 3SXOA 1PUAA 2ZOGA 4KLVA 1FNOA 2P0WA 3MN8A 4PK2A 5G21A 3PGPA 4E2AA 1M4DA 3WR7A 4RS2A 4CGOA 2ZW7A 3PB7X 3QB8A 2BEIA 5DWNA 4C7IA 5JM6A 2QECA 2IL4A 2PRBA 3TT2A 1Y9WA 4IK2A 4FD5A 2ZEFA 5EMIA 5LYFA 1UWYA 4NJRA 3LWUA 2WZNA 2NYQA 4MFJA 3D67A 2YNDA 4F0XA 1IU8A 1Q7LA 1A2ZA 4CGLA 3F8KA 2OR4A 4FAIA 1Y0YA 1XFOA 4ZI6A 5LYLA 1S5KA 2R1IA 3KR5A 3TTHA 2BUEA 2REFA 4P4JA 4LQGA 4MMOA 4KVXA 4U5YA 5D29A 3CPXA 4MHYA 3TE4A 3NH4A 4ORFA 5CBMA 4MHDA 1R57A 2GREA 3D7HA 3PP9A 3G3SA 1MK4A 2PJ5A 2QIRA 4KOVA 4PV6A 1UFHA 4H6ZA 3JTKA 3IU1A 4W9YA 5DS0A 2ZW6A 3FNCA 3K2KA 4PXEA 4YRHA 5JH9A 3IFEA 3R96A 4MHZA 3SJFA 2WYRA 3P2FA 4QBJA 1Y7RA 4KSIA 1S7KA 4AVBA 4F9VA 4LX9A 3PRTA 4UEZA 2G9DA 2X7BA 1YX0A 3BHXA 1YK3A 4C2XA 4ZY1A 3DR8A 4JD6A 1TKFA 4X3RA 4A2ZA 2XEFA 1V0CA 4AG9A 4ZGYB 1ZG8A 3JVNA 4P10A 3H8GA 4R9MA 5GCNA 1AUGA 4KZTA 5EBVA 4B14A 4FD4A 3KKWA 4K3NA 3S6GA 3T9YA 4OC2A 1KUVA 3RYOA 4B13A 3S9LA 3N5FA 1Z5RA 4MHNA 1VHOA 5K8OA 4CPAA 4NSQA 1TKJA 4TWEA 4M6IA 3RO0A 3A9LA 4JWPA 3B8GA 2J8NA 4LUAA 2JBKA 1CG2A 1RO5A 2B3UA 3QNVA 4JJXA 1X10A 4QVTA 4R8FA 2K5TA 2DXQA 4CAWA 3BLNA 1XJOA 1CPSA 4KSFA 5LRJA 1P0HA 2C27A 3GYAA 3K9TA 4WWVA 4MI4A 4KORA 5IB9A 2POKA 4EWTA 2V77A 3TC8A 5KTAA 4A39A 1OZPA 2JDDA 4XPDC 2PJ3A 1VHSA 3HUVA 2CIJA 3PFOA 4UCPA 3SJEA 4KOUA 1CP7A 1I21A 2Z3KA 2VXKA 4UWJA 3R1KA 1Z4RA 4OIWA 2PR1A 1KUXA 4M85A 4CAXA 2WPWA 3B3CA 5THWA 1CX8A 4F9UA 1ELLP 4ZY2A 3KL9A 4QB9A 5JGFA 4O23A 5LRGA 2FE7A 3D68A 1J4JA 3GY9A 3HLPA 3EXNA 4A94A 4AVAA 1FY7A 4MCPA 2ZEHA 3RAMA 4X5KA 4CYQA 4DUKA 2J8RA 2FVGA
chains in the Genus database with same CATH topology
2VZZA 5EC4A 1MJAA 3H4QA 4BBHA 2Q44A 2BL1A 5JQ4A 1KZFA 5JPHA 5H84A 2VEZA 2HV2A 3FB3A 1XMTA 5F46A 4L89A 1RXTA 2B58A 1IB1E 3BJ7A 3VWEA 4B5OA 4KOTA 1QSRA 3LODA 1I12A 1YVOA 3R9EA 1CJWA 2R8VA 3IU2A 1B6BA 4AG7A 3S6KA 2ZW4A 4KVME 2Z3LA 2CNTA 4FD7A 4J3GA 5KTDA 4KSAA 2RC4A 1VKCA 2VZYA 4CYPA 4UWIA 3IWGA 2Q4VA 2ARHA 3G8WA 4KOSA 4MY0A 1N71A 2OU2A 3EFAA 3PZJA 4UFWA 3EY5A 2I00A 4MJ8A 4YFJA 1S3ZA 4CYOA 1Z4EA 3D3SA 1BOBA 4RI1A 1L0CA 1XE4A 4HKFA 5AG7A 4QC6A 1LRZA 4C7HA 1KUYA 3F5BA 4B5PA 4A31A 5HMNA 2Z3NA 2O28A 3FXTA 4BMHA 1S60A 3VWDA 2FCKA 4IF5A 2CNSA 4II9A 3SHPA 1WK4A 4UCNA 1S7FA 3F0AA 2Q0YA 3QAHA 1YGHA 4NEXA 2YNCA 2Z3OA 2Q7BA 4H6UA 1NSLA 4PSXA 4KOYA 2WUUA 3TO7A 4KOWA 5F49A 4U9ZA 1ZO0A 4OAEA 2GIVA 4OLLA 2PQ8A 4KVOE 4A95A 5AG5A 5F47A 3ZJ0A 2FIAA 2D4OA 1IIDA 5A27A 2PR8A 4NCZA 1QSOA 3N7ZA 4UFVA 1TIQA 4Q36A 1YVKA 4XPLA 2WSAA 4R87A 2QMLA 4B5PB 1U6MA 1M1DA 3S6HA 2FSRA 1Q2DA 2ZW5A 3OWCA 4UCMA 4HNXB 4H89A 2D4PA 2R98A 3V8IA 2Z11A 1P4NA 3DSBA 5F48A 2OZHA 2JLMA 2Q04A 2Z0ZA 1NMTA 1WWZA 3EO4A 3W6XA 3S6FA 3FRMA 4JXQA 4AVCA 4JLYA 5IB0A 3EC4A 4YGOA 5H86A 4HNWB 1QSNA 2HUZA 5J8CA 1XIXA 2OH1A 4NXYA 1PU9A 3IWEA 1XF8A 4R3LA 4A32A 2GE3A 2Z3MA 2Z10A 3TCVA 2PDOA 4MFZA 3TO6A 1M44A 4CGMA 2CNMA 3I3GA 4FD6A 2AE6A 2B3VA 5AG6A 4B11A 5DWMA 4B10A 4AB7A 4E0AA 4CAFA 3MGDA 4C2ZA 4E8OA 1B87A 2EUIA 4L8AA 1NE9A 1Z9UA 5G1ZA 2ATRA 2AJ6A 2B4DB 4KUBA 4XPKA 1MJBA 4KOXA 3DNSA 4A30A 4PK3A 1CM0A 2J8MA 2Z3PA 2PC1A 3SXNA 1Q2CA 4CRZB 3TO9A 2FT0A 4KUAA 2DPTA 1S7NA 3I9SA 2JEVA 4UA3A 4MY3A 4PSWA 4CYNA 5FVJA 2CXAA 4OADA 3FIXA 2R7HA 2I79A 3TOBA 2P6FA 3W6SA 2FXFA 5CNPA 2VI7A 1XEBA 1M4IA 2ZXVA 2OZGA 1I1DA 4JXRA 1M4GA 4DNCA 4U9YA 4K30A 4EVYA 4R57A 2VBQA 3R9FA 3GKRA 3T90A 2REEA 5J8FA 2YNCC 3D2MA 1K4JA 1Y9KA 2P6EA 2YNEA 3LD2A 3CXSA 3JUWA 4CGPA 3D2PA 5G22A 2B4DA 4XNHB 4HNYB 5C82A 3DR6A 4GS4A 4MBUA 2OB0A 1IYKA 2HQYA 4ZBGA 3FYNA 3E0KA 3UY5A 3C26A 1IYLA 3NE7A 3P2HA 4F0YA 1GHEA 2F5IA 2FL4A 4QUSA 4R3KA 4UFXA 3D8PA 3CXPA 2Y0MA 4KS9A 4I49A 4Q38A 5E96A 4IUSA 4CGNA 4Y49C 2EVNA 2G3AA 4XPDB 2WPXA 5ISVA 2FS5A 4CAVA 4KLWA 2GANA 1BO4A 1YLEA 2B5GA 4UBRA 2NMTA 5KTCA 4A33A 2VQYA 3BJ8A 2OZUA 2P6GA 4MFPA 1SQHA 5C88A 3FBUA 2PSWA 2B4BA 4XNHC 3K9UA 2A4NA 5A28A 4MFLA 2YGWA 3CXQA 2DPSA 2G0BA 4M3SA 3TFYA 3H5ZA 5IV0A 2KCWA 4B12A 2CY2A 4MFQA 2ZPAA 2JDCA 5AG4A 1YR0A 2G3TA 1MJ9A 4C2YA 4CS0B 3ZZIA 2FIWA 4ONUA 4Y49B 5I0CA 2BSWA 1S7LA 5IX3A 4CRYB 4MFKA 5AGEA 3W91A 3TOAA 1YREA 5G20A 1IICA 1ON0A 1QSTA 5HH1A 3R9GA 3IGRA 4C68A 2Q4YA 1QSMA 3DDDA 3R95A 4NF1A 5BWAB 4F6AA 4CAEA 1Q2YA 2H5MA 2B5GB 3SXOA 1PUAA 4KLVA 4PK2A 2P0WA 5G21A 3PGPA 4E2AA 1M4DA 3WR7A 4RS2A 4CGOA 2ZW7A 3QB8A 5DWNA 2BEIA 4C7IA 2QECA 2IL4A 2PRBA 3TT2A 1Y9WA 4FD5A 4MFJA 2YNDA 4F0XA 4CGLA 3F8KA 1S5KA 2R1IA 3TTHA 2BUEA 2REFA 4KVXA 4U5YA 3TE4A 4ORFA 4MHDA 1R57A 3PP9A 3G3SA 1MK4A 2QIRA 4KOVA 4PV6A 1UFHA 4H6ZA 3JTKA 3IU1A 2ZW6A 3FNCA 4YRHA 3R96A 3P2FA 4QBJA 1Y7RA 1S7KA 4AVBA 4LX9A 2X7BA 1YX0A 1YK3A 4C2XA 3DR8A 4JD6A 4A2ZA 4AG9A 1V0CA 4ZGYB 3JVNA 4R9MA 5GCNA 5EBVA 4KZTA 4B14A 4FD4A 3KKWA 3S6GA 3T9YA 4B13A 1KUVA 3RYOA 4NSQA 3A9LA 4JWPA 3B8GA 2J8NA 4LUAA 1RO5A 2B3UA 4JJXA 4QVTA 2K5TA 2DXQA 4CAWA 3BLNA 4KSFA 1P0HA 2C27A 3GYAA 4MI4A 4KORA 5KTAA 1OZPA 2JDDA 4XPDC 1VHSA 4UCPA 4KOUA 1I21A 2Z3KA 2VXKA 4UWJA 3R1KA 1Z4RA 2PR1A 1KUXA 4M85A 4CAXA 2WPWA 4QB9A 2FE7A 3GY9A 1J4JA 3EXNA 4AVAA 1FY7A 4X5KA 4CYQA 2J8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VZZ A;  5EC4 A;  1MJA A;  3H4Q A;  2Q44 A;  2BL1 A;  5JQ4 A;  1KZF A;  5JPH A;  5H84 A;  2VEZ A;  2HV2 A;  3FB3 A;  1XMT A;  5F46 A;  4L89 A;  1RXT A;  2B58 A;  1IB1 E;  3BJ7 A;  3VWE A;  4B5O A;  4KOT A;  1QSR A;  3LOD A;  1I12 A;  1YVO A;  3R9E A;  1CJW A;  2R8V A;  1B6B A;  4AG7 A;  3S6K A;  2ZW4 A;  4KVM E;  2CNT A;  4FD7 A;  4J3G A;  5KTD A;  2RC4 A;  1VKC A;  2VZY A;  4UWI A;  3IWG A;  2Q4V A;  2ARH A;  3G8W A;  4KOS A;  4MY0 A;  1N71 A;  2OU2 A;  3EFA A;  3PZJ A;  3EY5 A;  2I00 A;  4MJ8 A;  4YFJ A;  1S3Z A;  1Z4E A;  3D3S A;  1BOB A;  4RI1 A;  1L0C A;  1XE4 A;  4HKF A;  4QC6 A;  1LRZ A;  1KUY A;  3F5B A;  4B5P A;  5HMN A;  2O28 A;  3FXT A;  4BMH A;  1S60 A;  3VWD A;  2FCK A;  4IF5 A;  2CNS A;  4II9 A;  3SHP A;  1WK4 A;  1S7F A;  3F0A A;  2Q0Y A;  3QAH A;  1YGH A;  4NEX A;  2Q7B A;  4H6U A;  1NSL A;  4PSX A;  4KOY A;  3TO7 A;  4KOW A;  5F49 A;  4U9Z A;  4OAE A;  2GIV A;  4OLL A;  2PQ8 A;  4KVO E;  5F47 A;  3ZJ0 A;  2FIA A;  2D4O A;  1IID A;  2PR8 A;  4NCZ A;  1QSO A;  3N7Z A;  1TIQ A;  4XPL A;  1YVK A;  4R87 A;  2QML A;  4B5P B;  1U6M A;  1M1D A;  3S6H A;  2FSR A;  1Q2D A;  2ZW5 A;  3OWC A;  4HNX B;  4H89 A;  2D4P A;  2R98 A;  3V8I A;  2Z11 A;  1P4N A;  3DSB A;  5F48 A;  2OZH A;  2JLM A;  2Q04 A;  2Z0Z A;  1NMT A;  1WWZ A;  3EO4 A;  3W6X A;  3S6F A;  3FRM A;  4JXQ A;  4AVC A;  4JLY A;  5IB0 A;  3EC4 A;  4YGO A;  5H86 A;  4HNW B;  1QSN A;  2HUZ A;  5J8C A;  1XIX A;  2OH1 A;  4NXY A;  1PU9 A;  1XF8 A;  4R3L A;  2GE3 A;  2Z10 A;  3TCV A;  2PDO A;  3TO6 A;  1M44 A;  2CNM A;  3I3G A;  4FD6 A;  2AE6 A;  2B3V A;  5DWM A;  4AB7 A;  4E0A A;  3MGD A;  4E8O A;  1B87 A;  2EUI A;  4L8A A;  1NE9 A;  1Z9U A;  2ATR A;  2AJ6 A;  2B4D B;  4KUB A;  4XPK A;  1MJB A;  4KOX A;  3DNS A;  4PK3 A;  1CM0 A;  2J8M A;  2PC1 A;  3SXN A;  1Q2C A;  4CRZ B;  3TO9 A;  2FT0 A;  4KUA A;  3I9S A;  1S7N A;  2JEV A;  4UA3 A;  4MY3 A;  4PSW A;  5FVJ A;  4OAD A;  3FIX A;  2R7H A;  2I79 A;  3TOB A;  2P6F A;  3W6S A;  2FXF A;  5CNP A;  2VI7 A;  1XEB A;  1M4I A;  2ZXV A;  2OZG A;  1I1D A;  4JXR A;  1M4G A;  4DNC A;  4U9Y A;  4K30 A;  4EVY A;  4R57 A;  2VBQ A;  3R9F A;  3GKR A;  3T90 A;  2REE A;  5J8F A;  3D2M A;  1K4J A;  1Y9K A;  2P6E A;  3LD2 A;  3CXS A;  3JUW A;  3D2P A;  2B4D A;  4XNH B;  4HNY B;  5C82 A;  3DR6 A;  4GS4 A;  4MBU A;  2OB0 A;  1IYK A;  2HQY A;  4ZBG A;  3FYN A;  3E0K A;  3UY5 A;  3C26 A;  1IYL A;  3NE7 A;  3P2H A;  4F0Y A;  1GHE A;  2F5I A;  2FL4 A;  4QUS A;  4R3K A;  3D8P A;  3CXP A;  2Y0M A;  4I49 A;  5E96 A;  4IUS A;  4Y49 C;  2EVN A;  2G3A A;  4XPD B;  2WPX A;  5ISV A;  2FS5 A;  4CAV A;  4KLW A;  2GAN A;  1BO4 A;  1YLE A;  2B5G A;  4UBR A;  2NMT A;  5KTC A;  2VQY A;  3BJ8 A;  2OZU A;  2P6G A;  1SQH A;  5C88 A;  3FBU A;  2PSW A;  2B4B A;  4XNH C;  3K9U A;  2A4N A;  3CXQ A;  2G0B A;  4M3S A;  3TFY A;  5IV0 A;  2KCW A;  2CY2 A;  2ZPA A;  2JDC A;  1YR0 A;  2G3T A;  1MJ9 A;  4CS0 B;  3ZZI A;  2FIW A;  4ONU A;  4Y49 B;  5I0C A;  2BSW A;  1S7L A;  5IX3 A;  4CRY B;  3W91 A;  3TOA A;  1YRE A;  1IIC A;  1ON0 A;  1QST A;  5HH1 A;  3R9G A;  3IGR A;  2Q4Y A;  1QSM A;  3DDD A;  3R95 A;  4NF1 A;  4F6A A;  1Q2Y A;  2H5M A;  2B5G B;  3SXO A;  1PUA A;  4KLV A;  4PK2 A;  2P0W A;  3PGP A;  4E2A A;  1M4D A;  3WR7 A;  4RS2 A;  2ZW7 A;  3QB8 A;  5DWN A;  2BEI A;  2QEC A;  2IL4 A;  2PRB A;  3TT2 A;  1Y9W A;  4FD5 A;  3F8K A;  1S5K A;  2R1I A;  3TTH A;  2BUE A;  2REF A;  4KVX A;  4U5Y A;  3TE4 A;  4ORF A;  4MHD A;  1R57 A;  3PP9 A;  3G3S A;  1MK4 A;  2QIR A;  4KOV A;  4PV6 A;  1UFH A;  4H6Z A;  2ZW6 A;  3FNC A;  4YRH A;  3R96 A;  3P2F A;  4QBJ A;  1Y7R A;  1S7K A;  4AVB A;  4LX9 A;  2X7B A;  1YX0 A;  1YK3 A;  3DR8 A;  4JD6 A;  4AG9 A;  1V0C A;  3JVN A;  4R9M A;  5GCN A;  5EBV A;  4KZT A;  4FD4 A;  3KKW A;  3S6G A;  3T9Y A;  1KUV A;  3RYO A;  4NSQ A;  4JWP A;  3B8G A;  2J8N A;  4LUA A;  1RO5 A;  2B3U A;  4JJX A;  4QVT A;  2K5T A;  2DXQ A;  4CAW A;  3BLN A;  1P0H A;  2C27 A;  3GYA A;  4MI4 A;  4KOR A;  5KTA A;  1OZP A;  2JDD A;  4XPD C;  1VHS A;  4KOU A;  1I21 A;  2VXK A;  4UWJ A;  3R1K A;  1Z4R A;  2PR1 A;  1KUX A;  4M85 A;  4CAX A;  2WPW A;  4QB9 A;  2FE7 A;  3GY9 A;  1J4J A;  3EXN A;  4AVA A;  1FY7 A;  4X5K A;  2J8R A; 
#chains in the Genus database with same CATH topology
 2VZZ A;  1X12 A;  5EC4 A;  1MJA A;  1R3N A;  3D7F A;  2PIY A;  3H4Q A;  3SI0 A;  4BBH A;  2Q44 A;  2BL1 A;  1CP6 A;  3D7D A;  4NGP A;  5JQ4 A;  4P4I A;  4ZX8 A;  1KZF A;  3KR4 A;  5JPH A;  2QYV A;  5H84 A;  2VEZ A;  3FED A;  2HV2 A;  1XOV A;  3PB4 X;  3FB3 A;  1XMT A;  5F46 A;  4L89 A;  1RXT A;  1ZLH A;  2PJ2 A;  2B58 A;  2QJ8 A;  1IB1 E;  2EK9 A;  2V8V A;  3PB6 X;  3BJ7 A;  3JRU A;  3KHZ A;  1ZG7 A;  5LYI A;  1ZG9 A;  3VWE A;  4R76 A;  4UIA A;  4B5O A;  4KOT A;  1QSR A;  3LOD A;  4UEF A;  1JWQ A;  1VGY A;  4P6Y A;  2EWB A;  1I12 A;  1YVO A;  4M6G A;  2J9A A;  3R9E A;  3V38 A;  1CJW A;  2R8V A;  2GLF A;  3IU2 A;  1B6B A;  2PRQ A;  2V8H A;  2C1C A;  4AG7 A;  3S6K A;  4WJB A;  2ZW4 A;  3S9N A;  4KVM E;  3D4U A;  2Z3L A;  2CF4 A;  2CNT A;  4MRI A;  4FD7 A;  4J3G A;  2ZOF A;  5KTD A;  4KSA A;  1TXR A;  2RC4 A;  1VKC A;  1Z2L A;  2VZY A;  2XEG A;  1IGB A;  4CYP A;  4UWI A;  3IWG A;  5HVF A;  4P4D A;  2Q4V A;  4TNU A;  4YU9 A;  1QQ9 A;  2ARH A;  3G8W A;  2AFO A;  4KOS A;  4MY0 A;  3V7Z A;  1N71 A;  2OU2 A;  3EFA A;  2GU2 A;  3PZJ A;  5ELY A;  4OC4 A;  4UFW A;  1LOK A;  3EY5 A;  2I00 A;  3WC7 A;  4MJ8 A;  4YFJ A;  1S3Z A;  1LAN A;  4CYO A;  1Z4E A;  3D3S A;  1BOB A;  2PJB A;  2PCU A;  2PJ6 A;  4RI1 A;  4ZX9 A;  1L0C A;  1XE4 A;  4HKF A;  1XRY A;  5AG7 A;  1LFW A;  5K8N A;  1GYT A;  2Q4Z A;  1HEE A;  1LRZ A;  4QC6 A;  4C7H A;  1KUY A;  3F5B A;  3D66 A;  1F2P A;  4B5P A;  4A31 A;  3KGQ A;  2C6C A;  5HMN A;  2Z3N A;  3B7I A;  2BOA A;  2O28 A;  3FXT A;  2DEA A;  4BMH A;  1Z8L A;  2ZEN A;  4P4E A;  3QAY A;  1AYE A;  1OBR A;  1S60 A;  1CBX A;  3VWD A;  2FCK A;  4IF5 A;  4P4B A;  2CNS A;  4II9 A;  2V8G A;  3SHP A;  4Q7A A;  4PXB A;  1WK4 A;  4PXD A;  4UCN A;  1LAM A;  1S7F A;  3F0A A;  2ODF A;  2Q0Y A;  3QAH A;  4R7M A;  2PE3 A;  4NJQ A;  4P45 A;  1YGH A;  2GLJ A;  3B3S A;  4NEX A;  2YNC A;  3KHX A;  4FBE A;  3IO1 A;  2Z3O A;  4PPZ A;  3KQZ A;  3FF3 A;  2Q7B A;  4H6U A;  4A37 A;  1F57 A;  2AFZ A;  1NSL A;  4PSX A;  3PBE A;  4KOY A;  1YW6 A;  2WUU A;  3ISX A;  1IOI A;  4KOW A;  3BI0 A;  2RB7 A;  3TO7 A;  6CPA A;  5F49 A;  4U9Z A;  1ZO0 A;  2PJ4 A;  4OAE A;  3S9M A;  2GIV A;  1HDU A;  4OLL A;  2VL1 A;  1FT7 A;  2PQ8 A;  4KVO E;  1DTD A;  1VHE A;  3BXM A;  3PEI A;  3NH8 A;  4A95 A;  5AG5 A;  5F47 A;  3ZJ0 A;  4EFD A;  2FIA A;  3LMS A;  1YSJ A;  1R43 A;  2D4O A;  1IID A;  4BIN A;  5A27 A;  2PR8 A;  4G1P A;  1PYT B;  3IIB A;  4NCZ A;  2O53 A;  3CT9 A;  1QSO A;  1ELM P;  3H8E A;  3N7Z A;  4UFV A;  2AFW A;  3WC5 A;  1TIQ A;  4Q36 A;  1YVK A;  4M6H A;  2WSA A;  4XPL A;  4R87 A;  2QML A;  4B5P B;  3B3T A;  4UF4 A;  1U6M A;  4NGT A;  1M1D A;  3S6H A;  2FSR A;  1Q2D A;  2ZW5 A;  3OWC A;  4NGQ A;  4HNX B;  4H89 A;  4UCM A;  3RBU A;  1JQG A;  2D4P A;  2I3C A;  2R98 A;  1H8L A;  2Z11 A;  3V8I A;  4DJL A;  1P4N A;  3DSB A;  1YLO A;  4NGR A;  5F48 A;  3FVL A;  4X2T A;  2OZH A;  2JLM A;  2Q04 A;  2Z0Z A;  4RN7 A;  1NMT A;  1WWZ A;  3EO4 A;  2ZEP A;  4MCR A;  3W6X A;  2PJA A;  3S6F A;  3FRM A;  4JXQ A;  1EE3 P;  2IMO A;  3KAS A;  4PQA A;  4AVC A;  2C6G A;  4JLY A;  3EC4 A;  4OKO A;  5IB0 A;  3FJU A;  2O4H A;  3BI1 A;  4YGO A;  3NA6 A;  2EO8 A;  5H86 A;  3VH9 A;  3SJX A;  3NE8 A;  4HNW B;  1QSN A;  2IQ6 A;  2HUZ A;  5J8C A;  1XIX A;  2OH1 A;  4NXY A;  4R6T A;  1PU9 A;  3IWE A;  4A38 A;  1XF8 A;  4R3L A;  4A32 A;  2GE3 A;  2Z3M A;  5J1Q A;  4GM5 A;  2Z10 A;  3TCV A;  2PDO A;  4MFZ A;  3TO6 A;  1M44 A;  3T8W A;  4CGM A;  2CNM A;  3I3G A;  4FD6 A;  2AE6 A;  2B3V A;  4MCS A;  4OC1 A;  5AG6 A;  4B11 A;  5DWM A;  4B10 A;  4MCQ A;  4AB7 A;  4E0A A;  1RTQ A;  4CAF A;  3MGD A;  4C2Z A;  2CTC A;  4E8O A;  1B87 A;  2PJ9 A;  5HVH A;  2EUI A;  2BCO A;  4GXH A;  4L8A A;  7CPA A;  1NE9 A;  5HVG A;  1Z9U A;  3GLJ A;  3PBB A;  5G1Z A;  4HPS A;  1F2O A;  4EME A;  2ATR A;  3NFZ A;  1Z8X A;  1LAP A;  2AJ6 A;  4OP4 A;  2B4D B;  4KUB A;  2JBJ A;  4XPK A;  3DLJ A;  1MJB A;  4KOX A;  2F8H A;  3DNS A;  1HDQ A;  3WAB A;  3WT4 A;  8CPA A;  4A30 A;  4PK3 A;  1CM0 A;  2J8M A;  3ISZ A;  2PJ7 A;  4DYO A;  1TKH A;  3IJ3 A;  2Z3P A;  2PC1 A;  3CZX A;  3IEH A;  4MXU A;  3SXN A;  1Q2C A;  4P44 A;  1VIX A;  2PJ8 A;  2F7V A;  2JEW A;  3B3V A;  3TO9 A;  4CRZ B;  2FT0 A;  2Q7S A;  4RUH A;  3IC1 A;  2AFS A;  1XMB A;  4KUA A;  2DPT A;  1S7N A;  1IY7 A;  2JEV A;  2IJZ A;  3I9S A;  4MY3 A;  4PSW A;  4UA3 A;  4F8Z A;  4OC3 A;  3B2Y A;  3WC6 A;  3CDX A;  4OME A;  2OOT A;  4CYN A;  5FVJ A;  2AFM A;  3MRU A;  2CXA A;  4OAD A;  2AFU A;  3FIX A;  2R7H A;  2I79 A;  3TOB A;  2P6F A;  1BLL E;  1TF8 A;  2NSM A;  2ZED A;  1ZLI A;  2FXF A;  3FEE A;  3W6S A;  5K8M A;  5CNP A;  4UEE A;  5LYD A;  2VI7 A;  5K8P A;  1XEB A;  4IHM A;  4OC5 A;  1M4I A;  2ZEG A;  2OZG A;  1I1D A;  2ZXV A;  1M4G A;  4JXR A;  2ZEE A;  4K30 A;  2PJ1 A;  4U9Y A;  4DNC A;  4EVY A;  4R57 A;  2VBQ A;  3R9F A;  3GKR A;  3T90 A;  2REE A;  5J8F A;  4NGS A;  2YNC C;  4PXC A;  3D2M A;  2XEJ A;  1K4J A;  4JZ0 A;  4OC0 A;  3GB0 A;  1Y9K A;  1BAV A;  2P6E A;  2YNE A;  3LD2 A;  5D8N A;  3CXS A;  2ANP A;  3GUX A;  3JUW A;  4FWU A;  4CGP A;  4BD9 A;  3D2P A;  4ONW A;  1XBU A;  4NFR A;  5G22 A;  2B4D A;  3D7G A;  5F09 A;  3FH4 A;  4LQ6 A;  2C6P A;  2Q43 A;  4XNH B;  4HNY B;  2HB6 A;  3FEC A;  5C82 A;  3DR6 A;  5LRK A;  4GS4 A;  4P4F A;  3TX8 A;  4MBU A;  2OB0 A;  4NGN A;  1IYK A;  1LCP A;  2GFQ A;  2HQY A;  3B3W A;  3FX6 A;  4ZBG A;  4Z65 A;  1Z8T A;  3FYN A;  1Y7E A;  3E0K A;  4MHP A;  3UY5 A;  1BPN A;  3C26 A;  1IYL A;  2EK8 A;  3NE7 A;  3P2H A;  4F0Y A;  1GHE A;  2F5I A;  2RFH A;  2AFX A;  2FL4 A;  4QUS A;  4R3K A;  4UFX A;  3D8P A;  4ZYQ A;  3CXP A;  2Y0M A;  4FUU A;  1YW4 A;  2PJ0 A;  4I49 A;  4KS9 A;  1Y0R A;  2Q51 A;  3FMC A;  4Q38 A;  5E96 A;  3NH5 A;  3KI9 A;  2ZEL A;  3CPA A;  4AXV A;  4IUS A;  1QMU A;  3RNZ A;  4Y49 C;  2EVN A;  4CGN A;  3H8F A;  2G3A A;  2XEI A;  2WPX A;  4XPD B;  2EBJ A;  3VAT A;  5ISV A;  2FS5 A;  4CAV A;  4KLW A;  1YME A;  2GAN A;  1BO4 A;  1YLE A;  2B5G A;  4UBR A;  2NMT A;  5KTC A;  1ARM A;  4A33 A;  2VQY A;  1CPX A;  3BJ8 A;  3IWW A;  2OZU A;  2P6G A;  4MFP A;  1SQH A;  3VAR A;  5C88 A;  3FBU A;  1ARL A;  2PSW A;  2B4B A;  4XNH C;  3KZW A;  3K9U A;  3DGV A;  2A4N A;  3KQX A;  5A28 A;  1NSA A;  4OID A;  5HXD A;  1BPM A;  5CPA A;  3LAC A;  4MFL A;  2YGW A;  3PFE A;  3SI2 A;  4IAV A;  4X8I A;  3CXQ A;  2DPS A;  2G0B A;  4M3S A;  3TFY A;  2V8D A;  4UIB A;  3H5Z A;  4B6Z A;  2KCW A;  3PB8 X;  2PVV A;  2ZEO A;  4B12 A;  2CY2 A;  1YQE A;  4MFQ A;  5IV0 A;  2ZPA A;  2BO9 A;  2JDC A;  5AG4 A;  1AMP A;  1DE4 C;  1YR0 A;  3PB9 X;  3RZA A;  2G3T A;  1MJ9 A;  2ZEM A;  4C2Y A;  4CS0 B;  3I1U A;  3ZZI A;  1IOF A;  2ABZ A;  3SJG A;  4H2K A;  2FIW A;  4ONU A;  2QVP A;  4Y49 B;  4ZY0 A;  5I0C A;  1PCA A;  2PJC A;  2CTB A;  3B35 A;  4JYW A;  2BSW A;  1S7L A;  3GIU A;  5IX3 A;  1KWM A;  4CRY B;  3SI1 A;  4MFK A;  5AGE A;  3W91 A;  3TOA A;  1YRE A;  5G20 A;  1IIC A;  1ON0 A;  1TF9 A;  1Z8W A;  1QST A;  5HH1 A;  3R9G A;  2DF5 A;  1M4L A;  4YWY A;  3IGR A;  5I4M A;  4NGM A;  4C68 A;  2Q4Y A;  3L2N A;  1QSM A;  3DDD A;  3R95 A;  2PVW A;  4NF1 A;  2PIZ A;  5BWA B;  4F6A A;  4CAE A;  1Q2Y A;  2H5M A;  2HC9 A;  2B5G B;  3SXO A;  1PUA A;  2ZOG A;  4KLV A;  1FNO A;  2P0W A;  3MN8 A;  4PK2 A;  5G21 A;  3PGP A;  4E2A A;  1M4D A;  3WR7 A;  4RS2 A;  4CGO A;  2ZW7 A;  3PB7 X;  3QB8 A;  2BEI A;  5DWN A;  4C7I A;  5JM6 A;  2QEC A;  2IL4 A;  2PRB A;  3TT2 A;  1Y9W A;  4IK2 A;  4FD5 A;  2ZEF A;  5EMI A;  5LYF A;  1UWY A;  4NJR A;  3LWU A;  2WZN A;  2NYQ A;  4MFJ A;  3D67 A;  2YND A;  4F0X A;  1IU8 A;  1Q7L A;  1A2Z A;  4CGL A;  3F8K A;  2OR4 A;  4FAI A;  1Y0Y A;  1XFO A;  4ZI6 A;  5LYL A;  1S5K A;  2R1I A;  3KR5 A;  3TTH A;  2BUE A;  2REF A;  4P4J A;  4LQG A;  4MMO A;  4KVX A;  4U5Y A;  5D29 A;  3CPX A;  4MHY A;  3TE4 A;  3NH4 A;  4ORF A;  5CBM A;  4MHD A;  1R57 A;  2GRE A;  3D7H A;  3PP9 A;  3G3S A;  1MK4 A;  2PJ5 A;  2QIR A;  4KOV A;  4PV6 A;  1UFH A;  4H6Z A;  3JTK A;  3IU1 A;  4W9Y A;  5DS0 A;  2ZW6 A;  3FNC A;  3K2K A;  4PXE A;  4YRH A;  5JH9 A;  3IFE A;  3R96 A;  4MHZ A;  3SJF A;  2WYR A;  3P2F A;  4QBJ A;  1Y7R A;  4KSI A;  1S7K A;  4AVB A;  4F9V A;  4LX9 A;  3PRT A;  4UEZ A;  2G9D A;  2X7B A;  1YX0 A;  3BHX A;  1YK3 A;  4C2X A;  4ZY1 A;  3DR8 A;  4JD6 A;  1TKF A;  4X3R A;  4A2Z A;  2XEF A;  1V0C A;  4AG9 A;  4ZGY B;  1ZG8 A;  3JVN A;  4P10 A;  3H8G A;  4R9M A;  5GCN A;  1AUG A;  4KZT A;  5EBV A;  4B14 A;  4FD4 A;  3KKW A;  4K3N A;  3S6G A;  3T9Y A;  4OC2 A;  1KUV A;  3RYO A;  4B13 A;  3S9L A;  3N5F A;  1Z5R A;  4MHN A;  1VHO A;  5K8O A;  4CPA A;  4NSQ A;  1TKJ A;  4TWE A;  4M6I A;  3RO0 A;  3A9L A;  4JWP A;  3B8G A;  2J8N A;  4LUA A;  2JBK A;  1CG2 A;  1RO5 A;  2B3U A;  3QNV A;  4JJX A;  1X10 A;  4QVT A;  4R8F A;  2K5T A;  2DXQ A;  4CAW A;  3BLN A;  1XJO A;  1CPS A;  4KSF A;  5LRJ A;  1P0H A;  2C27 A;  3GYA A;  3K9T A;  4WWV A;  4MI4 A;  4KOR A;  5IB9 A;  2POK A;  4EWT A;  2V77 A;  3TC8 A;  5KTA A;  4A39 A;  1OZP A;  2JDD A;  4XPD C;  2PJ3 A;  1VHS A;  3HUV A;  2CIJ A;  3PFO A;  4UCP A;  3SJE A;  4KOU A;  1CP7 A;  1I21 A;  2Z3K A;  2VXK A;  4UWJ A;  3R1K A;  1Z4R A;  4OIW A;  2PR1 A;  1KUX A;  4M85 A;  4CAX A;  2WPW A;  3B3C A;  5THW A;  1CX8 A;  4F9U A;  1ELL P;  4ZY2 A;  3KL9 A;  4QB9 A;  5JGF A;  4O23 A;  5LRG A;  2FE7 A;  3D68 A;  1J4J A;  3GY9 A;  3HLP A;  3EXN A;  4A94 A;  4AVA A;  1FY7 A;  4MCP A;  2ZEH A;  3RAM A;  4X5K A;  4CYQ A;  4DUK A;  2J8R A;  2FVG A; 
#chains in the Genus database with same CATH homology
 2VZZ A;  5EC4 A;  1MJA A;  3H4Q A;  4BBH A;  2Q44 A;  2BL1 A;  5JQ4 A;  1KZF A;  5JPH A;  5H84 A;  2VEZ A;  2HV2 A;  3FB3 A;  1XMT A;  5F46 A;  4L89 A;  1RXT A;  2B58 A;  1IB1 E;  3BJ7 A;  3VWE A;  4B5O A;  4KOT A;  1QSR A;  3LOD A;  1I12 A;  1YVO A;  3R9E A;  1CJW A;  2R8V A;  3IU2 A;  1B6B A;  4AG7 A;  3S6K A;  2ZW4 A;  4KVM E;  2Z3L A;  2CNT A;  4FD7 A;  4J3G A;  5KTD A;  4KSA A;  2RC4 A;  1VKC A;  2VZY A;  4CYP A;  4UWI A;  3IWG A;  2Q4V A;  2ARH A;  3G8W A;  4KOS A;  4MY0 A;  1N71 A;  2OU2 A;  3EFA A;  3PZJ A;  4UFW A;  3EY5 A;  2I00 A;  4MJ8 A;  4YFJ A;  1S3Z A;  4CYO A;  1Z4E A;  3D3S A;  1BOB A;  4RI1 A;  1L0C A;  1XE4 A;  4HKF A;  5AG7 A;  4QC6 A;  1LRZ A;  4C7H A;  1KUY A;  3F5B A;  4B5P A;  4A31 A;  5HMN A;  2Z3N A;  2O28 A;  3FXT A;  4BMH A;  1S60 A;  3VWD A;  2FCK A;  4IF5 A;  2CNS A;  4II9 A;  3SHP A;  1WK4 A;  4UCN A;  1S7F A;  3F0A A;  2Q0Y A;  3QAH A;  1YGH A;  4NEX A;  2YNC A;  2Z3O A;  2Q7B A;  4H6U A;  1NSL A;  4PSX A;  4KOY A;  2WUU A;  3TO7 A;  4KOW A;  5F49 A;  4U9Z A;  1ZO0 A;  4OAE A;  2GIV A;  4OLL A;  2PQ8 A;  4KVO E;  4A95 A;  5AG5 A;  5F47 A;  3ZJ0 A;  2FIA A;  2D4O A;  1IID A;  5A27 A;  2PR8 A;  4NCZ A;  1QSO A;  3N7Z A;  4UFV A;  1TIQ A;  4Q36 A;  1YVK A;  4XPL A;  2WSA A;  4R87 A;  2QML A;  4B5P B;  1U6M A;  1M1D A;  3S6H A;  2FSR A;  1Q2D A;  2ZW5 A;  3OWC A;  4UCM A;  4HNX B;  4H89 A;  2D4P A;  2R98 A;  3V8I A;  2Z11 A;  1P4N A;  3DSB A;  5F48 A;  2OZH A;  2JLM A;  2Q04 A;  2Z0Z A;  1NMT A;  1WWZ A;  3EO4 A;  3W6X A;  3S6F A;  3FRM A;  4JXQ A;  4AVC A;  4JLY A;  5IB0 A;  3EC4 A;  4YGO A;  5H86 A;  4HNW B;  1QSN A;  2HUZ A;  5J8C A;  1XIX A;  2OH1 A;  4NXY A;  1PU9 A;  3IWE A;  1XF8 A;  4R3L A;  4A32 A;  2GE3 A;  2Z3M A;  2Z10 A;  3TCV A;  2PDO A;  4MFZ A;  3TO6 A;  1M44 A;  4CGM A;  2CNM A;  3I3G A;  4FD6 A;  2AE6 A;  2B3V A;  5AG6 A;  4B11 A;  5DWM A;  4B10 A;  4AB7 A;  4E0A A;  4CAF A;  3MGD A;  4C2Z A;  4E8O A;  1B87 A;  2EUI A;  4L8A A;  1NE9 A;  1Z9U A;  5G1Z A;  2ATR A;  2AJ6 A;  2B4D B;  4KUB A;  4XPK A;  1MJB A;  4KOX A;  3DNS A;  4A30 A;  4PK3 A;  1CM0 A;  2J8M A;  2Z3P A;  2PC1 A;  3SXN A;  1Q2C A;  4CRZ B;  3TO9 A;  2FT0 A;  4KUA A;  2DPT A;  1S7N A;  3I9S A;  2JEV A;  4UA3 A;  4MY3 A;  4PSW A;  4CYN A;  5FVJ A;  2CXA A;  4OAD A;  3FIX A;  2R7H A;  2I79 A;  3TOB A;  2P6F A;  3W6S A;  2FXF A;  5CNP A;  2VI7 A;  1XEB A;  1M4I A;  2ZXV A;  2OZG A;  1I1D A;  4JXR A;  1M4G A;  4DNC A;  4U9Y A;  4K30 A;  4EVY A;  4R57 A;  2VBQ A;  3R9F A;  3GKR A;  3T90 A;  2REE A;  5J8F A;  2YNC C;  3D2M A;  1K4J A;  1Y9K A;  2P6E A;  2YNE A;  3LD2 A;  3CXS A;  3JUW A;  4CGP A;  3D2P A;  5G22 A;  2B4D A;  4XNH B;  4HNY B;  5C82 A;  3DR6 A;  4GS4 A;  4MBU A;  2OB0 A;  1IYK A;  2HQY A;  4ZBG A;  3FYN A;  3E0K A;  3UY5 A;  3C26 A;  1IYL A;  3NE7 A;  3P2H A;  4F0Y A;  1GHE A;  2F5I A;  2FL4 A;  4QUS A;  4R3K A;  4UFX A;  3D8P A;  3CXP A;  2Y0M A;  4KS9 A;  4I49 A;  4Q38 A;  5E96 A;  4IUS A;  4CGN A;  4Y49 C;  2EVN A;  2G3A A;  4XPD B;  2WPX A;  5ISV A;  2FS5 A;  4CAV A;  4KLW A;  2GAN A;  1BO4 A;  1YLE A;  2B5G A;  4UBR A;  2NMT A;  5KTC A;  4A33 A;  2VQY A;  3BJ8 A;  2OZU A;  2P6G A;  4MFP A;  1SQH A;  5C88 A;  3FBU A;  2PSW A;  2B4B A;  4XNH C;  3K9U A;  2A4N A;  5A28 A;  4MFL A;  2YGW A;  3CXQ A;  2DPS A;  2G0B A;  4M3S A;  3TFY A;  3H5Z A;  5IV0 A;  2KCW A;  4B12 A;  2CY2 A;  4MFQ A;  2ZPA A;  2JDC A;  5AG4 A;  1YR0 A;  2G3T A;  1MJ9 A;  4C2Y A;  4CS0 B;  3ZZI A;  2FIW A;  4ONU A;  4Y49 B;  5I0C A;  2BSW A;  1S7L A;  5IX3 A;  4CRY B;  4MFK A;  5AGE A;  3W91 A;  3TOA A;  1YRE A;  5G20 A;  1IIC A;  1ON0 A;  1QST A;  5HH1 A;  3R9G A;  3IGR A;  4C68 A;  2Q4Y A;  1QSM A;  3DDD A;  3R95 A;  4NF1 A;  5BWA B;  4F6A A;  4CAE A;  1Q2Y A;  2H5M A;  2B5G B;  3SXO A;  1PUA A;  4KLV A;  4PK2 A;  2P0W A;  5G21 A;  3PGP A;  4E2A A;  1M4D A;  3WR7 A;  4RS2 A;  4CGO A;  2ZW7 A;  3QB8 A;  5DWN A;  2BEI A;  4C7I A;  2QEC A;  2IL4 A;  2PRB A;  3TT2 A;  1Y9W A;  4FD5 A;  4MFJ A;  2YND A;  4F0X A;  4CGL A;  3F8K A;  1S5K A;  2R1I A;  3TTH A;  2BUE A;  2REF A;  4KVX A;  4U5Y A;  3TE4 A;  4ORF A;  4MHD A;  1R57 A;  3PP9 A;  3G3S A;  1MK4 A;  2QIR A;  4KOV A;  4PV6 A;  1UFH A;  4H6Z A;  3JTK A;  3IU1 A;  2ZW6 A;  3FNC A;  4YRH A;  3R96 A;  3P2F A;  4QBJ A;  1Y7R A;  1S7K A;  4AVB A;  4LX9 A;  2X7B A;  1YX0 A;  1YK3 A;  4C2X A;  3DR8 A;  4JD6 A;  4A2Z A;  4AG9 A;  1V0C A;  4ZGY B;  3JVN A;  4R9M A;  5GCN A;  5EBV A;  4KZT A;  4B14 A;  4FD4 A;  3KKW A;  3S6G A;  3T9Y A;  4B13 A;  1KUV A;  3RYO A;  4NSQ A;  3A9L A;  4JWP A;  3B8G A;  2J8N A;  4LUA A;  1RO5 A;  2B3U A;  4JJX A;  4QVT A;  2K5T A;  2DXQ A;  4CAW A;  3BLN A;  4KSF A;  1P0H A;  2C27 A;  3GYA A;  4MI4 A;  4KOR A;  5KTA A;  1OZP A;  2JDD A;  4XPD C;  1VHS A;  4UCP A;  4KOU A;  1I21 A;  2Z3K A;  2VXK A;  4UWJ A;  3R1K A;  1Z4R A;  2PR1 A;  1KUX A;  4M85 A;  4CAX A;  2WPW A;  4QB9 A;  2FE7 A;  3GY9 A;  1J4J A;  3EXN A;  4AVA A;  1FY7 A;  4X5K A;  4CYQ A;  2J8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...