4NF1A

Structure of n-acetyltransferase domain of x. fastidiosa nags/k without his-tag
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
146
structure length
146
Chain Sequence
VIRATTWKDLDLPRLQHLIQSSFRRTLIPHYFETTPLLRAYVSENYRAAVILTKLGNVPYLDKFAVLDDAQGEGLGRAVWSIMREETPQLFWRSRHNNQANAFYYAESDGYYKQDHWKIFWNGLHHFQQIQQCVAHCTQHPPTLID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Acetylglutamate kinase
publication title Structures of the N-acetyltransferase domain of Xylella fastidiosaN-acetyl-L-glutamate synthase/kinase with and without a His tag bound to N-acetyl-L-glutamate.
pubmed doi rcsb
source organism Xylella fastidiosa temecula1
molecule tags Transferase
total genus 48
structure length 146
sequence length 146
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.2.8: Acetylglutamate kinase.
pdb deposition date 2013-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4nf1A00
1YX0A 2ZW4A 2C27A 4LX9A 3EO4A 3SXOA 4L8AA 3K9UA 4KORA 5E96A 1QSOA 4KOTA 2Q7BA 3PP9A 3FNCA 3F8KA 4B5PB 3TO9A 2Q44A 1XIXA 2R7HA 4NXYA 1I21A 3GKRA 4XNHC 1K4JA 2I79A 1P0HA 1R57A 2GIVA 4I49A 2Q0YA 2J8RA 4NCZA 1YVOA 2D4PA 4KVME 3FB3A 4H6ZA 3PGPA 1ON0A 2FL4A 5EBVA 2Q04A 5DWMA 2B4BA 4UWIA 1M4IA 1V0CA 1XF8A 2QECA 3N7ZA 2H5MA 2VQYA 5J8FA 3B8GA 4QUSA 5IX3A 5F46A 4KUBA 4MY3A 3FXTA 4AB7A 3W6SA 4B5OA 1P4NA 4NF1A 4AG7A 4B5PA 3EFAA 4KOYA 1SQHA 4KVXA 4KLWA 3RYOA 3V8IA 2BL1A 4E0AA 5F48A 4JD6A 1MK4A 2K5TA 2ZW6A 2P6FA 3LD2A 4X5KA 1S7FA 4XPDC 5JPHA 2PDOA 1XE4A 5F47A 3S6FA 1M4DA 3F5BA 3R1KA 4JWPA 4QBJA 3T9YA 2GANA 3IWGA 4EVYA 4R9MA 1XMTA 3G8WA 3VWDA 1KUVA 4KZTA 3SXNA 2HUZA 2VI7A 4U5YA 1BOBA 3DDDA 4M3SA 4JLYA 3H4QA 3CXQA 3BJ7A 4IF5A 1S7LA 5H86A 4CAXA 4E8OA 1VKCA 4FD4A 1CM0A 4JJXA 1UFHA 4R57A 3GYAA 5JQ4A 2NMTA 3W6XA 3VWEA 3ZZIA 4K30A 1IYLA 4UA3A 2R1IA 3S6GA 2OZHA 2Z11A 3S6KA 3FRMA 2WPWA 2A4NA 2X7BA 4FD7A 2Y0MA 2ZW7A 4CS0B 2P6GA 2B4DB 2REFA 1KZFA 4R87A 4KOVA 4F6AA 3R95A 1M44A 5KTDA 1QSRA 1VHSA 4KOSA 3NE7A 4KOXA 1QSMA 2VEZA 2CY2A 4M85A 4ORFA 4CRZB 4DNCA 4J3GA 4PV6A 2PSWA 1Y9WA 1S7KA 1YGHA 1QSNA 3EY5A 1CJWA 2HV2A 5EC4A 4U9YA 3FYNA 2QIRA 2KCWA 2FIAA 4MHDA 4PK3A 1S60A 1M1DA 3TTHA 2JEVA 3ZJ0A 3W91A 4MI4A 2PRBA 5IV0A 3G3SA 3TO7A 2B4DA 4HNWB 2JDCA 1MJBA 1N71A 5HMNA 1S5KA 1S3ZA 4H89A 5C88A 1FY7A 4XPKA 5J8CA 4AVCA 4OADA 3D2MA 2ZXVA 4QVTA 4AVAA 1Q2YA 4KOWA 2PQ8A 4Y49B 2ARHA 3FIXA 4QC6A 2VBQA 2G0BA 3DR8A 4YGOA 3TOAA 1MJAA 3TOBA 2ZPAA 3UY5A 4LUAA 2R98A 1MJ9A 2HQYA 3BJ8A 1IICA 2BSWA 1B6BA 4PSXA 2ATRA 3OWCA 2Q4VA 2JLMA 4PK2A 5DWNA 1Q2CA 1PU9A 1WK4A 4JXQA 4MY0A 2F5IA 3CXSA 4XNHB 3T90A 2FS5A 2AE6A 2PC1A 2PR8A 3JUWA 5ISVA 1RXTA 2D4OA 2B3UA 2AJ6A 3I3GA 1YK3A 3R9EA 3R9FA 3GY9A 4MBUA 1YLEA 5GCNA 5KTCA 2FE7A 1RO5A 3DSBA 1IB1E 3I9SA 2FSRA 1TIQA 4BMHA 4ONUA 1NSLA 2BEIA 4R3KA 4RI1A 1Z9UA 1Y9KA 1I1DA 2BUEA 4U9ZA 3TE4A 3TT2A 2JDDA 4CRYB 5I0CA 4R3LA 3TFYA 2VZYA 3LODA 2FIWA 1PUAA 4CAVA 2IL4A 4KUAA 2OB0A 2B5GB 2P6EA 2DXQA 1B87A 1M4GA 2VXKA 2Z10A 1I12A 3D3SA 3FBUA 1Y7RA 2O28A 4XPDB 4GS4A 3PZJA 3TO6A 4YFJA 4FD6A 2EUIA 2B58A 3S6HA 3R9GA 4CAWA 1U6MA 5FVJA 1Z4EA 4KOUA 3E0KA 3TCVA 2G3AA 1NE9A 2I00A 3F0AA 3DR6A 1KUYA 1Z4RA 2WPXA 4HKFA 4II9A 1BO4A 3P2FA 3IGRA 4H6UA 2CNMA 4L89A 5KTAA 1LRZA 3SHPA 1IYKA 4PSWA 2B5GA 5IB0A 5F49A 4XPLA 4NEXA 3C26A 3DNSA 2EVNA 2Z0ZA 4AVBA 2Q4YA 3QAHA 3QB8A 3CXPA 2GE3A 3EXNA 4JXRA 4FD5A 1OZPA 2ZW5A 1L0CA 3D8PA 4UWJA 2R8VA 4HNYB 2OU2A 2CNTA 3WR7A 1S7NA 1WWZA 1NMTA 4UBRA 3D2PA 5CNPA 4KVOE 3EC4A 2VZZA 1XEBA 4YRHA 4RS2A 2G3TA 2J8NA 1YR0A 2PR1A 4ZBGA 5H84A 4AG9A 1Q2DA 2FXFA 1IIDA 5C82A 2P0WA 4MJ8A 4NSQA 2RC4A 2OZGA 4OLLA 4OAEA 3R96A 1J4JA 4E2AA 4F0YA 2OH1A 2J8MA 5HH1A 2OZUA 4HNXB 2FT0A 1KUXA 4IUSA 2FCKA 3MGDA 3KKWA 3JVNA 4QB9A 3BLNA 1QSTA 1YVKA 2QMLA 2B3VA 2CNSA 4KLVA 4Y49C 2REEA 3P2HA 1YREA 1GHEA
chains in the Genus database with same CATH superfamily
1YX0A 2ZW4A 3B3VA 4MXUA 1JQGA 2C27A 4LX9A 3EO4A 4Q36A 4L8AA 3SXOA 2PIYA 4R6TA 2PJAA 3K9UA 4KS9A 5K8MA 4KORA 3RZAA 4H2KA 5E96A 1QSOA 4KOTA 2Q7BA 4C2XA 3PP9A 2ZOFA 3FNCA 1F2OA 4B6ZA 3F8KA 3S9LA 4B5PB 4FAIA 2AFSA 4GXHA 3TO9A 2XEFA 2Q44A 1XIXA 2R7HA 4NXYA 1HEEA 1I21A 3GIUA 4BD9A 3GKRA 4YU9A 4XNHC 1ELLP 2Q4ZA 1K4JA 2PVVA 2ZELA 1ARLA 2I79A 2O4HA 1P0HA 1GYTA 4OMEA 5K8PA 1DTDA 1R57A 4P10A 4A2ZA 2GIVA 4I49A 4B11A 2Q0YA 2V8DA 2J8RA 4NCZA 4UEEA 3V7ZA 4DYOA 2XEJA 1YVOA 2D4PA 3CDXA 4KVME 3FB3A 4H6ZA 4CGPA 3PGPA 1ON0A 4NGPA 2FL4A 5A27A 5EBVA 1Z2LA 4WJBA 5D8NA 2Q04A 2EBJA 4C68A 4MCQA 5DWMA 3S9MA 2B4BA 2ZENA 1M4IA 2V8VA 1V0CA 3H8GA 4UWIA 1XF8A 2QECA 3N7ZA 5LRJA 5AGEA 2H5MA 4CAFA 2VQYA 3KHZA 4JYWA 4YWYA 3FH4A 5J8FA 4MCPA 3GUXA 3B8GA 4QUSA 5IX3A 5F46A 4KUBA 1BPNA 4MY3A 4A38A 4C7IA 4O23A 3FXTA 1EE3P 2CTBA 4P44A 4LQGA 3SJGA 2DEAA 4EMEA 3D7GA 2PJ0A 4AB7A 3W6SA 1VHEA 4B5OA 1P4NA 4NF1A 3D7HA 3KQZA 4AG7A 4B5PA 1VIXA 4PXBA 3EFAA 1XMBA 4KOYA 1KWMA 1Y0RA 4NGNA 1SQHA 4CGNA 3KR5A 2DPSA 5ELYA 2Q7SA 1FT7A 4KVXA 2QJ8A 4KLWA 2V8HA 3RYOA 1DE4C 3V8IA 1Z8WA 2Z3LA 3B3WA 2BL1A 3PBBA 2ZEPA 3IU2A 3I1UA 2PJ9A 3A9LA 4E0AA 2Z3KA 5F48A 4JD6A 1Z8LA 2AFZA 1MK4A 2K5TA 2Z3OA 2P6FA 2ZW6A 3LD2A 4X5KA 3KI9A 1S7FA 1CP7A 3WC5A 2GLFA 4XPDC 2GFQA 5JPHA 2PDOA 4A39A 3IU1A 1XE4A 5F47A 3S6FA 1M4DA 2DF5A 2PJ8A 2Z3NA 5A28A 1FNOA 4P4EA 3F5BA 3R1KA 1BLLE 4JWPA 4PXCA 4C2ZA 4QBJA 3NH4A 2I3CA 3T9YA 2GANA 2POKA 3IWGA 4R9MA 4EVYA 1XMTA 3PEIA 3G8WA 2FVGA 3VWDA 1KUVA 4KZTA 4ZX9A 3IFEA 1X12A 2HUZA 3SXNA 2VI7A 4U5YA 1BOBA 4UEFA 2CIJA 3DDDA 2GREA 1CP6A 3DGVA 4M3SA 4JLYA 3H4QA 3CXQA 3BJ7A 4IF5A 3BI0A 1HDUA 1S7LA 5H86A 4CAXA 4E8OA 1VKCA 1Z8TA 1CM0A 4FD4A 4JJXA 1UFHA 2ZEGA 4R57A 2NSMA 3GYAA 2WYRA 3N5FA 4UEZA 4EWTA 5JQ4A 4RUHA 2NMTA 1UWYA 4ZY1A 3W6XA 2IMOA 3VWEA 3ZZIA 4K30A 1IYLA 4UA3A 1ZG8A 2R1IA 4FUUA 4OIDA 4MFQA 4F9UA 4KSFA 3S6GA 3BXMA 4PXDA 2OZHA 2ZEOA 2Z11A 4UCMA 4A30A 4BBHA 3CT9A 5HVHA 4NJRA 3S6KA 3FRMA 2WPWA 2A4NA 2QVPA 2X7BA 4FD7A 2Y0MA 4NFRA 5JGFA 3D67A 2PJCA 2ZW7A 3ISZA 3LWUA 4CS0B 2Q51A 2P6GA 4DUKA 1AUGA 4MCSA 2B4DB 3FVLA 2REFA 4MFKA 4F8ZA 1KZFA 4R87A 5LRKA 4KOVA 2PE3A 3HLPA 8CPAA 3L2NA 2YNCC 2ZEMA 3FEEA 4F6AA 3NE8A 3D7FA 1M44A 3R95A 5KTDA 1YLOA 1QSRA 1VHSA 4KOSA 3NE7A 4KOXA 1QSMA 2VEZA 4TNUA 4II9A 2YNDA 3RO0A 1TF8A 2CY2A 3IJ3A 4M85A 3DLJA 2PJ4A 4ORFA 4CRZB 4DNCA 4J3GA 4PV6A 2PSWA 3NH5A 4OC0A 1YSJA 1R43A 1Y9WA 5CBMA 4P4BA 1S7KA 1YGHA 3D68A 2YNEA 3B7IA 2BO9A 1Y7EA 5D29A 7CPAA 5JM6A 4ZI6A 1QSNA 3EY5A 1CJWA 2HV2A 3IEHA 5EC4A 4U9YA 3NFZA 4B13A 3FYNA 3QAYA 3TC8A 3VH9A 4X3RA 2GLJA 2QIRA 4OIWA 4P4IA 1JWQA 2NYQA 2BOAA 3FX6A 2KCWA 3KASA 2FIAA 4UCPA 4MHDA 3B3CA 4PK3A 5K8OA 2AFWA 1S60A 1M1DA 5LYDA 3TTHA 2JEVA 2EO8A 4MHNA 5I4MA 5IB9A 2JBJA 4MHZA 3ZJ0A 4MRIA 4MFLA 3W91A 4MI4A 4X8IA 2PRBA 2IQ6A 3K9TA 1LFWA 5IV0A 3G3SA 3TO7A 2B4DA 4HNWB 3KR4A 2JDCA 1MJBA 1N71A 5HMNA 1X10A 4M6GA 4A33A 5LYLA 3SJEA 1S5KA 1XFOA 3MRUA 1S3ZA 4NGSA 1QQ9A 4H89A 1VGYA 4WWVA 2AFMA 5C88A 1FY7A 4XPKA 5J8CA 1IOIA 4AVCA 4OADA 3D2MA 2ZXVA 4F0XA 3CPXA 2PCUA 2O53A 3CPAA 2C1CA 4QVTA 4AVAA 5LYFA 1ZLHA 3H8FA 1Q2YA 4KOWA 4A95A 2PQ8A 4X2TA 2J9AA 3PB9X 3WABA 5K8NA 4GM5A 4Y49B 2ARHA 3FIXA 3PFEA 2YGWA 4QC6A 2VBQA 2G0BA 3DR8A 3LACA 4YGOA 4CYQA 3TOAA 1MJAA 5HVGA 3TOBA 2ZPAA 3LMSA 3UY5A 3SI0A 4LUAA 5CPAA 2R98A 4C7HA 2V77A 3IWEA 1MJ9A 1ZLIA 5AG7A 5LRGA 3T8WA 1F2PA 2DPTA 2HQYA 2PRQA 3BJ8A 3NH8A 1IICA 2BSWA 2V8GA 1B6BA 1LOKA 2JBKA 4PSXA 3FMCA 2ZEHA 4PQAA 4PXEA 2ATRA 3OWCA 4PPZA 2Q4VA 2JLMA 4OC5A 4PK2A 2IJZA 1Q2CA 1PU9A 1WK4A 2C6GA 4JXQA 2F5IA 4MY0A 5DWNA 3RAMA 1ZG9A 3CXSA 6CPAA 4XNHB 3T90A 5DS0A 4CGLA 2FS5A 2AE6A 1YW4A 4R76A 2PC1A 5JH9A 2PR8A 4OKOA 5EMIA 3JUWA 1YW6A 4NGQA 4BINA 5ISVA 3JTKA 1RXTA 2D4OA 3IWWA 2B3UA 4P4DA 2AJ6A 3I3GA 1YK3A 3GB0A 3R9EA 3R9FA 3GY9A 4MBUA 2AFXA 4ONWA 2OOTA 3IO1A 4K3NA 2EWBA 3SJFA 4HPSA 4IK2A 1H8LA 1YLEA 5GCNA 4CGMA 5KTCA 3WT4A 1AMPA 3MN8A 2FE7A 1RO5A 3DSBA 1IB1E 3PBEA 2QYVA 3I9SA 2Z3MA 2FSRA 1TIQA 3PB7X 1ZO0A 4BMHA 4W9YA 4ONUA 1NSLA 2BEIA 3D7DA 2Q43A 4R3KA 4RI1A 1RTQA 1Y9KA 1Z9UA 3PB4X 5HXDA 1I1DA 2BUEA 4U9ZA 3TE4A 4CAEA 2PVWA 3TT2A 2OR4A 3TX8A 4MMOA 4KSIA 5G21A 2JDDA 4FWUA 1YQEA 4JZ0A 4NGMA 4CRYB 5I0CA 4R3LA 4IHMA 1PCAA 1HDQA 3TFYA 1IY7A 2VZYA 1YMEA 2FIWA 2WSAA 1PUAA 3LODA 4MHPA 3WC7A 2IL4A 4B10A 4CAVA 1VHOA 4KUAA 1TXRA 4OP4A 2OB0A 1OBRA 2B5GB 2P6EA 4R7MA 4FBEA 2DXQA 3IIBA 1B87A 1LCPA 3SI2A 2XEGA 1BAVA 1IU8A 2CF4A 4ZY2A 2C6CA 1M4GA 2VXKA 1TKFA 4IAVA 4MFJA 5AG4A 2Z10A 1I12A 3D3SA 3FBUA 4MFZA 4CYOA 3SJXA 1Y7RA 1IOFA 3V38A 2O28A 2PJ3A 4XPDB 3FECA 4MHYA 3PFOA 4MFPA 4GS4A 3PZJA 4NJQA 1XBUA 3B3TA 3TO6A 4YFJA 4FD6A 2EUIA 3KL9A 2B58A 3S6HA 3R9GA 4CAWA 3IC1A 2ZEEA 3FEDA 2PJ5A 1U6MA 3H8EA 4UFWA 4C2YA 1LANA 5FVJA 2GU2A 1Z4EA 2ZEFA 4KOUA 1CPSA 5G1ZA 3E0KA 3TCVA 4G1PA 2G3AA 2WZNA 3SI1A 2AFUA 4LQ6A 4ZX8A 1NE9A 2I00A 3F0AA 2C6PA 3JRUA 3DR6A 4ZY0A 1KUYA 2RB7A 1Z4RA 2WPXA 4HKFA 4UF4A 1BO4A 4ZGYB 3P2FA 3IGRA 5G20A 4H6UA 2CNMA 4L89A 3VARA 5KTAA 3KHXA 1LRZA 3SHPA 2PJBA 1IYKA 3B2YA 4PSWA 2B5GA 2Z3PA 3RBUA 4AXVA 4B12A 2PJ2A 5IB0A 5F49A 4XPLA 1Q7LA 1IGBA 4NEXA 4RN7A 4OC3A 1Y0YA 3C26A 3DNSA 4R8FA 2EVNA 2BCOA 1ARMA 3NA6A 4NGTA 1XJOA 2Z0ZA 3KGQA 1A2ZA 4MCRA 4AVBA 2Q4YA 4M6HA 3QAHA 3QB8A 2ZOGA 3ISXA 3CXPA 4UFXA 3D4UA 4TWEA 4A31A 1ZG7A 4NGRA 3GLJA 3B35A 2GE3A 3EXNA 2PJ7A 5AG6A 4JXRA 4FD5A 4OC4A 1OZPA 1Z5RA 2ZW5A 2G9DA 4OC1A 5F09A 1L0CA 3D8PA 3CZXA 2R8VA 4HNYB 4P45A 4UWJA 2OU2A 5THWA 3H5ZA 3VATA 1TKHA 5BWAB 4CGOA 4KSAA 5HVFA 2XEIA 1QMUA 3WC6A 4DJLA 2CNTA 3S9NA 3PRTA 3BI1A 4A32A 4F9VA 1CX8A 3D66A 3BHXA 4M6IA 3WR7A 1CPXA 2F7VA 1S7NA 1WWZA 4Z65A 1NMTA 2ZEDA 4UBRA 1LAPA 3D2PA 3PB6X 1CBXA 4UCNA 5CNPA 3K2KA 4KVOE 3EC4A 2HC9A 1XRYA 2PIZA 2ANPA 4ZYQA 5AG5A 3RNZA 2EK9A 2VZZA 1XEBA 3KQXA 4YRHA 1AYEA 4P4JA 4RS2A 3PB8X 2G3TA 3QNVA 4A37A 2J8NA 2HB6A 4P6YA 1YR0A 2PR1A 4ZBGA 5H84A 4AG9A 3KZWA 1BPMA 1Q2DA 2PJ1A 2FXFA 1IIDA 1M4LA 5C82A 2P0WA 4MJ8A 4NSQA 4Q38A 4UIBA 2RC4A 3HUVA 2OZGA 4OLLA 4OAEA 3R96A 4A94A 1J4JA 4E2AA 4F0YA 1XOVA 1TKJA 2RFHA 4CPAA 1F57A 2F8HA 2OH1A 2J8MA 5HH1A 5J1QA 2OZUA 4B14A 1PYTB 4HNXB 5LYIA 4CYNA 2AFOA 2FT0A 4Q7AA 4P4FA 1KUXA 1R3NA 2ABZA 4IUSA 2YNCA 2WUUA 1Z8XA 2CTCA 2FCKA 3FJUA 3B3SA 4OC2A 1CG2A 3MGDA 3KKWA 4UFVA 4UIAA 3JVNA 1NSAA 4QB9A 3BLNA 2JEWA 1QSTA 2ODFA 1TF9A 1YVKA 1ELMP 2QMLA 3FF3A 2B3VA 4EFDA 2CXAA 2CNSA 4KLVA 4Y49C 2REEA 2EK8A 3P2HA 4CYPA 1YREA 1GHEA 1LAMA 2VL1A 2PJ6A 5G22A
chains in the Genus database with same CATH topology
1YX0A 2ZW4A 2C27A 4LX9A 3EO4A 4Q36A 4L8AA 3SXOA 3K9UA 4KS9A 4KORA 5E96A 1QSOA 4KOTA 2Q7BA 4C2XA 3PP9A 3FNCA 3F8KA 4B5PB 3TO9A 2Q44A 1XIXA 2R7HA 4NXYA 1I21A 3GKRA 4XNHC 1K4JA 2I79A 1P0HA 4A2ZA 1R57A 2GIVA 4I49A 4B11A 2Q0YA 2J8RA 4NCZA 1YVOA 2D4PA 4KVME 3FB3A 4H6ZA 4CGPA 3PGPA 1ON0A 2FL4A 5A27A 5EBVA 2Q04A 4C68A 5DWMA 2B4BA 4UWIA 1M4IA 1V0CA 1XF8A 2QECA 3N7ZA 4CAFA 5AGEA 2H5MA 2VQYA 5J8FA 3B8GA 4QUSA 5IX3A 5F46A 4KUBA 4MY3A 4C7IA 3FXTA 4AB7A 3W6SA 4B5OA 1P4NA 4NF1A 4AG7A 4B5PA 3EFAA 4KOYA 4CGNA 1SQHA 2DPSA 4KVXA 4KLWA 3RYOA 3V8IA 2Z3LA 2BL1A 3IU2A 3A9LA 4E0AA 2Z3KA 5F48A 4JD6A 2ZW6A 1MK4A 2K5TA 2P6FA 2Z3OA 3LD2A 4X5KA 1S7FA 4XPDC 5JPHA 2PDOA 3IU1A 1XE4A 5F47A 3S6FA 1M4DA 2Z3NA 5A28A 3F5BA 3R1KA 4JWPA 4C2ZA 4QBJA 3T9YA 2GANA 3IWGA 4EVYA 4R9MA 1XMTA 3G8WA 3VWDA 1KUVA 4KZTA 3SXNA 2HUZA 2VI7A 4U5YA 1BOBA 3DDDA 4M3SA 4JLYA 3H4QA 3CXQA 3BJ7A 4IF5A 1S7LA 5H86A 4CAXA 4E8OA 1VKCA 4FD4A 1CM0A 4JJXA 1UFHA 4R57A 3GYAA 5JQ4A 2NMTA 3W6XA 3VWEA 3ZZIA 4K30A 1IYLA 4UA3A 2R1IA 4MFQA 4KSFA 3S6GA 2OZHA 2Z11A 4UCMA 4A30A 4BBHA 3S6KA 3FRMA 2WPWA 2A4NA 2X7BA 4FD7A 2Y0MA 2ZW7A 4CS0B 2P6GA 2B4DB 4MFKA 2REFA 1KZFA 4R87A 4KOVA 2YNCC 4F6AA 3R95A 1M44A 5KTDA 1QSRA 1VHSA 4KOSA 3NE7A 4KOXA 1QSMA 2VEZA 2YNDA 2CY2A 4M85A 4ORFA 4CRZB 4DNCA 4J3GA 4PV6A 2PSWA 1Y9WA 1S7KA 1YGHA 2YNEA 1QSNA 3EY5A 1CJWA 2HV2A 5EC4A 4U9YA 4B13A 3FYNA 2QIRA 2KCWA 4UCPA 2FIAA 4MHDA 4PK3A 1S60A 1M1DA 3TTHA 2JEVA 3ZJ0A 4MFLA 3W91A 4MI4A 2PRBA 5IV0A 3G3SA 3TO7A 2B4DA 4HNWB 2JDCA 1MJBA 1N71A 5HMNA 4A33A 1S5KA 1S3ZA 4H89A 5C88A 1FY7A 4XPKA 5J8CA 4AVCA 4OADA 3D2MA 2ZXVA 4F0XA 4QVTA 4AVAA 1Q2YA 4KOWA 4A95A 2PQ8A 4Y49B 2ARHA 3FIXA 2YGWA 4QC6A 2VBQA 2G0BA 3DR8A 4YGOA 4CYQA 3TOAA 1MJAA 3TOBA 2ZPAA 3UY5A 4LUAA 4C7HA 2R98A 3IWEA 1MJ9A 5AG7A 2HQYA 2DPTA 3BJ8A 1IICA 2BSWA 1B6BA 4PSXA 2ATRA 3OWCA 2Q4VA 2JLMA 4PK2A 5DWNA 1Q2CA 1PU9A 1WK4A 4JXQA 4MY0A 2F5IA 3CXSA 4XNHB 3T90A 4CGLA 2FS5A 2AE6A 2PC1A 2PR8A 3JUWA 5ISVA 3JTKA 1RXTA 2D4OA 2B3UA 2AJ6A 3I3GA 1YK3A 3R9EA 3R9FA 3GY9A 4MBUA 1YLEA 5GCNA 4CGMA 5KTCA 2FE7A 1RO5A 3DSBA 1IB1E 3I9SA 2Z3MA 2FSRA 1TIQA 1ZO0A 4BMHA 4ONUA 1NSLA 2BEIA 4R3KA 4RI1A 1Z9UA 1Y9KA 1I1DA 2BUEA 4U9ZA 3TE4A 4CAEA 3TT2A 5G21A 2JDDA 4CRYB 5I0CA 4R3LA 3TFYA 2VZYA 2WSAA 3LODA 2FIWA 4B10A 1PUAA 4CAVA 2IL4A 4KUAA 2OB0A 2B5GB 2P6EA 2DXQA 1B87A 4MFJA 1M4GA 2VXKA 5AG4A 2Z10A 1I12A 3D3SA 3FBUA 4MFZA 4CYOA 1Y7RA 2O28A 4XPDB 4MFPA 4GS4A 3PZJA 3TO6A 4YFJA 4FD6A 2EUIA 2B58A 3S6HA 3R9GA 4CAWA 1U6MA 4UFWA 4C2YA 5FVJA 1Z4EA 4KOUA 5G1ZA 3E0KA 3TCVA 2G3AA 1NE9A 2I00A 3F0AA 3DR6A 1KUYA 1Z4RA 2WPXA 4HKFA 4ZGYB 1BO4A 4II9A 3P2FA 3IGRA 5G20A 4H6UA 2CNMA 4L89A 5KTAA 1LRZA 3SHPA 1IYKA 4PSWA 2B5GA 2Z3PA 4B12A 5IB0A 5F49A 4XPLA 4NEXA 3C26A 3DNSA 2EVNA 2Z0ZA 4AVBA 2Q4YA 3QAHA 3QB8A 3CXPA 4UFXA 4A31A 2GE3A 3EXNA 5AG6A 4JXRA 4FD5A 1OZPA 2ZW5A 1L0CA 3D8PA 4UWJA 2R8VA 4HNYB 2OU2A 3H5ZA 5BWAB 4CGOA 4KSAA 2CNTA 4A32A 3WR7A 1S7NA 1WWZA 1NMTA 4UBRA 3D2PA 4UCNA 5CNPA 4KVOE 3EC4A 5AG5A 2VZZA 1XEBA 4YRHA 4RS2A 2G3TA 2J8NA 1YR0A 2PR1A 4ZBGA 5H84A 4AG9A 1Q2DA 2FXFA 1IIDA 5C82A 2P0WA 4MJ8A 4NSQA 4Q38A 2RC4A 2OZGA 4OLLA 4OAEA 3R96A 1J4JA 4E2AA 4F0YA 2OH1A 2J8MA 5HH1A 2OZUA 4B14A 4HNXB 4CYNA 2FT0A 1KUXA 4IUSA 2YNCA 2WUUA 2FCKA 3MGDA 3KKWA 4UFVA 3JVNA 4QB9A 3BLNA 1QSTA 1YVKA 2QMLA 2B3VA 2CXAA 2CNSA 4KLVA 4Y49C 2REEA 3P2HA 4CYPA 1YREA 1GHEA 5G22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YX0 A;  2ZW4 A;  2C27 A;  4LX9 A;  3EO4 A;  3SXO A;  4L8A A;  3K9U A;  4KOR A;  5E96 A;  1QSO A;  4KOT A;  2Q7B A;  3PP9 A;  3FNC A;  3F8K A;  4B5P B;  3TO9 A;  2Q44 A;  1XIX A;  2R7H A;  4NXY A;  1I21 A;  3GKR A;  4XNH C;  1K4J A;  2I79 A;  1P0H A;  1R57 A;  2GIV A;  4I49 A;  2Q0Y A;  2J8R A;  4NCZ A;  1YVO A;  2D4P A;  4KVM E;  3FB3 A;  4H6Z A;  3PGP A;  1ON0 A;  2FL4 A;  5EBV A;  2Q04 A;  5DWM A;  2B4B A;  4UWI A;  1M4I A;  1V0C A;  1XF8 A;  2QEC A;  3N7Z A;  2H5M A;  2VQY A;  5J8F A;  3B8G A;  4QUS A;  5IX3 A;  5F46 A;  4KUB A;  4MY3 A;  3FXT A;  4AB7 A;  3W6S A;  4B5O A;  1P4N A;  4NF1 A;  4AG7 A;  4B5P A;  3EFA A;  4KOY A;  1SQH A;  4KVX A;  4KLW A;  3RYO A;  3V8I A;  2BL1 A;  4E0A A;  5F48 A;  4JD6 A;  1MK4 A;  2K5T A;  2ZW6 A;  2P6F A;  3LD2 A;  4X5K A;  1S7F A;  4XPD C;  5JPH A;  2PDO A;  1XE4 A;  5F47 A;  3S6F A;  1M4D A;  3F5B A;  3R1K A;  4JWP A;  4QBJ A;  3T9Y A;  2GAN A;  3IWG A;  4EVY A;  4R9M A;  1XMT A;  3G8W A;  3VWD A;  1KUV A;  4KZT A;  3SXN A;  2HUZ A;  2VI7 A;  4U5Y A;  1BOB A;  3DDD A;  4M3S A;  4JLY A;  3H4Q A;  3CXQ A;  3BJ7 A;  4IF5 A;  1S7L A;  5H86 A;  4CAX A;  4E8O A;  1VKC A;  4FD4 A;  1CM0 A;  4JJX A;  1UFH A;  4R57 A;  3GYA A;  5JQ4 A;  2NMT A;  3W6X A;  3VWE A;  3ZZI A;  4K30 A;  1IYL A;  4UA3 A;  2R1I A;  3S6G A;  2OZH A;  2Z11 A;  3S6K A;  3FRM A;  2WPW A;  2A4N A;  2X7B A;  4FD7 A;  2Y0M A;  2ZW7 A;  4CS0 B;  2P6G A;  2B4D B;  2REF A;  1KZF A;  4R87 A;  4KOV A;  4F6A A;  3R95 A;  1M44 A;  5KTD A;  1QSR A;  1VHS A;  4KOS A;  3NE7 A;  4KOX A;  1QSM A;  2VEZ A;  2CY2 A;  4M85 A;  4ORF A;  4CRZ B;  4DNC A;  4J3G A;  4PV6 A;  2PSW A;  1Y9W A;  1S7K A;  1YGH A;  1QSN A;  3EY5 A;  1CJW A;  2HV2 A;  5EC4 A;  4U9Y A;  3FYN A;  2QIR A;  2KCW A;  2FIA A;  4MHD A;  4PK3 A;  1S60 A;  1M1D A;  3TTH A;  2JEV A;  3ZJ0 A;  3W91 A;  4MI4 A;  2PRB A;  5IV0 A;  3G3S A;  3TO7 A;  2B4D A;  4HNW B;  2JDC A;  1MJB A;  1N71 A;  5HMN A;  1S5K A;  1S3Z A;  4H89 A;  5C88 A;  1FY7 A;  4XPK A;  5J8C A;  4AVC A;  4OAD A;  3D2M A;  2ZXV A;  4QVT A;  4AVA A;  1Q2Y A;  4KOW A;  2PQ8 A;  4Y49 B;  2ARH A;  3FIX A;  4QC6 A;  2VBQ A;  2G0B A;  3DR8 A;  4YGO A;  3TOA A;  1MJA A;  3TOB A;  2ZPA A;  3UY5 A;  4LUA A;  2R98 A;  1MJ9 A;  2HQY A;  3BJ8 A;  1IIC A;  2BSW A;  1B6B A;  4PSX A;  2ATR A;  3OWC A;  2Q4V A;  2JLM A;  4PK2 A;  5DWN A;  1Q2C A;  1PU9 A;  1WK4 A;  4JXQ A;  4MY0 A;  2F5I A;  3CXS A;  4XNH B;  3T90 A;  2FS5 A;  2AE6 A;  2PC1 A;  2PR8 A;  3JUW A;  5ISV A;  1RXT A;  2D4O A;  2B3U A;  2AJ6 A;  3I3G A;  1YK3 A;  3R9E A;  3R9F A;  3GY9 A;  4MBU A;  1YLE A;  5GCN A;  5KTC A;  2FE7 A;  1RO5 A;  3DSB A;  1IB1 E;  3I9S A;  2FSR A;  1TIQ A;  4BMH A;  4ONU A;  1NSL A;  2BEI A;  4R3K A;  4RI1 A;  1Z9U A;  1Y9K A;  1I1D A;  2BUE A;  4U9Z A;  3TE4 A;  3TT2 A;  2JDD A;  4CRY B;  5I0C A;  4R3L A;  3TFY A;  2VZY A;  3LOD A;  2FIW A;  1PUA A;  4CAV A;  2IL4 A;  4KUA A;  2OB0 A;  2B5G B;  2P6E A;  2DXQ A;  1B87 A;  1M4G A;  2VXK A;  2Z10 A;  1I12 A;  3D3S A;  3FBU A;  1Y7R A;  2O28 A;  4XPD B;  4GS4 A;  3PZJ A;  3TO6 A;  4YFJ A;  4FD6 A;  2EUI A;  2B58 A;  3S6H A;  3R9G A;  4CAW A;  1U6M A;  5FVJ A;  1Z4E A;  4KOU A;  3E0K A;  3TCV A;  2G3A A;  1NE9 A;  2I00 A;  3F0A A;  3DR6 A;  1KUY A;  1Z4R A;  2WPX A;  4HKF A;  4II9 A;  1BO4 A;  3P2F A;  3IGR A;  4H6U A;  2CNM A;  4L89 A;  5KTA A;  1LRZ A;  3SHP A;  1IYK A;  4PSW A;  2B5G A;  5IB0 A;  5F49 A;  4XPL A;  4NEX A;  3C26 A;  3DNS A;  2EVN A;  2Z0Z A;  4AVB A;  2Q4Y A;  3QAH A;  3QB8 A;  3CXP A;  2GE3 A;  3EXN A;  4JXR A;  4FD5 A;  1OZP A;  2ZW5 A;  1L0C A;  3D8P A;  4UWJ A;  2R8V A;  4HNY B;  2OU2 A;  2CNT A;  3WR7 A;  1S7N A;  1WWZ A;  1NMT A;  4UBR A;  3D2P A;  5CNP A;  4KVO E;  3EC4 A;  2VZZ A;  1XEB A;  4YRH A;  4RS2 A;  2G3T A;  2J8N A;  1YR0 A;  2PR1 A;  4ZBG A;  5H84 A;  4AG9 A;  1Q2D A;  2FXF A;  1IID A;  5C82 A;  2P0W A;  4MJ8 A;  4NSQ A;  2RC4 A;  2OZG A;  4OLL A;  4OAE A;  3R96 A;  1J4J A;  4E2A A;  4F0Y A;  2OH1 A;  2J8M A;  5HH1 A;  2OZU A;  4HNX B;  2FT0 A;  1KUX A;  4IUS A;  2FCK A;  3MGD A;  3KKW A;  3JVN A;  4QB9 A;  3BLN A;  1QST A;  1YVK A;  2QML A;  2B3V A;  2CNS A;  4KLV A;  4Y49 C;  2REE A;  3P2H A;  1YRE A;  1GHE A; 
#chains in the Genus database with same CATH topology
 1YX0 A;  2ZW4 A;  3B3V A;  4MXU A;  1JQG A;  2C27 A;  4LX9 A;  3EO4 A;  4Q36 A;  4L8A A;  3SXO A;  2PIY A;  4R6T A;  2PJA A;  3K9U A;  4KS9 A;  5K8M A;  4KOR A;  3RZA A;  4H2K A;  5E96 A;  1QSO A;  4KOT A;  2Q7B A;  4C2X A;  3PP9 A;  2ZOF A;  3FNC A;  1F2O A;  4B6Z A;  3F8K A;  3S9L A;  4B5P B;  4FAI A;  2AFS A;  4GXH A;  3TO9 A;  2XEF A;  2Q44 A;  1XIX A;  2R7H A;  4NXY A;  1HEE A;  1I21 A;  3GIU A;  4BD9 A;  3GKR A;  4YU9 A;  4XNH C;  1ELL P;  2Q4Z A;  1K4J A;  2PVV A;  2ZEL A;  1ARL A;  2I79 A;  2O4H A;  1P0H A;  1GYT A;  4OME A;  5K8P A;  1DTD A;  1R57 A;  4P10 A;  4A2Z A;  2GIV A;  4I49 A;  4B11 A;  2Q0Y A;  2V8D A;  2J8R A;  4NCZ A;  4UEE A;  3V7Z A;  4DYO A;  2XEJ A;  1YVO A;  2D4P A;  3CDX A;  4KVM E;  3FB3 A;  4H6Z A;  4CGP A;  3PGP A;  1ON0 A;  4NGP A;  2FL4 A;  5A27 A;  5EBV A;  1Z2L A;  4WJB A;  5D8N A;  2Q04 A;  2EBJ A;  4C68 A;  4MCQ A;  5DWM A;  3S9M A;  2B4B A;  2ZEN A;  1M4I A;  2V8V A;  1V0C A;  3H8G A;  4UWI A;  1XF8 A;  2QEC A;  3N7Z A;  5LRJ A;  5AGE A;  2H5M A;  4CAF A;  2VQY A;  3KHZ A;  4JYW A;  4YWY A;  3FH4 A;  5J8F A;  4MCP A;  3GUX A;  3B8G A;  4QUS A;  5IX3 A;  5F46 A;  4KUB A;  1BPN A;  4MY3 A;  4A38 A;  4C7I A;  4O23 A;  3FXT A;  1EE3 P;  2CTB A;  4P44 A;  4LQG A;  3SJG A;  2DEA A;  4EME A;  3D7G A;  2PJ0 A;  4AB7 A;  3W6S A;  1VHE A;  4B5O A;  1P4N A;  4NF1 A;  3D7H A;  3KQZ A;  4AG7 A;  4B5P A;  1VIX A;  4PXB A;  3EFA A;  1XMB A;  4KOY A;  1KWM A;  1Y0R A;  4NGN A;  1SQH A;  4CGN A;  3KR5 A;  2DPS A;  5ELY A;  2Q7S A;  1FT7 A;  4KVX A;  2QJ8 A;  4KLW A;  2V8H A;  3RYO A;  1DE4 C;  3V8I A;  1Z8W A;  2Z3L A;  3B3W A;  2BL1 A;  3PBB A;  2ZEP A;  3IU2 A;  3I1U A;  2PJ9 A;  3A9L A;  4E0A A;  2Z3K A;  5F48 A;  4JD6 A;  1Z8L A;  2AFZ A;  1MK4 A;  2K5T A;  2Z3O A;  2P6F A;  2ZW6 A;  3LD2 A;  4X5K A;  3KI9 A;  1S7F A;  1CP7 A;  3WC5 A;  2GLF A;  4XPD C;  2GFQ A;  5JPH A;  2PDO A;  4A39 A;  3IU1 A;  1XE4 A;  5F47 A;  3S6F A;  1M4D A;  2DF5 A;  2PJ8 A;  2Z3N A;  5A28 A;  1FNO A;  4P4E A;  3F5B A;  3R1K A;  1BLL E;  4JWP A;  4PXC A;  4C2Z A;  4QBJ A;  3NH4 A;  2I3C A;  3T9Y A;  2GAN A;  2POK A;  3IWG A;  4R9M A;  4EVY A;  1XMT A;  3PEI A;  3G8W A;  2FVG A;  3VWD A;  1KUV A;  4KZT A;  4ZX9 A;  3IFE A;  1X12 A;  2HUZ A;  3SXN A;  2VI7 A;  4U5Y A;  1BOB A;  4UEF A;  2CIJ A;  3DDD A;  2GRE A;  1CP6 A;  3DGV A;  4M3S A;  4JLY A;  3H4Q A;  3CXQ A;  3BJ7 A;  4IF5 A;  3BI0 A;  1HDU A;  1S7L A;  5H86 A;  4CAX A;  4E8O A;  1VKC A;  1Z8T A;  1CM0 A;  4FD4 A;  4JJX A;  1UFH A;  2ZEG A;  4R57 A;  2NSM A;  3GYA A;  2WYR A;  3N5F A;  4UEZ A;  4EWT A;  5JQ4 A;  4RUH A;  2NMT A;  1UWY A;  4ZY1 A;  3W6X A;  2IMO A;  3VWE A;  3ZZI A;  4K30 A;  1IYL A;  4UA3 A;  1ZG8 A;  2R1I A;  4FUU A;  4OID A;  4MFQ A;  4F9U A;  4KSF A;  3S6G A;  3BXM A;  4PXD A;  2OZH A;  2ZEO A;  2Z11 A;  4UCM A;  4A30 A;  4BBH A;  3CT9 A;  5HVH A;  4NJR A;  3S6K A;  3FRM A;  2WPW A;  2A4N A;  2QVP A;  2X7B A;  4FD7 A;  2Y0M A;  4NFR A;  5JGF A;  3D67 A;  2PJC A;  2ZW7 A;  3ISZ A;  3LWU A;  4CS0 B;  2Q51 A;  2P6G A;  4DUK A;  1AUG A;  4MCS A;  2B4D B;  3FVL A;  2REF A;  4MFK A;  4F8Z A;  1KZF A;  4R87 A;  5LRK A;  4KOV A;  2PE3 A;  3HLP A;  8CPA A;  3L2N A;  2YNC C;  2ZEM A;  3FEE A;  4F6A A;  3NE8 A;  3D7F A;  1M44 A;  3R95 A;  5KTD A;  1YLO A;  1QSR A;  1VHS A;  4KOS A;  3NE7 A;  4KOX A;  1QSM A;  2VEZ A;  4TNU A;  4II9 A;  2YND A;  3RO0 A;  1TF8 A;  2CY2 A;  3IJ3 A;  4M85 A;  3DLJ A;  2PJ4 A;  4ORF A;  4CRZ B;  4DNC A;  4J3G A;  4PV6 A;  2PSW A;  3NH5 A;  4OC0 A;  1YSJ A;  1R43 A;  1Y9W A;  5CBM A;  4P4B A;  1S7K A;  1YGH A;  3D68 A;  2YNE A;  3B7I A;  2BO9 A;  1Y7E A;  5D29 A;  7CPA A;  5JM6 A;  4ZI6 A;  1QSN A;  3EY5 A;  1CJW A;  2HV2 A;  3IEH A;  5EC4 A;  4U9Y A;  3NFZ A;  4B13 A;  3FYN A;  3QAY A;  3TC8 A;  3VH9 A;  4X3R A;  2GLJ A;  2QIR A;  4OIW A;  4P4I A;  1JWQ A;  2NYQ A;  2BOA A;  3FX6 A;  2KCW A;  3KAS A;  2FIA A;  4UCP A;  4MHD A;  3B3C A;  4PK3 A;  5K8O A;  2AFW A;  1S60 A;  1M1D A;  5LYD A;  3TTH A;  2JEV A;  2EO8 A;  4MHN A;  5I4M A;  5IB9 A;  2JBJ A;  4MHZ A;  3ZJ0 A;  4MRI A;  4MFL A;  3W91 A;  4MI4 A;  4X8I A;  2PRB A;  2IQ6 A;  3K9T A;  1LFW A;  5IV0 A;  3G3S A;  3TO7 A;  2B4D A;  4HNW B;  3KR4 A;  2JDC A;  1MJB A;  1N71 A;  5HMN A;  1X10 A;  4M6G A;  4A33 A;  5LYL A;  3SJE A;  1S5K A;  1XFO A;  3MRU A;  1S3Z A;  4NGS A;  1QQ9 A;  4H89 A;  1VGY A;  4WWV A;  2AFM A;  5C88 A;  1FY7 A;  4XPK A;  5J8C A;  1IOI A;  4AVC A;  4OAD A;  3D2M A;  2ZXV A;  4F0X A;  3CPX A;  2PCU A;  2O53 A;  3CPA A;  2C1C A;  4QVT A;  4AVA A;  5LYF A;  1ZLH A;  3H8F A;  1Q2Y A;  4KOW A;  4A95 A;  2PQ8 A;  4X2T A;  2J9A A;  3PB9 X;  3WAB A;  5K8N A;  4GM5 A;  4Y49 B;  2ARH A;  3FIX A;  3PFE A;  2YGW A;  4QC6 A;  2VBQ A;  2G0B A;  3DR8 A;  3LAC A;  4YGO A;  4CYQ A;  3TOA A;  1MJA A;  5HVG A;  3TOB A;  2ZPA A;  3LMS A;  3UY5 A;  3SI0 A;  4LUA A;  5CPA A;  2R98 A;  4C7H A;  2V77 A;  3IWE A;  1MJ9 A;  1ZLI A;  5AG7 A;  5LRG A;  3T8W A;  1F2P A;  2DPT A;  2HQY A;  2PRQ A;  3BJ8 A;  3NH8 A;  1IIC A;  2BSW A;  2V8G A;  1B6B A;  1LOK A;  2JBK A;  4PSX A;  3FMC A;  2ZEH A;  4PQA A;  4PXE A;  2ATR A;  3OWC A;  4PPZ A;  2Q4V A;  2JLM A;  4OC5 A;  4PK2 A;  2IJZ A;  1Q2C A;  1PU9 A;  1WK4 A;  2C6G A;  4JXQ A;  2F5I A;  4MY0 A;  5DWN A;  3RAM A;  1ZG9 A;  3CXS A;  6CPA A;  4XNH B;  3T90 A;  5DS0 A;  4CGL A;  2FS5 A;  2AE6 A;  1YW4 A;  4R76 A;  2PC1 A;  5JH9 A;  2PR8 A;  4OKO A;  5EMI A;  3JUW A;  1YW6 A;  4NGQ A;  4BIN A;  5ISV A;  3JTK A;  1RXT A;  2D4O A;  3IWW A;  2B3U A;  4P4D A;  2AJ6 A;  3I3G A;  1YK3 A;  3GB0 A;  3R9E A;  3R9F A;  3GY9 A;  4MBU A;  2AFX A;  4ONW A;  2OOT A;  3IO1 A;  4K3N A;  2EWB A;  3SJF A;  4HPS A;  4IK2 A;  1H8L A;  1YLE A;  5GCN A;  4CGM A;  5KTC A;  3WT4 A;  1AMP A;  3MN8 A;  2FE7 A;  1RO5 A;  3DSB A;  1IB1 E;  3PBE A;  2QYV A;  3I9S A;  2Z3M A;  2FSR A;  1TIQ A;  3PB7 X;  1ZO0 A;  4BMH A;  4W9Y A;  4ONU A;  1NSL A;  2BEI A;  3D7D A;  2Q43 A;  4R3K A;  4RI1 A;  1RTQ A;  1Y9K A;  1Z9U A;  3PB4 X;  5HXD A;  1I1D A;  2BUE A;  4U9Z A;  3TE4 A;  4CAE A;  2PVW A;  3TT2 A;  2OR4 A;  3TX8 A;  4MMO A;  4KSI A;  5G21 A;  2JDD A;  4FWU A;  1YQE A;  4JZ0 A;  4NGM A;  4CRY B;  5I0C A;  4R3L A;  4IHM A;  1PCA A;  1HDQ A;  3TFY A;  1IY7 A;  2VZY A;  1YME A;  2FIW A;  2WSA A;  1PUA A;  3LOD A;  4MHP A;  3WC7 A;  2IL4 A;  4B10 A;  4CAV A;  1VHO A;  4KUA A;  1TXR A;  4OP4 A;  2OB0 A;  1OBR A;  2B5G B;  2P6E A;  4R7M A;  4FBE A;  2DXQ A;  3IIB A;  1B87 A;  1LCP A;  3SI2 A;  2XEG A;  1BAV A;  1IU8 A;  2CF4 A;  4ZY2 A;  2C6C A;  1M4G A;  2VXK A;  1TKF A;  4IAV A;  4MFJ A;  5AG4 A;  2Z10 A;  1I12 A;  3D3S A;  3FBU A;  4MFZ A;  4CYO A;  3SJX A;  1Y7R A;  1IOF A;  3V38 A;  2O28 A;  2PJ3 A;  4XPD B;  3FEC A;  4MHY A;  3PFO A;  4MFP A;  4GS4 A;  3PZJ A;  4NJQ A;  1XBU A;  3B3T A;  3TO6 A;  4YFJ A;  4FD6 A;  2EUI A;  3KL9 A;  2B58 A;  3S6H A;  3R9G A;  4CAW A;  3IC1 A;  2ZEE A;  3FED A;  2PJ5 A;  1U6M A;  3H8E A;  4UFW A;  4C2Y A;  1LAN A;  5FVJ A;  2GU2 A;  1Z4E A;  2ZEF A;  4KOU A;  1CPS A;  5G1Z A;  3E0K A;  3TCV A;  4G1P A;  2G3A A;  2WZN A;  3SI1 A;  2AFU A;  4LQ6 A;  4ZX8 A;  1NE9 A;  2I00 A;  3F0A A;  2C6P A;  3JRU A;  3DR6 A;  4ZY0 A;  1KUY A;  2RB7 A;  1Z4R A;  2WPX A;  4HKF A;  4UF4 A;  1BO4 A;  4ZGY B;  3P2F A;  3IGR A;  5G20 A;  4H6U A;  2CNM A;  4L89 A;  3VAR A;  5KTA A;  3KHX A;  1LRZ A;  3SHP A;  2PJB A;  1IYK A;  3B2Y A;  4PSW A;  2B5G A;  2Z3P A;  3RBU A;  4AXV A;  4B12 A;  2PJ2 A;  5IB0 A;  5F49 A;  4XPL A;  1Q7L A;  1IGB A;  4NEX A;  4RN7 A;  4OC3 A;  1Y0Y A;  3C26 A;  3DNS A;  4R8F A;  2EVN A;  2BCO A;  1ARM A;  3NA6 A;  4NGT A;  1XJO A;  2Z0Z A;  3KGQ A;  1A2Z A;  4MCR A;  4AVB A;  2Q4Y A;  4M6H A;  3QAH A;  3QB8 A;  2ZOG A;  3ISX A;  3CXP A;  4UFX A;  3D4U A;  4TWE A;  4A31 A;  1ZG7 A;  4NGR A;  3GLJ A;  3B35 A;  2GE3 A;  3EXN A;  2PJ7 A;  5AG6 A;  4JXR A;  4FD5 A;  4OC4 A;  1OZP A;  1Z5R A;  2ZW5 A;  2G9D A;  4OC1 A;  5F09 A;  1L0C A;  3D8P A;  3CZX A;  2R8V A;  4HNY B;  4P45 A;  4UWJ A;  2OU2 A;  5THW A;  3H5Z A;  3VAT A;  1TKH A;  5BWA B;  4CGO A;  4KSA A;  5HVF A;  2XEI A;  1QMU A;  3WC6 A;  4DJL A;  2CNT A;  3S9N A;  3PRT A;  3BI1 A;  4A32 A;  4F9V A;  1CX8 A;  3D66 A;  3BHX A;  4M6I A;  3WR7 A;  1CPX A;  2F7V A;  1S7N A;  1WWZ A;  4Z65 A;  1NMT A;  2ZED A;  4UBR A;  1LAP A;  3D2P A;  3PB6 X;  1CBX A;  4UCN A;  5CNP A;  3K2K A;  4KVO E;  3EC4 A;  2HC9 A;  1XRY A;  2PIZ A;  2ANP A;  4ZYQ A;  5AG5 A;  3RNZ A;  2EK9 A;  2VZZ A;  1XEB A;  3KQX A;  4YRH A;  1AYE A;  4P4J A;  4RS2 A;  3PB8 X;  2G3T A;  3QNV A;  4A37 A;  2J8N A;  2HB6 A;  4P6Y A;  1YR0 A;  2PR1 A;  4ZBG A;  5H84 A;  4AG9 A;  3KZW A;  1BPM A;  1Q2D A;  2PJ1 A;  2FXF A;  1IID A;  1M4L A;  5C82 A;  2P0W A;  4MJ8 A;  4NSQ A;  4Q38 A;  4UIB A;  2RC4 A;  3HUV A;  2OZG A;  4OLL A;  4OAE A;  3R96 A;  4A94 A;  1J4J A;  4E2A A;  4F0Y A;  1XOV A;  1TKJ A;  2RFH A;  4CPA A;  1F57 A;  2F8H A;  2OH1 A;  2J8M A;  5HH1 A;  5J1Q A;  2OZU A;  4B14 A;  1PYT B;  4HNX B;  5LYI A;  4CYN A;  2AFO A;  2FT0 A;  4Q7A A;  4P4F A;  1KUX A;  1R3N A;  2ABZ A;  4IUS A;  2YNC A;  2WUU A;  1Z8X A;  2CTC A;  2FCK A;  3FJU A;  3B3S A;  4OC2 A;  1CG2 A;  3MGD A;  3KKW A;  4UFV A;  4UIA A;  3JVN A;  1NSA A;  4QB9 A;  3BLN A;  2JEW A;  1QST A;  2ODF A;  1TF9 A;  1YVK A;  1ELM P;  2QML A;  3FF3 A;  2B3V A;  4EFD A;  2CXA A;  2CNS A;  4KLV A;  4Y49 C;  2REE A;  2EK8 A;  3P2H A;  4CYP A;  1YRE A;  1GHE A;  1LAM A;  2VL1 A;  2PJ6 A;  5G22 A; 
#chains in the Genus database with same CATH homology
 1YX0 A;  2ZW4 A;  2C27 A;  4LX9 A;  3EO4 A;  4Q36 A;  4L8A A;  3SXO A;  3K9U A;  4KS9 A;  4KOR A;  5E96 A;  1QSO A;  4KOT A;  2Q7B A;  4C2X A;  3PP9 A;  3FNC A;  3F8K A;  4B5P B;  3TO9 A;  2Q44 A;  1XIX A;  2R7H A;  4NXY A;  1I21 A;  3GKR A;  4XNH C;  1K4J A;  2I79 A;  1P0H A;  4A2Z A;  1R57 A;  2GIV A;  4I49 A;  4B11 A;  2Q0Y A;  2J8R A;  4NCZ A;  1YVO A;  2D4P A;  4KVM E;  3FB3 A;  4H6Z A;  4CGP A;  3PGP A;  1ON0 A;  2FL4 A;  5A27 A;  5EBV A;  2Q04 A;  4C68 A;  5DWM A;  2B4B A;  4UWI A;  1M4I A;  1V0C A;  1XF8 A;  2QEC A;  3N7Z A;  4CAF A;  5AGE A;  2H5M A;  2VQY A;  5J8F A;  3B8G A;  4QUS A;  5IX3 A;  5F46 A;  4KUB A;  4MY3 A;  4C7I A;  3FXT A;  4AB7 A;  3W6S A;  4B5O A;  1P4N A;  4NF1 A;  4AG7 A;  4B5P A;  3EFA A;  4KOY A;  4CGN A;  1SQH A;  2DPS A;  4KVX A;  4KLW A;  3RYO A;  3V8I A;  2Z3L A;  2BL1 A;  3IU2 A;  3A9L A;  4E0A A;  2Z3K A;  5F48 A;  4JD6 A;  2ZW6 A;  1MK4 A;  2K5T A;  2P6F A;  2Z3O A;  3LD2 A;  4X5K A;  1S7F A;  4XPD C;  5JPH A;  2PDO A;  3IU1 A;  1XE4 A;  5F47 A;  3S6F A;  1M4D A;  2Z3N A;  5A28 A;  3F5B A;  3R1K A;  4JWP A;  4C2Z A;  4QBJ A;  3T9Y A;  2GAN A;  3IWG A;  4EVY A;  4R9M A;  1XMT A;  3G8W A;  3VWD A;  1KUV A;  4KZT A;  3SXN A;  2HUZ A;  2VI7 A;  4U5Y A;  1BOB A;  3DDD A;  4M3S A;  4JLY A;  3H4Q A;  3CXQ A;  3BJ7 A;  4IF5 A;  1S7L A;  5H86 A;  4CAX A;  4E8O A;  1VKC A;  4FD4 A;  1CM0 A;  4JJX A;  1UFH A;  4R57 A;  3GYA A;  5JQ4 A;  2NMT A;  3W6X A;  3VWE A;  3ZZI A;  4K30 A;  1IYL A;  4UA3 A;  2R1I A;  4MFQ A;  4KSF A;  3S6G A;  2OZH A;  2Z11 A;  4UCM A;  4A30 A;  4BBH A;  3S6K A;  3FRM A;  2WPW A;  2A4N A;  2X7B A;  4FD7 A;  2Y0M A;  2ZW7 A;  4CS0 B;  2P6G A;  2B4D B;  4MFK A;  2REF A;  1KZF A;  4R87 A;  4KOV A;  2YNC C;  4F6A A;  3R95 A;  1M44 A;  5KTD A;  1QSR A;  1VHS A;  4KOS A;  3NE7 A;  4KOX A;  1QSM A;  2VEZ A;  2YND A;  2CY2 A;  4M85 A;  4ORF A;  4CRZ B;  4DNC A;  4J3G A;  4PV6 A;  2PSW A;  1Y9W A;  1S7K A;  1YGH A;  2YNE A;  1QSN A;  3EY5 A;  1CJW A;  2HV2 A;  5EC4 A;  4U9Y A;  4B13 A;  3FYN A;  2QIR A;  2KCW A;  4UCP A;  2FIA A;  4MHD A;  4PK3 A;  1S60 A;  1M1D A;  3TTH A;  2JEV A;  3ZJ0 A;  4MFL A;  3W91 A;  4MI4 A;  2PRB A;  5IV0 A;  3G3S A;  3TO7 A;  2B4D A;  4HNW B;  2JDC A;  1MJB A;  1N71 A;  5HMN A;  4A33 A;  1S5K A;  1S3Z A;  4H89 A;  5C88 A;  1FY7 A;  4XPK A;  5J8C A;  4AVC A;  4OAD A;  3D2M A;  2ZXV A;  4F0X A;  4QVT A;  4AVA A;  1Q2Y A;  4KOW A;  4A95 A;  2PQ8 A;  4Y49 B;  2ARH A;  3FIX A;  2YGW A;  4QC6 A;  2VBQ A;  2G0B A;  3DR8 A;  4YGO A;  4CYQ A;  3TOA A;  1MJA A;  3TOB A;  2ZPA A;  3UY5 A;  4LUA A;  4C7H A;  2R98 A;  3IWE A;  1MJ9 A;  5AG7 A;  2HQY A;  2DPT A;  3BJ8 A;  1IIC A;  2BSW A;  1B6B A;  4PSX A;  2ATR A;  3OWC A;  2Q4V A;  2JLM A;  4PK2 A;  5DWN A;  1Q2C A;  1PU9 A;  1WK4 A;  4JXQ A;  4MY0 A;  2F5I A;  3CXS A;  4XNH B;  3T90 A;  4CGL A;  2FS5 A;  2AE6 A;  2PC1 A;  2PR8 A;  3JUW A;  5ISV A;  3JTK A;  1RXT A;  2D4O A;  2B3U A;  2AJ6 A;  3I3G A;  1YK3 A;  3R9E A;  3R9F A;  3GY9 A;  4MBU A;  1YLE A;  5GCN A;  4CGM A;  5KTC A;  2FE7 A;  1RO5 A;  3DSB A;  1IB1 E;  3I9S A;  2Z3M A;  2FSR A;  1TIQ A;  1ZO0 A;  4BMH A;  4ONU A;  1NSL A;  2BEI A;  4R3K A;  4RI1 A;  1Z9U A;  1Y9K A;  1I1D A;  2BUE A;  4U9Z A;  3TE4 A;  4CAE A;  3TT2 A;  5G21 A;  2JDD A;  4CRY B;  5I0C A;  4R3L A;  3TFY A;  2VZY A;  2WSA A;  3LOD A;  2FIW A;  4B10 A;  1PUA A;  4CAV A;  2IL4 A;  4KUA A;  2OB0 A;  2B5G B;  2P6E A;  2DXQ A;  1B87 A;  4MFJ A;  1M4G A;  2VXK A;  5AG4 A;  2Z10 A;  1I12 A;  3D3S A;  3FBU A;  4MFZ A;  4CYO A;  1Y7R A;  2O28 A;  4XPD B;  4MFP A;  4GS4 A;  3PZJ A;  3TO6 A;  4YFJ A;  4FD6 A;  2EUI A;  2B58 A;  3S6H A;  3R9G A;  4CAW A;  1U6M A;  4UFW A;  4C2Y A;  5FVJ A;  1Z4E A;  4KOU A;  5G1Z A;  3E0K A;  3TCV A;  2G3A A;  1NE9 A;  2I00 A;  3F0A A;  3DR6 A;  1KUY A;  1Z4R A;  2WPX A;  4HKF A;  4ZGY B;  1BO4 A;  4II9 A;  3P2F A;  3IGR A;  5G20 A;  4H6U A;  2CNM A;  4L89 A;  5KTA A;  1LRZ A;  3SHP A;  1IYK A;  4PSW A;  2B5G A;  2Z3P A;  4B12 A;  5IB0 A;  5F49 A;  4XPL A;  4NEX A;  3C26 A;  3DNS A;  2EVN A;  2Z0Z A;  4AVB A;  2Q4Y A;  3QAH A;  3QB8 A;  3CXP A;  4UFX A;  4A31 A;  2GE3 A;  3EXN A;  5AG6 A;  4JXR A;  4FD5 A;  1OZP A;  2ZW5 A;  1L0C A;  3D8P A;  4UWJ A;  2R8V A;  4HNY B;  2OU2 A;  3H5Z A;  5BWA B;  4CGO A;  4KSA A;  2CNT A;  4A32 A;  3WR7 A;  1S7N A;  1WWZ A;  1NMT A;  4UBR A;  3D2P A;  4UCN A;  5CNP A;  4KVO E;  3EC4 A;  5AG5 A;  2VZZ A;  1XEB A;  4YRH A;  4RS2 A;  2G3T A;  2J8N A;  1YR0 A;  2PR1 A;  4ZBG A;  5H84 A;  4AG9 A;  1Q2D A;  2FXF A;  1IID A;  5C82 A;  2P0W A;  4MJ8 A;  4NSQ A;  4Q38 A;  2RC4 A;  2OZG A;  4OLL A;  4OAE A;  3R96 A;  1J4J A;  4E2A A;  4F0Y A;  2OH1 A;  2J8M A;  5HH1 A;  2OZU A;  4B14 A;  4HNX B;  4CYN A;  2FT0 A;  1KUX A;  4IUS A;  2YNC A;  2WUU A;  2FCK A;  3MGD A;  3KKW A;  4UFV A;  3JVN A;  4QB9 A;  3BLN A;  1QST A;  1YVK A;  2QML A;  2B3V A;  2CXA A;  2CNS A;  4KLV A;  4Y49 C;  2REE A;  3P2H A;  4CYP A;  1YRE A;  1GHE A;  5G22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...