4NEXA

Structure of the n-acetyltransferase domain of x. fastidiosa nags/k
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
157
structure length
157
Chain Sequence
SSGLVPRGSHMVIRATTWKDLDLPRLQHLIQSSFRRTLIPHYFETTPLLRAYVSENYRAAVILTKLGNVPYLDKFAVLDDAQGEGLGRAVWSIMREETPQLFWRSRHNNQANAFYYAESDGYYKQDHWKIFWNGLHHFQQIQQCVAHCTQHPPTLID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Acetylglutamate kinase
publication title Structures of the N-acetyltransferase domain of Xylella fastidiosaN-acetyl-L-glutamate synthase/kinase with and without a His tag bound to N-acetyl-L-glutamate.
pubmed doi rcsb
source organism Xylella fastidiosa temecula1
molecule tags Transferase
total genus 48
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature ec 2.7.2.8: Acetylglutamate kinase.
pdb deposition date 2013-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4nexA00
3GKRA 3P2HA 5DWNA 1K4JA 2R7HA 3RYOA 3SHPA 1KUVA 2JDCA 3CXSA 2ATRA 4OAEA 4R3LA 1M4GA 1LRZA 1YX0A 4FD4A 2CY2A 4OADA 2CNSA 4MY3A 2Q4YA 2JDDA 2Q04A 4KLVA 3TO6A 3MGDA 5KTCA 2B5GA 3TOAA 4AB7A 4KLWA 4KZTA 1B87A 1CM0A 2KCWA 4XNHB 1YVOA 2QECA 4MJ8A 2Q4VA 2VQYA 3DNSA 3EC4A 2O28A 2ZW6A 2VEZA 3FNCA 3PP9A 2OZHA 1QSTA 4IF5A 1S7NA 4IUSA 3D2PA 2I00A 2PR1A 1BOBA 2Z0ZA 1S5KA 1YGHA 4UWJA 1Q2YA 2JLMA 4ONUA 4JXRA 1QSNA 2VI7A 1S7LA 1Z4RA 4MBUA 1PUAA 4RI1A 2ZW5A 2D4PA 3FXTA 2FS5A 2DXQA 3K9UA 1NE9A 4QC6A 1YLEA 2PQ8A 3SXOA 3FRMA 1XMTA 2PC1A 3BLNA 3V8IA 4OLLA 5GCNA 2PR8A 2OU2A 1RXTA 1IIDA 4MY0A 1Q2CA 3TCVA 2EVNA 5IX3A 2HUZA 4KOSA 1XE4A 2BL1A 4F0YA 3H4QA 4H6ZA 3TE4A 2B4DB 2Q7BA 3NE7A 5CNPA 1MJ9A 5JPHA 3JUWA 1Y9KA 2P6FA 4PK2A 2G0BA 4LUAA 3ZZIA 3I9SA 4KUAA 4PK3A 2VZYA 3S6HA 2FT0A 1MJAA 1QSOA 4R57A 1P4NA 3C26A 4NXYA 2ARHA 2Q0YA 4B5OA 3VWDA 4KOUA 2HV2A 5I0CA 4XPLA 3S6GA 4U9ZA 5KTDA 3DSBA 4Y49B 1YREA 2VZZA 5F46A 3UY5A 4CAWA 4F6AA 5JQ4A 1B6BA 2G3TA 3OWCA 4AG9A 1IICA 1YR0A 2Y0MA 4H89A 5E96A 2A4NA 4I49A 5H86A 4M85A 1MK4A 4E8OA 1Q2DA 4HKFA 1QSMA 2BEIA 4ORFA 3E0KA 4EVYA 1R57A 4KVOE 3S6KA 4FD5A 1KUYA 1KZFA 1Z9UA 2FIWA 3D3SA 3I3GA 4CAVA 3G8WA 4YFJA 1QSRA 3FIXA 5J8CA 4CRYB 1YK3A 2REEA 3W6XA 2VBQA 5ISVA 1FY7A 2PRBA 1VKCA 3R96A 3B8GA 3LODA 3BJ8A 5KTAA 2B5GB 3S6FA 1M44A 2EUIA 2FXFA 3F5BA 1I12A 2CNTA 2Q44A 2B3UA 2OZGA 5F48A 2K5TA 2P0WA 2R98A 4X5KA 4HNYB 4UWIA 1I1DA 3TT2A 5IB0A 1IB1E 4YRHA 4MI4A 2VXKA 3LD2A 4XPDB 3GYAA 4J3GA 2J8NA 2GIVA 3R9EA 1IYKA 4QBJA 4CS0B 5FVJA 5F49A 3CXQA 5H84A 2Z11A 3F8KA 2JEVA 1Z4EA 5DWMA 4B5PA 1N71A 4XPKA 3R95A 4KVXA 3EO4A 1RO5A 2D4OA 3TO7A 3FB3A 2BUEA 4KOVA 1XEBA 4JLYA 4YGOA 4R3KA 2B58A 5EBVA 4JWPA 4GS4A 4AVCA 2P6GA 1YVKA 4K30A 4KOWA 2I79A 4NF1A 3D2MA 1M1DA 1UFHA 4U5YA 1GHEA 4H6UA 1L0CA 1VHSA 4CAXA 3WR7A 5C88A 3JVNA 2P6EA 3R9FA 2FE7A 3TTHA 3P2FA 1TIQA 3PGPA 4M3SA 1OZPA 4LX9A 1MJBA 4II9A 5EC4A 4PSWA 4DNCA 1Y9WA 2FL4A 3PZJA 4JD6A 1CJWA 4QVTA 2C27A 4XNHC 2G3AA 1S60A 4KVME 1BO4A 1XIXA 4L89A 3CXPA 2B4BA 2GE3A 2R1IA 2ZXVA 2REFA 3FBUA 2B3VA 5HMNA 4JXQA 2AJ6A 3W6SA 3T90A 4FD6A 3QAHA 2H5MA 1S7FA 4R87A 3IGRA 3KKWA 2IL4A 4RS2A 1WK4A 2ZW4A 4QB9A 1U6MA 2BSWA 3F0AA 4XPDC 4QUSA 1S7KA 4L8AA 4HNXB 4NCZA 1P0HA 2Z10A 4R9MA 4UA3A 2R8VA 5F47A 4AVBA 3FYNA 2QMLA 2ZPAA 3EFAA 3R1KA 4KUBA 3N7ZA 2FIAA 2RC4A 1PU9A 2CNMA 2AE6A 4KOYA 2F5IA 3QB8A 4KOXA 2J8MA 2PDOA 4KORA 4MHDA 1M4DA 2X7BA 2HQYA 1I21A 4PSXA 1NSLA 1SQHA 2ZW7A 1KUXA 2GANA 4FD7A 2QIRA 3GY9A 5HH1A 4PV6A 1XF8A 4U9YA 4AVAA 4CRZB 4HNWB 3IWGA 4KOTA 4BMHA 3EY5A 2FCKA 2PSWA 3VWEA 2OZUA 4Y49C 4B5PB 2B4DA 4E0AA 3TO9A 3W91A 4E2AA 1J4JA 1NMTA 3G3SA 4AG7A 2J8RA 2NMTA 3BJ7A 1WWZA 3DDDA 5C82A 1ON0A 3EXNA 2WPWA 3DR8A 4ZBGA 4NEXA 1IYLA 3TFYA 3SXNA 3ZJ0A 2WPXA 3D8PA 3T9YA 5IV0A 1V0CA 2OB0A 4UBRA 1M4IA 4NSQA 2OH1A 5J8FA 4JJXA 3DR6A 1Y7RA 3R9GA 3TOBA 2FSRA 1S3ZA
chains in the Genus database with same CATH superfamily
3FMCA 3S9LA 2C1CA 3GKRA 5G22A 3B3SA 3WC7A 3RO0A 2AFXA 5D29A 3P2HA 5DWNA 1K4JA 3SJEA 2R7HA 4UF4A 1IU8A 1TF8A 5EMIA 4OC4A 3RYOA 3SHPA 1DTDA 4ZYQA 4NGNA 4MFPA 4ZI6A 1KUVA 6CPAA 1ZG9A 5AG6A 2JDCA 2V77A 3SJXA 3CXSA 4LQGA 2PE3A 1UWYA 3IU2A 2ATRA 1ARMA 4MFLA 4DYOA 4OAEA 4P4BA 4R3LA 3BXMA 1ZLIA 1M4GA 1LRZA 1YX0A 1ELMP 4FD4A 1LAMA 2CY2A 4OADA 1Z8XA 3MRUA 2CNSA 2Q7SA 3IWWA 4UIBA 4MY3A 2Q4YA 2JDDA 2Q04A 4CAFA 1IOFA 4KLVA 1YSJA 4MRIA 3TO6A 3MGDA 3FH4A 3TC8A 1YMEA 3D7GA 5KTCA 2B5GA 1ZG7A 4KS9A 3TOAA 4AB7A 4KLWA 3NE8A 4UCNA 4KZTA 1GYTA 5C88A 1B87A 1CM0A 2ZEPA 4P4IA 2PCUA 2KCWA 2Q43A 4XNHB 3PFOA 3B35A 1YVOA 4OC0A 1AMPA 2ZEGA 3NH4A 2QECA 2ZENA 3KHXA 3PBBA 4B10A 4TWEA 4MJ8A 2ZEHA 2Q4VA 2GLJA 2VQYA 3DNSA 3EC4A 2O28A 4WJBA 4MHPA 2ZW6A 4OC1A 4A94A 2VEZA 1TKJA 3FNCA 3PP9A 2YGWA 3NA6A 2OZHA 1QSTA 2QVPA 3I1UA 4A39A 1VHOA 4IF5A 3A9LA 1S7NA 4R7MA 1LFWA 4IUSA 4JYWA 3D2PA 2I00A 2FVGA 4CPAA 2PR1A 2YNEA 4DJLA 1BOBA 2Z0ZA 1S5KA 1YGHA 2F7VA 4UWJA 1Q2YA 1TXRA 2JLMA 3QAYA 4C7IA 3SI0A 2V8HA 4ONUA 4JXRA 3PRTA 4OC3A 2AFWA 3KGQA 3SJGA 4CYQA 3JRUA 5HVHA 1QSNA 2VI7A 4KSAA 1S7LA 1Z4RA 4MHNA 4MBUA 1PUAA 4DUKA 4RI1A 2AFUA 3IC1A 4NGMA 4M6IA 2ZW5A 3D4UA 5LRGA 4F9UA 2D4PA 3FXTA 2FS5A 2DXQA 5LRJA 2Z3MA 3K9UA 1R3NA 3DGVA 1QQ9A 1NE9A 2DPSA 4OC2A 4P4EA 2Z3OA 4QC6A 1YLEA 3WC6A 2PQ8A 3GLJA 4A2ZA 3SXOA 3FRMA 3PEIA 1JWQA 4Z65A 1XMTA 2PC1A 3H8EA 2HB6A 4GXHA 3BLNA 3V8IA 4MCSA 3B2YA 4OLLA 5GCNA 4MHYA 3B3TA 4P4FA 2PJ4A 2PR8A 2OU2A 1YW6A 1RXTA 1IIDA 4MY0A 2IJZA 1Q2CA 3TCVA 2JBKA 2EVNA 5IX3A 2CF4A 2HUZA 2DF5A 2GFQA 4P10A 4KOSA 4R76A 1AUGA 1XE4A 2BL1A 3IU1A 4CGMA 2PVVA 4P4JA 2ZOGA 4F0YA 3H4QA 4H6ZA 3TE4A 2YNDA 3N5FA 5G21A 2B4DB 5LYDA 2Q7BA 4A32A 1HDQA 3NE7A 4NFRA 5CNPA 1MJ9A 5JPHA 1LAPA 3JUWA 5JGFA 1Y9KA 1IGBA 2P6FA 4PK2A 4EMEA 2G0BA 5THWA 2PJ7A 4LUAA 1TF9A 4UCPA 3H5ZA 4IAVA 3ZZIA 3I9SA 4MCRA 2POKA 4UFWA 4KUAA 1BAVA 4PK3A 4CAEA 2VZYA 3S6HA 3IFEA 3KASA 5K8MA 2FT0A 1MJAA 1QSOA 4R57A 1P4NA 3C26A 3VARA 4NXYA 1LCPA 2PJ1A 7CPAA 4ONWA 4MFKA 1H8LA 2ARHA 3RBUA 4X3RA 2Q0YA 3B3CA 2EO8A 4B5OA 4H2KA 2WZNA 3VWDA 3KR5A 4KOUA 4MCQA 4UFVA 2HV2A 4C2ZA 4P44A 5I0CA 1PYTB 3KZWA 4XPLA 3S6GA 4U9ZA 5KTDA 3DSBA 4Y49B 5LYIA 2VL1A 5JM6A 1YREA 2VZZA 4BBHA 5F46A 2XEGA 1YLOA 3UY5A 4CAWA 4F6AA 3RNZA 1Q7LA 5JQ4A 2QJ8A 1B6BA 2G3TA 3OWCA 2JBJA 4AG9A 1LOKA 3CPAA 1IICA 4C68A 2YNCA 4BINA 1YR0A 2AFSA 2Y0MA 4H89A 4W9YA 5E96A 4FAIA 2A4NA 4I49A 5H86A 2ANPA 1MK4A 4M85A 5I4MA 3LMSA 4E8OA 1Q2DA 1Y0YA 4HKFA 1QSMA 1CP7A 2BEIA 4ORFA 3E0KA 4P45A 3D7FA 2DPTA 4NJQA 4EVYA 2WSAA 4CYPA 1R57A 3BHXA 1YW4A 2RB7A 4KVOE 3S6KA 4FD5A 1KUYA 1KZFA 1Z9UA 2FIWA 3D3SA 3I3GA 3PB7X 3IJ3A 5IB9A 4X8IA 2IQ6A 4X2TA 4CAVA 3FJUA 3G8WA 4YFJA 4CGPA 5LYLA 1QSRA 3FIXA 5J8CA 4UEFA 4CRYB 3GB0A 4CGOA 3KQZA 4NGQA 1BPNA 1YK3A 2REEA 3KQXA 2VBQA 3FEDA 1FY7A 3W6XA 4A33A 5ISVA 3PB4X 1LANA 2PRBA 5A28A 1VKCA 3D66A 3R96A 2EK9A 3B8GA 1CP6A 2C6PA 3LODA 3BJ8A 5KTAA 2B5GB 3S6FA 1M44A 4B14A 2EUIA 3SI1A 4PXCA 3VATA 4C7HA 1CG2A 4ZY0A 3S9NA 2FXFA 3F5BA 3RAMA 1I12A 1CBXA 1NSAA 1Z5RA 2CNTA 2Q44A 2B3UA 1YQEA 5CPAA 2OZGA 5F48A 3TX8A 2K5TA 2P0WA 2PJAA 1FNOA 4CGLA 5K8NA 4R8FA 2PJ8A 2O4HA 2R98A 3PFEA 4X5KA 5AG7A 1EE3P 2AFMA 3B3VA 4HNYB 1KWMA 4UWIA 2ZEMA 1I1DA 4CYOA 3TT2A 5IB0A 1IB1E 4YRHA 5AGEA 2RFHA 4MI4A 2VXKA 3LD2A 4XPDB 2GREA 3GYAA 4M6HA 5HVFA 2EBJA 4J3GA 2JEWA 2Z3LA 2J8NA 4OP4A 3FF3A 2WUUA 2NSMA 2GIVA 3S9MA 1XMBA 3R9EA 2PIZA 4PXBA 1IYKA 4QBJA 3IWEA 4CS0B 3KR4A 2PJ6A 3WT4A 5FVJA 4C2YA 2O53A 4WWVA 1Z8WA 3K9TA 1XJOA 5F49A 3CXQA 4RN7A 1ZG8A 5H84A 2Z11A 3F8KA 2JEVA 1Z4EA 4EFDA 5HXDA 1ZLHA 4OIWA 5DWMA 4B5PA 1Z2LA 2ZELA 1N71A 2F8HA 1F2OA 4XPKA 3R95A 1VIXA 3QNVA 4KVXA 3EO4A 4NGTA 4F8ZA 1RO5A 1Y7EA 2D4OA 1Z8LA 2ZEDA 1X10A 4KSFA 3TO7A 1RTQA 3D7DA 2BUEA 3FB3A 4KOVA 4UCMA 4B11A 5HVGA 1XEBA 4JLYA 5K8PA 1QMUA 4YGOA 4R3KA 2B58A 2QYVA 3H8GA 5EBVA 4JWPA 3HLPA 4GS4A 4PQAA 2OOTA 3V38A 2P6GA 4AVCA 1YVKA 4K30A 3D67A 4KOWA 2G9DA 4MCPA 3NFZA 2I79A 4NF1A 3VH9A 3D2MA 1M1DA 1UFHA 4U5YA 1GHEA 4H6UA 1F57A 1L0CA 1VHSA 2PJCA 4ZY2A 1XBUA 3WR7A 4CAXA 3JVNA 2P6EA 3R9FA 3V7ZA 2V8GA 1ZO0A 2FE7A 3LACA 4A38A 3TTHA 4CYNA 3FECA 3P2FA 1TIQA 1Y0RA 2Q51A 4A37A 3PGPA 5CBMA 3FVLA 4M3SA 2PRQA 1OZPA 5LRKA 4LX9A 1MJBA 4Q38A 4II9A 2IMOA 2V8VA 5EC4A 4FWUA 4PSWA 4DNCA 3KL9A 1Y9WA 2FL4A 3ISZA 3L2NA 3PZJA 4JD6A 4M6GA 4OKOA 2ZEFA 1CJWA 4QVTA 3KI9A 4C2XA 2ZEEA 2C27A 4XNHC 3ISXA 1R43A 2G3AA 4R6TA 1S60A 4KVME 3WABA 2EWBA 1BO4A 1XIXA 4PXDA 1CX8A 4L89A 5F09A 4ZGYB 1JQGA 3CXPA 2B4BA 2GE3A 2R1IA 1XRYA 4O23A 3CZXA 2ZXVA 5J1QA 2REFA 4A95A 3FBUA 1M4LA 2B3VA 4MXUA 5HMNA 3PBEA 2GU2A 4Q36A 2CTBA 2CXAA 4JXQA 5DS0A 5ELYA 4MMOA 3DLJA 2AJ6A 5G1ZA 3B3WA 2ZEOA 3W6SA 3T90A 4FD6A 3FX6A 3K2KA 3QAHA 2H5MA 1S7FA 4R87A 5AG5A 4BD9A 3IGRA 3KKWA 2IL4A 4RS2A 1WK4A 2ZW4A 4QB9A 1U6MA 2BSWA 1TKFA 2WYRA 3F0AA 4GM5A 4B13A 5LYFA 3NH8A 2EK8A 3PB6X 4QUSA 4XPDC 4AXVA 5BWAB 2V8DA 2DEAA 1S7KA 2PJBA 4L8AA 1TKHA 4HNXB 4NCZA 3SI2A 1P0HA 2Z3NA 4ZX8A 2PVWA 2PJ5A 2ABZA 3WC5A 2J9AA 4P6YA 2Z10A 1DE4C 4R9MA 2CIJA 3D68A 4B12A 4UA3A 2R8VA 1ARLA 3HUVA 5F47A 4AVBA 3LWUA 4HPSA 3FYNA 4RUHA 4OMEA 4A30A 2QMLA 2C6GA 2ZPAA 3EFAA 4UEEA 1IY7A 2Z3PA 3R1KA 4KUBA 3KHZA 3N7ZA 1X12A 2HC9A 5D8NA 4NGPA 4TNUA 2FIAA 2RC4A 4YWYA 1PU9A 2CNMA 3B7IA 4UIAA 5JH9A 2AE6A 4KOYA 2ODFA 4OIDA 2F5IA 3GIUA 3QB8A 4KOXA 2J8MA 2PDOA 4KORA 4KSIA 4MHDA 3PB8X 1M4DA 2X7BA 2BCOA 2HQYA 3SJFA 2XEIA 2PJ3A 1I21A 4PSXA 2Z3KA 4MHZA 1NSLA 2BOAA 1SQHA 1Z8TA 2ZW7A 4ZY1A 1FT7A 1KUXA 2GANA 1CPXA 4FD7A 2BO9A 2I3CA 2C6CA 2QIRA 3GY9A 3MN8A 5HH1A 2XEJA 3CT9A 4PXEA 4PV6A 4ZX9A 1XF8A 1HEEA 4U9YA 4AVAA 4CRZB 4MFQA 2Q4ZA 2NYQA 4HNWB 1XOVA 3BI1A 3IWGA 2PJ2A 4KOTA 8CPAA 1XFOA 1OBRA 4OC5A 3RZAA 4CGNA 1HDUA 3IIBA 2OR4A 3FEEA 4BMHA 3EY5A 2FCKA 2PSWA 3CDXA 1CPSA 2PJ9A 3VWEA 3CPXA 2OZUA 2XEFA 4K3NA 4Y49C 4MFZA 4B5PB 2B4DA 4NGSA 4UFXA 4E0AA 4NJRA 3TO9A 3W91A 4IK2A 4E2AA 1J4JA 5AG4A 1NMTA 3D7HA 3GUXA 3G3SA 4AG7A 4F9VA 3PB9X 1BPMA 4FUUA 2J8RA 1IOIA 2NMTA 2PJ0A 4YU9A 3BJ7A 1WWZA 1PCAA 3DDDA 4LQ6A 5C82A 2GLFA 4A31A 1ON0A 1VHEA 3EXNA 2WPWA 3DR8A 4ZBGA 1A2ZA 3IO1A 4NEXA 4F0XA 1IYLA 1AYEA 4MFJA 3TFYA 3SXNA 4PPZA 4UEZA 2WPXA 3ZJ0A 5A27A 3D8PA 3T8WA 2ZOFA 3T9YA 4FBEA 4EWTA 5IV0A 3JTKA 2YNCC 1BLLE 2AFOA 4NGRA 1V0CA 2CTCA 4JZ0A 3BI0A 2OB0A 2AFZA 4UBRA 1M4IA 5K8OA 5G20A 4NSQA 2OH1A 5J8FA 3H8FA 4JJXA 3DR6A 3IEHA 3NH5A 2PIYA 1Y7RA 3R9GA 4B6ZA 1VGYA 4Q7AA 1ELLP 4G1PA 4P4DA 3TOBA 4IHMA 1F2PA 2FSRA 1S3ZA
chains in the Genus database with same CATH topology
3GKRA 5G22A 3P2HA 5DWNA 1K4JA 2R7HA 3RYOA 3SHPA 4MFPA 1KUVA 5AG6A 2JDCA 3CXSA 3IU2A 2ATRA 4MFLA 4OAEA 4R3LA 1M4GA 1LRZA 1YX0A 4FD4A 2CY2A 4OADA 2CNSA 4MY3A 2Q4YA 2JDDA 2Q04A 4CAFA 4KLVA 3TO6A 3MGDA 5KTCA 2B5GA 4KS9A 3TOAA 4AB7A 4KLWA 4UCNA 4KZTA 1B87A 1CM0A 2KCWA 4XNHB 1YVOA 2QECA 4B10A 4MJ8A 2Q4VA 2VQYA 3DNSA 3EC4A 2O28A 2ZW6A 2VEZA 3FNCA 3PP9A 2YGWA 2OZHA 1QSTA 4IF5A 3A9LA 1S7NA 4IUSA 3D2PA 2I00A 2PR1A 2YNEA 1BOBA 2Z0ZA 1S5KA 1YGHA 4UWJA 1Q2YA 2JLMA 4C7IA 4ONUA 4JXRA 4CYQA 1QSNA 2VI7A 4KSAA 1S7LA 1Z4RA 4MBUA 1PUAA 4RI1A 2ZW5A 2D4PA 3FXTA 2FS5A 2DXQA 3K9UA 2Z3MA 1NE9A 2DPSA 2Z3OA 4QC6A 1YLEA 2PQ8A 4A2ZA 3SXOA 3FRMA 1XMTA 2PC1A 3BLNA 3V8IA 4OLLA 5GCNA 2PR8A 2OU2A 1RXTA 1IIDA 4MY0A 1Q2CA 3TCVA 2EVNA 5IX3A 2HUZA 4KOSA 1XE4A 2BL1A 3IU1A 4CGMA 4F0YA 3H4QA 4H6ZA 3TE4A 2YNDA 5G21A 2B4DB 2Q7BA 4A32A 3NE7A 5CNPA 1MJ9A 5JPHA 3JUWA 1Y9KA 2P6FA 4PK2A 2G0BA 4LUAA 4UCPA 3H5ZA 3ZZIA 3I9SA 4UFWA 4KUAA 4PK3A 4CAEA 2VZYA 3S6HA 2FT0A 1MJAA 1QSOA 4R57A 1P4NA 3C26A 4NXYA 4MFKA 2ARHA 2Q0YA 4B5OA 3VWDA 4KOUA 4UFVA 2HV2A 4C2ZA 5I0CA 4XPLA 3S6GA 4U9ZA 5KTDA 3DSBA 4Y49B 1YREA 2VZZA 4BBHA 5F46A 3UY5A 4CAWA 4F6AA 5JQ4A 1B6BA 2G3TA 3OWCA 4AG9A 4C68A 1IICA 2YNCA 1YR0A 2Y0MA 4H89A 5E96A 2A4NA 4I49A 5H86A 4M85A 1MK4A 4E8OA 1Q2DA 4HKFA 1QSMA 2BEIA 4ORFA 3E0KA 2DPTA 4EVYA 2WSAA 4CYPA 1R57A 4KVOE 3S6KA 4FD5A 1KUYA 1KZFA 1Z9UA 2FIWA 3D3SA 3I3GA 4CAVA 3G8WA 4YFJA 4CGPA 1QSRA 3FIXA 5J8CA 4CRYB 4CGOA 1YK3A 2REEA 3W6XA 2VBQA 4A33A 1FY7A 5ISVA 2PRBA 5A28A 1VKCA 3R96A 3B8GA 3LODA 3BJ8A 5KTAA 2B5GB 3S6FA 1M44A 4B14A 2EUIA 4C7HA 2FXFA 3F5BA 1I12A 2CNTA 2Q44A 2B3UA 2OZGA 5F48A 2K5TA 2P0WA 4CGLA 2R98A 5AG7A 4X5KA 4HNYB 4UWIA 1I1DA 4CYOA 3TT2A 5IB0A 1IB1E 4YRHA 5AGEA 4MI4A 2VXKA 3LD2A 4XPDB 3GYAA 4J3GA 2Z3LA 2J8NA 2WUUA 2GIVA 3R9EA 1IYKA 4QBJA 3IWEA 4CS0B 5FVJA 4C2YA 5F49A 3CXQA 5H84A 2Z11A 3F8KA 2JEVA 1Z4EA 5DWMA 4B5PA 1N71A 4XPKA 3R95A 4KVXA 3EO4A 1RO5A 2D4OA 4KSFA 3TO7A 3FB3A 2BUEA 4KOVA 4UCMA 4B11A 1XEBA 4JLYA 4YGOA 4R3KA 2B58A 5EBVA 4JWPA 4GS4A 4AVCA 2P6GA 1YVKA 4K30A 4KOWA 2I79A 4NF1A 3D2MA 1M1DA 1UFHA 4U5YA 1GHEA 4H6UA 1L0CA 1VHSA 4CAXA 3WR7A 5C88A 3JVNA 2P6EA 3R9FA 1ZO0A 2FE7A 3TTHA 4CYNA 3P2FA 1TIQA 3PGPA 4M3SA 1OZPA 4LX9A 1MJBA 4Q38A 4II9A 5EC4A 4PSWA 4DNCA 1Y9WA 2FL4A 3PZJA 4JD6A 1CJWA 4QVTA 4C2XA 2C27A 4XNHC 2G3AA 1S60A 4KVME 1BO4A 1XIXA 4L89A 4ZGYB 3CXPA 2B4BA 2GE3A 2R1IA 2ZXVA 2REFA 4A95A 3FBUA 2B3VA 5HMNA 4Q36A 4JXQA 2CXAA 2AJ6A 5G1ZA 3W6SA 3T90A 4FD6A 3QAHA 2H5MA 1S7FA 4R87A 5AG5A 3IGRA 3KKWA 2IL4A 4RS2A 1WK4A 2ZW4A 4QB9A 1U6MA 2BSWA 3F0AA 4B13A 4XPDC 4QUSA 5BWAB 1S7KA 4L8AA 4HNXB 4NCZA 1P0HA 2Z3NA 2Z10A 4R9MA 4B12A 4UA3A 2R8VA 5F47A 4AVBA 3FYNA 4A30A 2QMLA 2ZPAA 3EFAA 2Z3PA 3R1KA 4KUBA 3N7ZA 2FIAA 2RC4A 1PU9A 2CNMA 2AE6A 4KOYA 2F5IA 3QB8A 4KOXA 2J8MA 2PDOA 4KORA 4MHDA 1M4DA 2X7BA 2HQYA 1I21A 4PSXA 2Z3KA 1NSLA 1SQHA 2ZW7A 1KUXA 2GANA 4FD7A 2QIRA 3GY9A 5HH1A 4PV6A 1XF8A 4U9YA 4AVAA 4CRZB 4MFQA 4HNWB 3IWGA 4KOTA 4CGNA 4BMHA 3EY5A 2FCKA 2PSWA 3VWEA 2OZUA 4Y49C 4B5PB 4MFZA 2B4DA 4UFXA 4E0AA 3TO9A 3W91A 5AG4A 4E2AA 1J4JA 1NMTA 3G3SA 4AG7A 2J8RA 2NMTA 3BJ7A 1WWZA 3DDDA 5C82A 4A31A 1ON0A 3EXNA 2WPWA 3DR8A 4ZBGA 4NEXA 4F0XA 1IYLA 4MFJA 3TFYA 3SXNA 3ZJ0A 2WPXA 5A27A 3D8PA 3T9YA 5IV0A 3JTKA 2YNCC 1V0CA 2OB0A 4UBRA 1M4IA 5G20A 4NSQA 2OH1A 5J8FA 4JJXA 3DR6A 1Y7RA 3R9GA 3TOBA 2FSRA 1S3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GKR A;  3P2H A;  5DWN A;  1K4J A;  2R7H A;  3RYO A;  3SHP A;  1KUV A;  2JDC A;  3CXS A;  2ATR A;  4OAE A;  4R3L A;  1M4G A;  1LRZ A;  1YX0 A;  4FD4 A;  2CY2 A;  4OAD A;  2CNS A;  4MY3 A;  2Q4Y A;  2JDD A;  2Q04 A;  4KLV A;  3TO6 A;  3MGD A;  5KTC A;  2B5G A;  3TOA A;  4AB7 A;  4KLW A;  4KZT A;  1B87 A;  1CM0 A;  2KCW A;  4XNH B;  1YVO A;  2QEC A;  4MJ8 A;  2Q4V A;  2VQY A;  3DNS A;  3EC4 A;  2O28 A;  2ZW6 A;  2VEZ A;  3FNC A;  3PP9 A;  2OZH A;  1QST A;  4IF5 A;  1S7N A;  4IUS A;  3D2P A;  2I00 A;  2PR1 A;  1BOB A;  2Z0Z A;  1S5K A;  1YGH A;  4UWJ A;  1Q2Y A;  2JLM A;  4ONU A;  4JXR A;  1QSN A;  2VI7 A;  1S7L A;  1Z4R A;  4MBU A;  1PUA A;  4RI1 A;  2ZW5 A;  2D4P A;  3FXT A;  2FS5 A;  2DXQ A;  3K9U A;  1NE9 A;  4QC6 A;  1YLE A;  2PQ8 A;  3SXO A;  3FRM A;  1XMT A;  2PC1 A;  3BLN A;  3V8I A;  4OLL A;  5GCN A;  2PR8 A;  2OU2 A;  1RXT A;  1IID A;  4MY0 A;  1Q2C A;  3TCV A;  2EVN A;  5IX3 A;  2HUZ A;  4KOS A;  1XE4 A;  2BL1 A;  4F0Y A;  3H4Q A;  4H6Z A;  3TE4 A;  2B4D B;  2Q7B A;  3NE7 A;  5CNP A;  1MJ9 A;  5JPH A;  3JUW A;  1Y9K A;  2P6F A;  4PK2 A;  2G0B A;  4LUA A;  3ZZI A;  3I9S A;  4KUA A;  4PK3 A;  2VZY A;  3S6H A;  2FT0 A;  1MJA A;  1QSO A;  4R57 A;  1P4N A;  3C26 A;  4NXY A;  2ARH A;  2Q0Y A;  4B5O A;  3VWD A;  4KOU A;  2HV2 A;  5I0C A;  4XPL A;  3S6G A;  4U9Z A;  5KTD A;  3DSB A;  4Y49 B;  1YRE A;  2VZZ A;  5F46 A;  3UY5 A;  4CAW A;  4F6A A;  5JQ4 A;  1B6B A;  2G3T A;  3OWC A;  4AG9 A;  1IIC A;  1YR0 A;  2Y0M A;  4H89 A;  5E96 A;  2A4N A;  4I49 A;  5H86 A;  4M85 A;  1MK4 A;  4E8O A;  1Q2D A;  4HKF A;  1QSM A;  2BEI A;  4ORF A;  3E0K A;  4EVY A;  1R57 A;  4KVO E;  3S6K A;  4FD5 A;  1KUY A;  1KZF A;  1Z9U A;  2FIW A;  3D3S A;  3I3G A;  4CAV A;  3G8W A;  4YFJ A;  1QSR A;  3FIX A;  5J8C A;  4CRY B;  1YK3 A;  2REE A;  3W6X A;  2VBQ A;  5ISV A;  1FY7 A;  2PRB A;  1VKC A;  3R96 A;  3B8G A;  3LOD A;  3BJ8 A;  5KTA A;  2B5G B;  3S6F A;  1M44 A;  2EUI A;  2FXF A;  3F5B A;  1I12 A;  2CNT A;  2Q44 A;  2B3U A;  2OZG A;  5F48 A;  2K5T A;  2P0W A;  2R98 A;  4X5K A;  4HNY B;  4UWI A;  1I1D A;  3TT2 A;  5IB0 A;  1IB1 E;  4YRH A;  4MI4 A;  2VXK A;  3LD2 A;  4XPD B;  3GYA A;  4J3G A;  2J8N A;  2GIV A;  3R9E A;  1IYK A;  4QBJ A;  4CS0 B;  5FVJ A;  5F49 A;  3CXQ A;  5H84 A;  2Z11 A;  3F8K A;  2JEV A;  1Z4E A;  5DWM A;  4B5P A;  1N71 A;  4XPK A;  3R95 A;  4KVX A;  3EO4 A;  1RO5 A;  2D4O A;  3TO7 A;  3FB3 A;  2BUE A;  4KOV A;  1XEB A;  4JLY A;  4YGO A;  4R3K A;  2B58 A;  5EBV A;  4JWP A;  4GS4 A;  4AVC A;  2P6G A;  1YVK A;  4K30 A;  4KOW A;  2I79 A;  4NF1 A;  3D2M A;  1M1D A;  1UFH A;  4U5Y A;  1GHE A;  4H6U A;  1L0C A;  1VHS A;  4CAX A;  3WR7 A;  5C88 A;  3JVN A;  2P6E A;  3R9F A;  2FE7 A;  3TTH A;  3P2F A;  1TIQ A;  3PGP A;  4M3S A;  1OZP A;  4LX9 A;  1MJB A;  4II9 A;  5EC4 A;  4PSW A;  4DNC A;  1Y9W A;  2FL4 A;  3PZJ A;  4JD6 A;  1CJW A;  4QVT A;  2C27 A;  4XNH C;  2G3A A;  1S60 A;  4KVM E;  1BO4 A;  1XIX A;  4L89 A;  3CXP A;  2B4B A;  2GE3 A;  2R1I A;  2ZXV A;  2REF A;  3FBU A;  2B3V A;  5HMN A;  4JXQ A;  2AJ6 A;  3W6S A;  3T90 A;  4FD6 A;  3QAH A;  2H5M A;  1S7F A;  4R87 A;  3IGR A;  3KKW A;  2IL4 A;  4RS2 A;  1WK4 A;  2ZW4 A;  4QB9 A;  1U6M A;  2BSW A;  3F0A A;  4XPD C;  4QUS A;  1S7K A;  4L8A A;  4HNX B;  4NCZ A;  1P0H A;  2Z10 A;  4R9M A;  4UA3 A;  2R8V A;  5F47 A;  4AVB A;  3FYN A;  2QML A;  2ZPA A;  3EFA A;  3R1K A;  4KUB A;  3N7Z A;  2FIA A;  2RC4 A;  1PU9 A;  2CNM A;  2AE6 A;  4KOY A;  2F5I A;  3QB8 A;  4KOX A;  2J8M A;  2PDO A;  4KOR A;  4MHD A;  1M4D A;  2X7B A;  2HQY A;  1I21 A;  4PSX A;  1NSL A;  1SQH A;  2ZW7 A;  1KUX A;  2GAN A;  4FD7 A;  2QIR A;  3GY9 A;  5HH1 A;  4PV6 A;  1XF8 A;  4U9Y A;  4AVA A;  4CRZ B;  4HNW B;  3IWG A;  4KOT A;  4BMH A;  3EY5 A;  2FCK A;  2PSW A;  3VWE A;  2OZU A;  4Y49 C;  4B5P B;  2B4D A;  4E0A A;  3TO9 A;  3W91 A;  4E2A A;  1J4J A;  1NMT A;  3G3S A;  4AG7 A;  2J8R A;  2NMT A;  3BJ7 A;  1WWZ A;  3DDD A;  5C82 A;  1ON0 A;  3EXN A;  2WPW A;  3DR8 A;  4ZBG A;  4NEX A;  1IYL A;  3TFY A;  3SXN A;  3ZJ0 A;  2WPX A;  3D8P A;  3T9Y A;  5IV0 A;  1V0C A;  2OB0 A;  4UBR A;  1M4I A;  4NSQ A;  2OH1 A;  5J8F A;  4JJX A;  3DR6 A;  1Y7R A;  3R9G A;  3TOB A;  2FSR A;  1S3Z A; 
#chains in the Genus database with same CATH topology
 3FMC A;  3S9L A;  2C1C A;  3GKR A;  5G22 A;  3B3S A;  3WC7 A;  3RO0 A;  2AFX A;  5D29 A;  3P2H A;  5DWN A;  1K4J A;  3SJE A;  2R7H A;  4UF4 A;  1IU8 A;  1TF8 A;  5EMI A;  4OC4 A;  3RYO A;  3SHP A;  1DTD A;  4ZYQ A;  4NGN A;  4MFP A;  4ZI6 A;  1KUV A;  6CPA A;  1ZG9 A;  5AG6 A;  2JDC A;  2V77 A;  3SJX A;  3CXS A;  4LQG A;  2PE3 A;  1UWY A;  3IU2 A;  2ATR A;  1ARM A;  4MFL A;  4DYO A;  4OAE A;  4P4B A;  4R3L A;  3BXM A;  1ZLI A;  1M4G A;  1LRZ A;  1YX0 A;  1ELM P;  4FD4 A;  1LAM A;  2CY2 A;  4OAD A;  1Z8X A;  3MRU A;  2CNS A;  2Q7S A;  3IWW A;  4UIB A;  4MY3 A;  2Q4Y A;  2JDD A;  2Q04 A;  4CAF A;  1IOF A;  4KLV A;  1YSJ A;  4MRI A;  3TO6 A;  3MGD A;  3FH4 A;  3TC8 A;  1YME A;  3D7G A;  5KTC A;  2B5G A;  1ZG7 A;  4KS9 A;  3TOA A;  4AB7 A;  4KLW A;  3NE8 A;  4UCN A;  4KZT A;  1GYT A;  5C88 A;  1B87 A;  1CM0 A;  2ZEP A;  4P4I A;  2PCU A;  2KCW A;  2Q43 A;  4XNH B;  3PFO A;  3B35 A;  1YVO A;  4OC0 A;  1AMP A;  2ZEG A;  3NH4 A;  2QEC A;  2ZEN A;  3KHX A;  3PBB A;  4B10 A;  4TWE A;  4MJ8 A;  2ZEH A;  2Q4V A;  2GLJ A;  2VQY A;  3DNS A;  3EC4 A;  2O28 A;  4WJB A;  4MHP A;  2ZW6 A;  4OC1 A;  4A94 A;  2VEZ A;  1TKJ A;  3FNC A;  3PP9 A;  2YGW A;  3NA6 A;  2OZH A;  1QST A;  2QVP A;  3I1U A;  4A39 A;  1VHO A;  4IF5 A;  3A9L A;  1S7N A;  4R7M A;  1LFW A;  4IUS A;  4JYW A;  3D2P A;  2I00 A;  2FVG A;  4CPA A;  2PR1 A;  2YNE A;  4DJL A;  1BOB A;  2Z0Z A;  1S5K A;  1YGH A;  2F7V A;  4UWJ A;  1Q2Y A;  1TXR A;  2JLM A;  3QAY A;  4C7I A;  3SI0 A;  2V8H A;  4ONU A;  4JXR A;  3PRT A;  4OC3 A;  2AFW A;  3KGQ A;  3SJG A;  4CYQ A;  3JRU A;  5HVH A;  1QSN A;  2VI7 A;  4KSA A;  1S7L A;  1Z4R A;  4MHN A;  4MBU A;  1PUA A;  4DUK A;  4RI1 A;  2AFU A;  3IC1 A;  4NGM A;  4M6I A;  2ZW5 A;  3D4U A;  5LRG A;  4F9U A;  2D4P A;  3FXT A;  2FS5 A;  2DXQ A;  5LRJ A;  2Z3M A;  3K9U A;  1R3N A;  3DGV A;  1QQ9 A;  1NE9 A;  2DPS A;  4OC2 A;  4P4E A;  2Z3O A;  4QC6 A;  1YLE A;  3WC6 A;  2PQ8 A;  3GLJ A;  4A2Z A;  3SXO A;  3FRM A;  3PEI A;  1JWQ A;  4Z65 A;  1XMT A;  2PC1 A;  3H8E A;  2HB6 A;  4GXH A;  3BLN A;  3V8I A;  4MCS A;  3B2Y A;  4OLL A;  5GCN A;  4MHY A;  3B3T A;  4P4F A;  2PJ4 A;  2PR8 A;  2OU2 A;  1YW6 A;  1RXT A;  1IID A;  4MY0 A;  2IJZ A;  1Q2C A;  3TCV A;  2JBK A;  2EVN A;  5IX3 A;  2CF4 A;  2HUZ A;  2DF5 A;  2GFQ A;  4P10 A;  4KOS A;  4R76 A;  1AUG A;  1XE4 A;  2BL1 A;  3IU1 A;  4CGM A;  2PVV A;  4P4J A;  2ZOG A;  4F0Y A;  3H4Q A;  4H6Z A;  3TE4 A;  2YND A;  3N5F A;  5G21 A;  2B4D B;  5LYD A;  2Q7B A;  4A32 A;  1HDQ A;  3NE7 A;  4NFR A;  5CNP A;  1MJ9 A;  5JPH A;  1LAP A;  3JUW A;  5JGF A;  1Y9K A;  1IGB A;  2P6F A;  4PK2 A;  4EME A;  2G0B A;  5THW A;  2PJ7 A;  4LUA A;  1TF9 A;  4UCP A;  3H5Z A;  4IAV A;  3ZZI A;  3I9S A;  4MCR A;  2POK A;  4UFW A;  4KUA A;  1BAV A;  4PK3 A;  4CAE A;  2VZY A;  3S6H A;  3IFE A;  3KAS A;  5K8M A;  2FT0 A;  1MJA A;  1QSO A;  4R57 A;  1P4N A;  3C26 A;  3VAR A;  4NXY A;  1LCP A;  2PJ1 A;  7CPA A;  4ONW A;  4MFK A;  1H8L A;  2ARH A;  3RBU A;  4X3R A;  2Q0Y A;  3B3C A;  2EO8 A;  4B5O A;  4H2K A;  2WZN A;  3VWD A;  3KR5 A;  4KOU A;  4MCQ A;  4UFV A;  2HV2 A;  4C2Z A;  4P44 A;  5I0C A;  1PYT B;  3KZW A;  4XPL A;  3S6G A;  4U9Z A;  5KTD A;  3DSB A;  4Y49 B;  5LYI A;  2VL1 A;  5JM6 A;  1YRE A;  2VZZ A;  4BBH A;  5F46 A;  2XEG A;  1YLO A;  3UY5 A;  4CAW A;  4F6A A;  3RNZ A;  1Q7L A;  5JQ4 A;  2QJ8 A;  1B6B A;  2G3T A;  3OWC A;  2JBJ A;  4AG9 A;  1LOK A;  3CPA A;  1IIC A;  4C68 A;  2YNC A;  4BIN A;  1YR0 A;  2AFS A;  2Y0M A;  4H89 A;  4W9Y A;  5E96 A;  4FAI A;  2A4N A;  4I49 A;  5H86 A;  2ANP A;  1MK4 A;  4M85 A;  5I4M A;  3LMS A;  4E8O A;  1Q2D A;  1Y0Y A;  4HKF A;  1QSM A;  1CP7 A;  2BEI A;  4ORF A;  3E0K A;  4P45 A;  3D7F A;  2DPT A;  4NJQ A;  4EVY A;  2WSA A;  4CYP A;  1R57 A;  3BHX A;  1YW4 A;  2RB7 A;  4KVO E;  3S6K A;  4FD5 A;  1KUY A;  1KZF A;  1Z9U A;  2FIW A;  3D3S A;  3I3G A;  3PB7 X;  3IJ3 A;  5IB9 A;  4X8I A;  2IQ6 A;  4X2T A;  4CAV A;  3FJU A;  3G8W A;  4YFJ A;  4CGP A;  5LYL A;  1QSR A;  3FIX A;  5J8C A;  4UEF A;  4CRY B;  3GB0 A;  4CGO A;  3KQZ A;  4NGQ A;  1BPN A;  1YK3 A;  2REE A;  3KQX A;  2VBQ A;  3FED A;  1FY7 A;  3W6X A;  4A33 A;  5ISV A;  3PB4 X;  1LAN A;  2PRB A;  5A28 A;  1VKC A;  3D66 A;  3R96 A;  2EK9 A;  3B8G A;  1CP6 A;  2C6P A;  3LOD A;  3BJ8 A;  5KTA A;  2B5G B;  3S6F A;  1M44 A;  4B14 A;  2EUI A;  3SI1 A;  4PXC A;  3VAT A;  4C7H A;  1CG2 A;  4ZY0 A;  3S9N A;  2FXF A;  3F5B A;  3RAM A;  1I12 A;  1CBX A;  1NSA A;  1Z5R A;  2CNT A;  2Q44 A;  2B3U A;  1YQE A;  5CPA A;  2OZG A;  5F48 A;  3TX8 A;  2K5T A;  2P0W A;  2PJA A;  1FNO A;  4CGL A;  5K8N A;  4R8F A;  2PJ8 A;  2O4H A;  2R98 A;  3PFE A;  4X5K A;  5AG7 A;  1EE3 P;  2AFM A;  3B3V A;  4HNY B;  1KWM A;  4UWI A;  2ZEM A;  1I1D A;  4CYO A;  3TT2 A;  5IB0 A;  1IB1 E;  4YRH A;  5AGE A;  2RFH A;  4MI4 A;  2VXK A;  3LD2 A;  4XPD B;  2GRE A;  3GYA A;  4M6H A;  5HVF A;  2EBJ A;  4J3G A;  2JEW A;  2Z3L A;  2J8N A;  4OP4 A;  3FF3 A;  2WUU A;  2NSM A;  2GIV A;  3S9M A;  1XMB A;  3R9E A;  2PIZ A;  4PXB A;  1IYK A;  4QBJ A;  3IWE A;  4CS0 B;  3KR4 A;  2PJ6 A;  3WT4 A;  5FVJ A;  4C2Y A;  2O53 A;  4WWV A;  1Z8W A;  3K9T A;  1XJO A;  5F49 A;  3CXQ A;  4RN7 A;  1ZG8 A;  5H84 A;  2Z11 A;  3F8K A;  2JEV A;  1Z4E A;  4EFD A;  5HXD A;  1ZLH A;  4OIW A;  5DWM A;  4B5P A;  1Z2L A;  2ZEL A;  1N71 A;  2F8H A;  1F2O A;  4XPK A;  3R95 A;  1VIX A;  3QNV A;  4KVX A;  3EO4 A;  4NGT A;  4F8Z A;  1RO5 A;  1Y7E A;  2D4O A;  1Z8L A;  2ZED A;  1X10 A;  4KSF A;  3TO7 A;  1RTQ A;  3D7D A;  2BUE A;  3FB3 A;  4KOV A;  4UCM A;  4B11 A;  5HVG A;  1XEB A;  4JLY A;  5K8P A;  1QMU A;  4YGO A;  4R3K A;  2B58 A;  2QYV A;  3H8G A;  5EBV A;  4JWP A;  3HLP A;  4GS4 A;  4PQA A;  2OOT A;  3V38 A;  2P6G A;  4AVC A;  1YVK A;  4K30 A;  3D67 A;  4KOW A;  2G9D A;  4MCP A;  3NFZ A;  2I79 A;  4NF1 A;  3VH9 A;  3D2M A;  1M1D A;  1UFH A;  4U5Y A;  1GHE A;  4H6U A;  1F57 A;  1L0C A;  1VHS A;  2PJC A;  4ZY2 A;  1XBU A;  3WR7 A;  4CAX A;  3JVN A;  2P6E A;  3R9F A;  3V7Z A;  2V8G A;  1ZO0 A;  2FE7 A;  3LAC A;  4A38 A;  3TTH A;  4CYN A;  3FEC A;  3P2F A;  1TIQ A;  1Y0R A;  2Q51 A;  4A37 A;  3PGP A;  5CBM A;  3FVL A;  4M3S A;  2PRQ A;  1OZP A;  5LRK A;  4LX9 A;  1MJB A;  4Q38 A;  4II9 A;  2IMO A;  2V8V A;  5EC4 A;  4FWU A;  4PSW A;  4DNC A;  3KL9 A;  1Y9W A;  2FL4 A;  3ISZ A;  3L2N A;  3PZJ A;  4JD6 A;  4M6G A;  4OKO A;  2ZEF A;  1CJW A;  4QVT A;  3KI9 A;  4C2X A;  2ZEE A;  2C27 A;  4XNH C;  3ISX A;  1R43 A;  2G3A A;  4R6T A;  1S60 A;  4KVM E;  3WAB A;  2EWB A;  1BO4 A;  1XIX A;  4PXD A;  1CX8 A;  4L89 A;  5F09 A;  4ZGY B;  1JQG A;  3CXP A;  2B4B A;  2GE3 A;  2R1I A;  1XRY A;  4O23 A;  3CZX A;  2ZXV A;  5J1Q A;  2REF A;  4A95 A;  3FBU A;  1M4L A;  2B3V A;  4MXU A;  5HMN A;  3PBE A;  2GU2 A;  4Q36 A;  2CTB A;  2CXA A;  4JXQ A;  5DS0 A;  5ELY A;  4MMO A;  3DLJ A;  2AJ6 A;  5G1Z A;  3B3W A;  2ZEO A;  3W6S A;  3T90 A;  4FD6 A;  3FX6 A;  3K2K A;  3QAH A;  2H5M A;  1S7F A;  4R87 A;  5AG5 A;  4BD9 A;  3IGR A;  3KKW A;  2IL4 A;  4RS2 A;  1WK4 A;  2ZW4 A;  4QB9 A;  1U6M A;  2BSW A;  1TKF A;  2WYR A;  3F0A A;  4GM5 A;  4B13 A;  5LYF A;  3NH8 A;  2EK8 A;  3PB6 X;  4QUS A;  4XPD C;  4AXV A;  5BWA B;  2V8D A;  2DEA A;  1S7K A;  2PJB A;  4L8A A;  1TKH A;  4HNX B;  4NCZ A;  3SI2 A;  1P0H A;  2Z3N A;  4ZX8 A;  2PVW A;  2PJ5 A;  2ABZ A;  3WC5 A;  2J9A A;  4P6Y A;  2Z10 A;  1DE4 C;  4R9M A;  2CIJ A;  3D68 A;  4B12 A;  4UA3 A;  2R8V A;  1ARL A;  3HUV A;  5F47 A;  4AVB A;  3LWU A;  4HPS A;  3FYN A;  4RUH A;  4OME A;  4A30 A;  2QML A;  2C6G A;  2ZPA A;  3EFA A;  4UEE A;  1IY7 A;  2Z3P A;  3R1K A;  4KUB A;  3KHZ A;  3N7Z A;  1X12 A;  2HC9 A;  5D8N A;  4NGP A;  4TNU A;  2FIA A;  2RC4 A;  4YWY A;  1PU9 A;  2CNM A;  3B7I A;  4UIA A;  5JH9 A;  2AE6 A;  4KOY A;  2ODF A;  4OID A;  2F5I A;  3GIU A;  3QB8 A;  4KOX A;  2J8M A;  2PDO A;  4KOR A;  4KSI A;  4MHD A;  3PB8 X;  1M4D A;  2X7B A;  2BCO A;  2HQY A;  3SJF A;  2XEI A;  2PJ3 A;  1I21 A;  4PSX A;  2Z3K A;  4MHZ A;  1NSL A;  2BOA A;  1SQH A;  1Z8T A;  2ZW7 A;  4ZY1 A;  1FT7 A;  1KUX A;  2GAN A;  1CPX A;  4FD7 A;  2BO9 A;  2I3C A;  2C6C A;  2QIR A;  3GY9 A;  3MN8 A;  5HH1 A;  2XEJ A;  3CT9 A;  4PXE A;  4PV6 A;  4ZX9 A;  1XF8 A;  1HEE A;  4U9Y A;  4AVA A;  4CRZ B;  4MFQ A;  2Q4Z A;  2NYQ A;  4HNW B;  1XOV A;  3BI1 A;  3IWG A;  2PJ2 A;  4KOT A;  8CPA A;  1XFO A;  1OBR A;  4OC5 A;  3RZA A;  4CGN A;  1HDU A;  3IIB A;  2OR4 A;  3FEE A;  4BMH A;  3EY5 A;  2FCK A;  2PSW A;  3CDX A;  1CPS A;  2PJ9 A;  3VWE A;  3CPX A;  2OZU A;  2XEF A;  4K3N A;  4Y49 C;  4MFZ A;  4B5P B;  2B4D A;  4NGS A;  4UFX A;  4E0A A;  4NJR A;  3TO9 A;  3W91 A;  4IK2 A;  4E2A A;  1J4J A;  5AG4 A;  1NMT A;  3D7H A;  3GUX A;  3G3S A;  4AG7 A;  4F9V A;  3PB9 X;  1BPM A;  4FUU A;  2J8R A;  1IOI A;  2NMT A;  2PJ0 A;  4YU9 A;  3BJ7 A;  1WWZ A;  1PCA A;  3DDD A;  4LQ6 A;  5C82 A;  2GLF A;  4A31 A;  1ON0 A;  1VHE A;  3EXN A;  2WPW A;  3DR8 A;  4ZBG A;  1A2Z A;  3IO1 A;  4NEX A;  4F0X A;  1IYL A;  1AYE A;  4MFJ A;  3TFY A;  3SXN A;  4PPZ A;  4UEZ A;  2WPX A;  3ZJ0 A;  5A27 A;  3D8P A;  3T8W A;  2ZOF A;  3T9Y A;  4FBE A;  4EWT A;  5IV0 A;  3JTK A;  2YNC C;  1BLL E;  2AFO A;  4NGR A;  1V0C A;  2CTC A;  4JZ0 A;  3BI0 A;  2OB0 A;  2AFZ A;  4UBR A;  1M4I A;  5K8O A;  5G20 A;  4NSQ A;  2OH1 A;  5J8F A;  3H8F A;  4JJX A;  3DR6 A;  3IEH A;  3NH5 A;  2PIY A;  1Y7R A;  3R9G A;  4B6Z A;  1VGY A;  4Q7A A;  1ELL P;  4G1P A;  4P4D A;  3TOB A;  4IHM A;  1F2P A;  2FSR A;  1S3Z A; 
#chains in the Genus database with same CATH homology
 3GKR A;  5G22 A;  3P2H A;  5DWN A;  1K4J A;  2R7H A;  3RYO A;  3SHP A;  4MFP A;  1KUV A;  5AG6 A;  2JDC A;  3CXS A;  3IU2 A;  2ATR A;  4MFL A;  4OAE A;  4R3L A;  1M4G A;  1LRZ A;  1YX0 A;  4FD4 A;  2CY2 A;  4OAD A;  2CNS A;  4MY3 A;  2Q4Y A;  2JDD A;  2Q04 A;  4CAF A;  4KLV A;  3TO6 A;  3MGD A;  5KTC A;  2B5G A;  4KS9 A;  3TOA A;  4AB7 A;  4KLW A;  4UCN A;  4KZT A;  1B87 A;  1CM0 A;  2KCW A;  4XNH B;  1YVO A;  2QEC A;  4B10 A;  4MJ8 A;  2Q4V A;  2VQY A;  3DNS A;  3EC4 A;  2O28 A;  2ZW6 A;  2VEZ A;  3FNC A;  3PP9 A;  2YGW A;  2OZH A;  1QST A;  4IF5 A;  3A9L A;  1S7N A;  4IUS A;  3D2P A;  2I00 A;  2PR1 A;  2YNE A;  1BOB A;  2Z0Z A;  1S5K A;  1YGH A;  4UWJ A;  1Q2Y A;  2JLM A;  4C7I A;  4ONU A;  4JXR A;  4CYQ A;  1QSN A;  2VI7 A;  4KSA A;  1S7L A;  1Z4R A;  4MBU A;  1PUA A;  4RI1 A;  2ZW5 A;  2D4P A;  3FXT A;  2FS5 A;  2DXQ A;  3K9U A;  2Z3M A;  1NE9 A;  2DPS A;  2Z3O A;  4QC6 A;  1YLE A;  2PQ8 A;  4A2Z A;  3SXO A;  3FRM A;  1XMT A;  2PC1 A;  3BLN A;  3V8I A;  4OLL A;  5GCN A;  2PR8 A;  2OU2 A;  1RXT A;  1IID A;  4MY0 A;  1Q2C A;  3TCV A;  2EVN A;  5IX3 A;  2HUZ A;  4KOS A;  1XE4 A;  2BL1 A;  3IU1 A;  4CGM A;  4F0Y A;  3H4Q A;  4H6Z A;  3TE4 A;  2YND A;  5G21 A;  2B4D B;  2Q7B A;  4A32 A;  3NE7 A;  5CNP A;  1MJ9 A;  5JPH A;  3JUW A;  1Y9K A;  2P6F A;  4PK2 A;  2G0B A;  4LUA A;  4UCP A;  3H5Z A;  3ZZI A;  3I9S A;  4UFW A;  4KUA A;  4PK3 A;  4CAE A;  2VZY A;  3S6H A;  2FT0 A;  1MJA A;  1QSO A;  4R57 A;  1P4N A;  3C26 A;  4NXY A;  4MFK A;  2ARH A;  2Q0Y A;  4B5O A;  3VWD A;  4KOU A;  4UFV A;  2HV2 A;  4C2Z A;  5I0C A;  4XPL A;  3S6G A;  4U9Z A;  5KTD A;  3DSB A;  4Y49 B;  1YRE A;  2VZZ A;  4BBH A;  5F46 A;  3UY5 A;  4CAW A;  4F6A A;  5JQ4 A;  1B6B A;  2G3T A;  3OWC A;  4AG9 A;  4C68 A;  1IIC A;  2YNC A;  1YR0 A;  2Y0M A;  4H89 A;  5E96 A;  2A4N A;  4I49 A;  5H86 A;  4M85 A;  1MK4 A;  4E8O A;  1Q2D A;  4HKF A;  1QSM A;  2BEI A;  4ORF A;  3E0K A;  2DPT A;  4EVY A;  2WSA A;  4CYP A;  1R57 A;  4KVO E;  3S6K A;  4FD5 A;  1KUY A;  1KZF A;  1Z9U A;  2FIW A;  3D3S A;  3I3G A;  4CAV A;  3G8W A;  4YFJ A;  4CGP A;  1QSR A;  3FIX A;  5J8C A;  4CRY B;  4CGO A;  1YK3 A;  2REE A;  3W6X A;  2VBQ A;  4A33 A;  1FY7 A;  5ISV A;  2PRB A;  5A28 A;  1VKC A;  3R96 A;  3B8G A;  3LOD A;  3BJ8 A;  5KTA A;  2B5G B;  3S6F A;  1M44 A;  4B14 A;  2EUI A;  4C7H A;  2FXF A;  3F5B A;  1I12 A;  2CNT A;  2Q44 A;  2B3U A;  2OZG A;  5F48 A;  2K5T A;  2P0W A;  4CGL A;  2R98 A;  5AG7 A;  4X5K A;  4HNY B;  4UWI A;  1I1D A;  4CYO A;  3TT2 A;  5IB0 A;  1IB1 E;  4YRH A;  5AGE A;  4MI4 A;  2VXK A;  3LD2 A;  4XPD B;  3GYA A;  4J3G A;  2Z3L A;  2J8N A;  2WUU A;  2GIV A;  3R9E A;  1IYK A;  4QBJ A;  3IWE A;  4CS0 B;  5FVJ A;  4C2Y A;  5F49 A;  3CXQ A;  5H84 A;  2Z11 A;  3F8K A;  2JEV A;  1Z4E A;  5DWM A;  4B5P A;  1N71 A;  4XPK A;  3R95 A;  4KVX A;  3EO4 A;  1RO5 A;  2D4O A;  4KSF A;  3TO7 A;  3FB3 A;  2BUE A;  4KOV A;  4UCM A;  4B11 A;  1XEB A;  4JLY A;  4YGO A;  4R3K A;  2B58 A;  5EBV A;  4JWP A;  4GS4 A;  4AVC A;  2P6G A;  1YVK A;  4K30 A;  4KOW A;  2I79 A;  4NF1 A;  3D2M A;  1M1D A;  1UFH A;  4U5Y A;  1GHE A;  4H6U A;  1L0C A;  1VHS A;  4CAX A;  3WR7 A;  5C88 A;  3JVN A;  2P6E A;  3R9F A;  1ZO0 A;  2FE7 A;  3TTH A;  4CYN A;  3P2F A;  1TIQ A;  3PGP A;  4M3S A;  1OZP A;  4LX9 A;  1MJB A;  4Q38 A;  4II9 A;  5EC4 A;  4PSW A;  4DNC A;  1Y9W A;  2FL4 A;  3PZJ A;  4JD6 A;  1CJW A;  4QVT A;  4C2X A;  2C27 A;  4XNH C;  2G3A A;  1S60 A;  4KVM E;  1BO4 A;  1XIX A;  4L89 A;  4ZGY B;  3CXP A;  2B4B A;  2GE3 A;  2R1I A;  2ZXV A;  2REF A;  4A95 A;  3FBU A;  2B3V A;  5HMN A;  4Q36 A;  4JXQ A;  2CXA A;  2AJ6 A;  5G1Z A;  3W6S A;  3T90 A;  4FD6 A;  3QAH A;  2H5M A;  1S7F A;  4R87 A;  5AG5 A;  3IGR A;  3KKW A;  2IL4 A;  4RS2 A;  1WK4 A;  2ZW4 A;  4QB9 A;  1U6M A;  2BSW A;  3F0A A;  4B13 A;  4XPD C;  4QUS A;  5BWA B;  1S7K A;  4L8A A;  4HNX B;  4NCZ A;  1P0H A;  2Z3N A;  2Z10 A;  4R9M A;  4B12 A;  4UA3 A;  2R8V A;  5F47 A;  4AVB A;  3FYN A;  4A30 A;  2QML A;  2ZPA A;  3EFA A;  2Z3P A;  3R1K A;  4KUB A;  3N7Z A;  2FIA A;  2RC4 A;  1PU9 A;  2CNM A;  2AE6 A;  4KOY A;  2F5I A;  3QB8 A;  4KOX A;  2J8M A;  2PDO A;  4KOR A;  4MHD A;  1M4D A;  2X7B A;  2HQY A;  1I21 A;  4PSX A;  2Z3K A;  1NSL A;  1SQH A;  2ZW7 A;  1KUX A;  2GAN A;  4FD7 A;  2QIR A;  3GY9 A;  5HH1 A;  4PV6 A;  1XF8 A;  4U9Y A;  4AVA A;  4CRZ B;  4MFQ A;  4HNW B;  3IWG A;  4KOT A;  4CGN A;  4BMH A;  3EY5 A;  2FCK A;  2PSW A;  3VWE A;  2OZU A;  4Y49 C;  4B5P B;  4MFZ A;  2B4D A;  4UFX A;  4E0A A;  3TO9 A;  3W91 A;  5AG4 A;  4E2A A;  1J4J A;  1NMT A;  3G3S A;  4AG7 A;  2J8R A;  2NMT A;  3BJ7 A;  1WWZ A;  3DDD A;  5C82 A;  4A31 A;  1ON0 A;  3EXN A;  2WPW A;  3DR8 A;  4ZBG A;  4NEX A;  4F0X A;  1IYL A;  4MFJ A;  3TFY A;  3SXN A;  3ZJ0 A;  2WPX A;  5A27 A;  3D8P A;  3T9Y A;  5IV0 A;  3JTK A;  2YNC C;  1V0C A;  2OB0 A;  4UBR A;  1M4I A;  5G20 A;  4NSQ A;  2OH1 A;  5J8F A;  4JJX A;  3DR6 A;  1Y7R A;  3R9G A;  3TOB A;  2FSR A;  1S3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...