4NF1A

Structure of n-acetyltransferase domain of x. fastidiosa nags/k without his-tag
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
146
structure length
146
Chain Sequence
VIRATTWKDLDLPRLQHLIQSSFRRTLIPHYFETTPLLRAYVSENYRAAVILTKLGNVPYLDKFAVLDDAQGEGLGRAVWSIMREETPQLFWRSRHNNQANAFYYAESDGYYKQDHWKIFWNGLHHFQQIQQCVAHCTQHPPTLID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of the N-acetyltransferase domain of Xylella fastidiosaN-acetyl-L-glutamate synthase/kinase with and without a His tag bound to N-acetyl-L-glutamate.
pubmed doi rcsb
source organism Xylella fastidiosa temecula1
molecule tags Transferase
molecule keywords Acetylglutamate kinase
total genus 48
structure length 146
sequence length 146
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.2.8: Acetylglutamate kinase.
pdb deposition date 2013-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4nf1A00
3NE7A 4JJXA 4FD4A 1S7KA 4I49A 3B8GA 1S7LA 4E2AA 2R98A 1I21A 4XNHC 3F5BA 2P0WA 4AVBA 4U9ZA 2G0BA 1XMTA 2Z11A 1FY7A 2CNSA 3W91A 1R57A 4FD7A 2REFA 4KLVA 4RI1A 3TO7A 4M85A 5IX3A 4HKFA 4CS0B 4KVXA 4H6ZA 3F8KA 1ON0A 4HNYB 2Z0ZA 3RYOA 2OZGA 4CRZB 3N7ZA 3D2PA 2Q04A 3T9YA 1IYKA 2BUEA 4KOUA 2Q44A 1NSLA 4R87A 2ZW4A 5HMNA 3ZZIA 3T90A 3BJ8A 4EVYA 5HH1A 4HNXB 4B5PA 4MI4A 4QBJA 4OAEA 2QECA 1Y7RA 4LX9A 2DXQA 2AJ6A 4MJ8A 1XE4A 3SXNA 1B6BA 3R1KA 4L8AA 4KVME 4ZBGA 2VZYA 4E0AA 1BOBA 2OZHA 3D8PA 3TTHA 2ZW7A 3FNCA 2REEA 4KOWA 2FT0A 3TOBA 1UFHA 2H5MA 1I1DA 2HUZA 3S6GA 1IYLA 5J8CA 4UWJA 5DWMA 1Y9WA 5F49A 4IF5A 5F48A 3QAHA 4XPLA 1I12A 2GIVA 3OWCA 2ZW5A 4LUAA 3LD2A 3LODA 2B3VA 4IUSA 2R7HA 4MBUA 2D4PA 2OU2A 5DWNA 2GE3A 1Q2DA 3JUWA 4CAWA 2JLMA 1S7FA 1PUAA 1VHSA 3I3GA 4F0YA 4FD5A 3GKRA 2J8RA 2JDDA 4KUAA 5CNPA 3QB8A 1BO4A 2QIRA 1M1DA 2RC4A 3FXTA 1S5KA 4AVCA 2FIWA 1KUXA 2OZUA 2P6FA 2Z10A 3R9FA 2P6EA 3DR8A 3VWDA 2A4NA 4PK3A 1XF8A 3S6HA 2FSRA 3W6XA 3F0AA 3KKWA 2FS5A 3D2MA 4KZTA 5ISVA 1M4GA 4KLWA 2B3UA 2FE7A 2I00A 2EVNA 3PZJA 2ZPAA 1YREA 4FD6A 1IICA 4KORA 2VQYA 3VWEA 1S60A 1PU9A 1CM0A 5C82A 1P4NA 1Q2YA 3H4QA 4Y49B 2D4OA 4MHDA 3R9EA 4PK2A 2HQYA 1NMTA 3E0KA 3TCVA 1KZFA 2CY2A 1YK3A 2CNTA 2PRBA 3S6FA 4B5PB 3UY5A 4NF1A 2B4DB 4R3KA 1MJ9A 4YFJA 2ARHA 2HV2A 4OADA 2I79A 2VZZA 2B5GA 1V0CA 4GS4A 4KOTA 1SQHA 5C88A 3EXNA 5EC4A 4JD6A 4OLLA 3TOAA 2P6GA 4KOYA 4F6AA 2VBQA 1Y9KA 3TO6A 2OH1A 4KOXA 2F5IA 1M4DA 3C26A 3EC4A 4JXQA 2Y0MA 1QSMA 1MK4A 4QB9A 1K4JA 5H86A 1MJAA 4ONUA 4NCZA 2ZW6A 3EFAA 2JDCA 3W6SA 5JQ4A 2AE6A 1M44A 3BLNA 3R96A 1YGHA 4Y49C 1XIXA 2B58A 1XEBA 2PR8A 1RO5A 3EO4A 3P2HA 1WWZA 3MGDA 3ZJ0A 2J8MA 3DDDA 1QSTA 3IWGA 3V8IA 4UWIA 4PSXA 4XPKA 3DNSA 2PR1A 2ZXVA 4YRHA 5F47A 1Q2CA 1YVKA 4HNWB 2Q4VA 1Z9UA 4UBRA 1KUVA 4AB7A 1GHEA 2BEIA 1P0HA 3R9GA 2ATRA 3S6KA 2OB0A 3TO9A 2O28A 1VKCA 2PDOA 3SXOA 3D3SA 2NMTA 4L89A 4J3GA 4XNHB 1Z4RA 4JXRA 1N71A 1YR0A 3TT2A 4AG9A 3CXSA 4CAVA 1L0CA 2VXKA 5KTAA 3FYNA 3G8WA 3FIXA 3PP9A 4H89A 4MY0A 4NSQA 2X7BA 2VI7A 1TIQA 4KUBA 3GYAA 1YLEA 4AG7A 4NEXA 1KUYA 1J4JA 1OZPA 3FRMA 3SHPA 5H84A 2PSWA 2B5GB 5IB0A 4QUSA 1Z4EA 5JPHA 3TE4A 2WPXA 4NXYA 2CNMA 3BJ7A 2G3TA 4PV6A 3R95A 4QVTA 4ORFA 2Q4YA 4PSWA 2K5TA 2QMLA 5GCNA 4U5YA 4R9MA 2FIAA 2Q7BA 3I9SA 1NE9A 4KOVA 4X5KA 1B87A 2BSWA 2B4DA 2IL4A 5J8FA 2PC1A 4JWPA 4E8OA 4R57A 1S7NA 2R1IA 1RXTA 3DR6A 1WK4A 1YX0A 3G3SA 1S3ZA 2EUIA 5IV0A 4H6UA 4B5OA 5KTCA 2JEVA 1YVOA 4YGOA 2B4BA 1M4IA 3FBUA 1IIDA 3IGRA 4M3SA 1LRZA 2G3AA 4MY3A 3P2FA 4CRYB 4UA3A 4U9YA 3DSBA 1MJBA 2WPWA 4R3LA 1U6MA 2R8VA 4II9A 3EY5A 4QC6A 4K30A 2FXFA 2VEZA 2J8NA 2FCKA 4KOSA 3WR7A 3PGPA 5EBVA 4BMHA 1CJWA 2Q0YA 5F46A 2KCWA 2C27A 5I0CA 2GANA 5FVJA 4AVAA 1QSRA 4RS2A 2BL1A 4JLYA 4DNCA 3CXQA 3FB3A 1IB1E 2PQ8A 3JVNA 1QSOA 1QSNA 2FL4A 4XPDB 5KTDA 3CXPA 4XPDC 3TFYA 5E96A 4KVOE 3GY9A 4CAXA 3K9UA
chains in the Genus database with same CATH superfamily
2WSAA 1Z8XA 3NE7A 4JJXA 4A95A 3KZWA 4FD4A 1S7KA 4MFJA 4I49A 4A33A 2YNCA 3B8GA 1S7LA 4E2AA 2F7VA 2R98A 4NFRA 1I21A 3PB7X 2AFSA 4XNHC 4UIAA 3F5BA 2P0WA 3CZXA 4M6GA 3TE4A 3H5ZA 3S9NA 2C1CA 4AVBA 4U9ZA 4ZY0A 2PJ8A 3H8EA 4X3RA 2G0BA 1XMTA 2Z11A 4DJLA 3IO1A 1FY7A 4A2ZA 1VHEA 2CNSA 3W91A 1R57A 4FD7A 2REFA 4KLVA 4W9YA 4RI1A 4Q38A 4RN7A 3TO7A 4M85A 5HVFA 5IX3A 3FX6A 4HKFA 4A30A 2I3CA 3PB8X 3H8GA 4GXHA 4B6ZA 4CPAA 4CS0B 4KVXA 4H6ZA 3F8KA 1BPNA 3CDXA 1ON0A 4HNYB 4OC0A 2Z0ZA 2ODFA 2OZGA 1FNOA 4X8IA 3RYOA 2ABZA 4CRZB 2ZEHA 3N7ZA 3D2PA 2Q04A 3T9YA 2EK9A 3PFEA 3VH9A 1IYKA 2BUEA 5IB9A 5K8MA 4KOUA 4MCSA 2Q44A 2VL1A 1NSLA 1VHOA 4R87A 5HVHA 2ZW4A 5HMNA 3ZZIA 2PJ2A 3T90A 3WABA 3KR5A 3BJ8A 4OC2A 3PB6X 2AFOA 5HH1A 1DE4C 4HNXB 3V38A 4B5PA 4P4EA 4EVYA 2EBJA 4MI4A 4QBJA 2WYRA 4OAEA 5G20A 2PIZA 1HDQA 1Y0YA 1Y7RA 2QECA 2V8DA 4LX9A 2PJ5A 4MMOA 4UF4A 2DXQA 1CX8A 2AJ6A 2ZEEA 2ZEPA 4A32A 4MJ8A 1Z2LA 1PCAA 1XE4A 3SXNA 4A39A 3B3SA 3FF3A 4M6IA 1B6BA 1VGYA 2IMOA 3R1KA 2XEJA 4CYNA 2XEGA 3CT9A 4KVME 4L8AA 2PJ4A 4ZBGA 4CAFA 2VZYA 4E0AA 1BOBA 4MCRA 2OZHA 3B7IA 2PJ3A 3D8PA 3TTHA 2ZW7A 3FNCA 2REEA 4KOWA 4PXEA 3RO0A 5F09A 1CBXA 8CPAA 3SJEA 2FT0A 1Z8LA 2HC9A 5LRKA 3VATA 3TOBA 1YLOA 2PVVA 4G1PA 4TWEA 1TKHA 1AYEA 5JH9A 1UFHA 4C68A 4YU9A 2QJ8A 2H5MA 1I1DA 2HUZA 3S6GA 1IYLA 4OC1A 5J8CA 4UWJA 5DWMA 1Y9WA 5F49A 4IF5A 4CGLA 4CYQA 3K2KA 5F48A 2GREA 3QAHA 2GU2A 4NJQA 3KQZA 3FEEA 2PJAA 4NGQA 1KWMA 4XPLA 3K9UA 1I12A 2GIVA 2V8GA 3OWCA 4CGNA 5K8NA 2ZW5A 4LUAA 3LD2A 3GB0A 3SJXA 3LODA 5BWAB 1ZG7A 2B3VA 4IUSA 1M4LA 2R7HA 4UEFA 4MBUA 4OC3A 4OC5A 3TX8A 2D4PA 2OU2A 5DWNA 3K9TA 4MFKA 4ONWA 1XJOA 3GIUA 2GE3A 2ZEFA 1Q2DA 3PB4X 3JUWA 1BLLE 2AFMA 2JBKA 1TXRA 4CAWA 2JLMA 1TKFA 1S7FA 4BINA 1PUAA 1VHSA 2V8VA 7CPAA 2EWBA 3I3GA 4F0YA 4FD5A 1HEEA 1TF9A 3GKRA 2J8RA 2JDDA 3D7DA 4KUAA 5CNPA 3QB8A 2CTBA 1BO4A 1NSAA 1FT7A 2PJ9A 2QIRA 3RZAA 3NE8A 1M1DA 2PJCA 2RC4A 5DS0A 2RFHA 3FXTA 1S5KA 3RAMA 3FJUA 4OKOA 4AVCA 3JTKA 1JQGA 4DYOA 2FIWA 1F2PA 1KUXA 2OZUA 4WWVA 4NGPA 2P6FA 2Z10A 3R9FA 2P6EA 3DR8A 3VWDA 2Q7SA 2V77A 2A4NA 4PK3A 3H8FA 1XF8A 2JBJA 3IWEA 3S6HA 4DUKA 2FSRA 3NFZA 3W6XA 3IC1A 3F0AA 3KKWA 2FS5A 3D2MA 4KZTA 3LACA 5ISVA 1M4GA 2CXAA 4KLWA 1IOFA 2B3UA 3B2YA 2FE7A 2I00A 2EVNA 2AFWA 2YNDA 2O53A 3BI0A 1TF8A 2ZPAA 2PJ1A 1YREA 3IWWA 3PZJA 4UCPA 2YNCC 4FD6A 3KHZA 3PBBA 1IICA 3S9LA 2QYVA 2JEWA 2BOAA 4KORA 4FUUA 4NJRA 4CGMA 4MHNA 3ISXA 4BD9A 1CPSA 2VQYA 3VWEA 3KI9A 4MFLA 1S60A 2Q51A 1PU9A 3ISZA 4R76A 3FH4A 1CM0A 3KR4A 2PJ7A 2C6CA 5C82A 1P4NA 1Q2YA 3H4QA 4Y49B 3IU2A 3BI1A 2D4OA 3CPXA 1X12A 3GUXA 4MHDA 4NGNA 3R9EA 2QVPA 3HLPA 3SJGA 4PK2A 2HQYA 1NMTA 3E0KA 4ZI6A 3TCVA 1KZFA 1ZLHA 2CY2A 4B14A 1YK3A 2CNTA 2PRBA 3S6FA 2ZENA 4B5PB 3UY5A 3KL9A 4NF1A 2B4DB 4R3KA 1MJ9A 4YFJA 2DEAA 3NH4A 1XRYA 2ARHA 3IEHA 2HV2A 3LWUA 2PJ0A 2PJ6A 4OADA 2I79A 4R6TA 2VZZA 2B5GA 1AUGA 1V0CA 3B35A 4GS4A 3QAYA 1SQHA 4KOTA 2Z3MA 4LQGA 4Q7AA 5C88A 3IU1A 4CYPA 3EXNA 5EC4A 4JD6A 4OLLA 3TOAA 4A37A 2P6GA 4UIBA 4KOYA 3JRUA 4OIWA 3SI0A 1CPXA 4F6AA 4ZYQA 2VBQA 4IAVA 1Y9KA 2CTCA 3TO6A 2OH1A 4EMEA 4KOXA 1QQ9A 1GYTA 3PEIA 2F5IA 4ZGYB 1M4DA 4OP4A 4B13A 3C26A 3EC4A 4JXQA 2Y0MA 1QSMA 1UWYA 1MK4A 2G9DA 3NA6A 1K4JA 3NH5A 4QB9A 5H86A 3IFEA 1ZLIA 3L2NA 2YNEA 1MJAA 2Z3PA 4MCQA 4NCZA 2O4HA 4ONUA 2ZW6A 3KGQA 3EFAA 1EE3P 2JDCA 4KSFA 3W6SA 5JQ4A 1IGBA 1F57A 4C7IA 2Q43A 2AE6A 5LYIA 1M44A 3BLNA 4IK2A 5JM6A 4P4IA 3R96A 1BPMA 2OR4A 1YGHA 4AXVA 4Y49C 1XIXA 4NGMA 3DGVA 4M6HA 3D7HA 4KSIA 2B58A 4P44A 1XEBA 2PR8A 5IB0A 1RO5A 3EO4A 3P2HA 4MXUA 2ZOGA 2ZEDA 5JPHA 4MFPA 3TC8A 1ZG8A 5AGEA 1WWZA 2Z3KA 3MGDA 3WC5A 1YW4A 2ZELA 4P4BA 4MRIA 3ZJ0A 1LFWA 3D68A 2J8MA 3DDDA 1LCPA 1QSTA 3IWGA 2PCUA 2PJBA 4GM5A 4F0XA 3V8IA 4UWIA 4PSXA 1ELMP 4XPKA 2C6GA 1RTQA 3FMCA 3DNSA 1Y0RA 2PR1A 4C2ZA 2ZXVA 3BXMA 4UEZA 5HVGA 3GLJA 4UFWA 4YRHA 5F47A 4A94A 2NYQA 4HPSA 1CP6A 1Q2CA 1YVKA 5I4MA 2FVGA 4HNWB 2Q4VA 1Z9UA 4UBRA 1KUVA 4F9UA 4AB7A 5J1QA 1GHEA 2IJZA 2BEIA 4WJBA 1P0HA 3R9GA 1XMBA 2ATRA 4BBHA 4JZ0A 3S6KA 5ELYA 1BAVA 3A9LA 1ZG9A 2OB0A 4YWYA 3TO9A 4P45A 2O28A 4CAEA 1VKCA 2J9AA 3B3CA 2PDOA 3SXOA 3D3SA 2BO9A 4PXDA 1X10A 5LYLA 2NMTA 1OBRA 4RUHA 4L89A 4J3GA 4XNHB 1Z4RA 4JXRA 4A31A 1N71A 5D29A 1YR0A 1IU8A 3TT2A 4NGRA 3LMSA 4AG9A 3CXSA 4FAIA 4CAVA 1L0CA 3MN8A 5AG4A 2VXKA 2GLJA 5D8NA 3FYNA 2ANPA 5KTAA 4PPZA 1ARLA 5G21A 3G8WA 3FIXA 3PP9A 4H89A 4MY0A 2PVWA 4NSQA 5K8OA 2X7BA 2VI7A 1TIQA 4KUBA 3GYAA 3RNZA 1YLEA 3CPAA 1H8LA 4AG7A 1ARMA 4MFQA 4NEXA 1KUYA 1LANA 4PXBA 4OIDA 3HUVA 4TNUA 5G22A 3PFOA 4C7HA 1J4JA 4R8FA 1OZPA 3FRMA 1Q7LA 1YQEA 5LRJA 3SHPA 3QNVA 5CBMA 4UFVA 5H84A 1R43A 2PSWA 3D4UA 3WT4A 2B5GB 3I1UA 4QUSA 2PIYA 1Z4EA 1CP7A 1A2ZA 4IHMA 1AMPA 1DTDA 1CG2A 2IQ6A 2WPXA 4MHZA 4P4DA 3RBUA 4NXYA 4LQ6A 4UFXA 2CNMA 2NSMA 3BJ7A 5CPAA 5JGFA 5AG7A 2G3TA 3BHXA 1LOKA 2DF5A 2BCOA 5EMIA 4PV6A 4NGTA 3KQXA 3T8WA 5HXDA 3R95A 4QVTA 2CIJA 3FEDA 3NH8A 4ORFA 2Q4YA 4CYOA 4PQAA 4R7MA 1ELLP 4CGOA 4PSWA 2K5TA 2QMLA 4K3NA 4MCPA 5A28A 5A27A 5GCNA 4P10A 1JWQA 2HB6A 4U5YA 4R9MA 3KHXA 3V7ZA 4EWTA 4UCMA 2FIAA 2OOTA 2AFZA 2AFXA 3I9SA 2Q7BA 1IY7A 1F2OA 2F8HA 2Z3NA 1NE9A 2CF4A 3D7GA 2DPTA 4FWUA 4KOVA 4X5KA 4NGSA 1B87A 2BSWA 2B4DA 2IL4A 4KS9A 2PC1A 4P4JA 5J8FA 4JWPA 1Z8WA 2RB7A 4E8OA 2ZOFA 2C6PA 3B3WA 4R57A 3FVLA 1S7NA 4Z65A 2R1IA 2XEIA 2PE3A 4ZX8A 2WZNA 4B11A 1RXTA 1HDUA 3DR6A 3D7FA 4OMEA 1WK4A 3WC6A 1XFOA 4MHYA 1YX0A 3G3SA 1IOIA 1S3ZA 2V8HA 2EUIA 5IV0A 1YMEA 4H6UA 5LYDA 2JEVA 4B5OA 5KTCA 1Z5RA 1YVOA 1YW6A 4JYWA 4Q36A 2ZEOA 4YGOA 3KASA 2B4BA 1M4IA 4ZX9A 4ZY2A 3FBUA 4B12A 2GLFA 3B3VA 1IIDA 3IGRA 3PRTA 1LRZA 4M3SA 2G3AA 4MY3A 4EFDA 3P2FA 4CRYB 4P6YA 4UA3A 4U9YA 3DSBA 1MJBA 4UEEA 2WPWA 2AFUA 4R3LA 1XBUA 1U6MA 2R8VA 1YSJA 2Q4ZA 3SI2A 4FBEA 4C2XA 3SI1A 3MRUA 4A38A 4II9A 2XEFA 2Z3OA 3EY5A 4K30A 4QC6A 1ZO0A 2FXFA 2J8NA 2VEZA 5AG6A 3FECA 2FCKA 2ZEMA 2YGWA 4KOSA 3B3TA 4KSAA 4B10A 1Y7EA 2Z3LA 3WR7A 5LYFA 3D66A 4C2YA 3PGPA 5EBVA 4BMHA 4CGPA 1CJWA 1TKJA 2WUUA 2Q0YA 1PYTB 5F46A 2KCWA 2C27A 2ZEGA 3DLJA 5I0CA 4PXCA 2DPSA 4UCNA 3S9MA 2EK8A 2GANA 4ZY1A 5FVJA 4AVAA 4OC4A 4F8ZA 1QSRA 1Z8TA 4O23A 4F9VA 4RS2A 4H2KA 3IJ3A 5LRGA 5AG5A 2BL1A 4JLYA 4MHPA 4DNCA 1QMUA 2PRQA 1LAMA 5THWA 2POKA 3SJFA 3CXQA 3FB3A 3WC7A 1VIXA 6CPAA 1IB1E 2PQ8A 1XOVA 3JVNA 4X2TA 1QSOA 2GFQA 1R3NA 4P4FA 3VARA 1QSNA 2FL4A 3D67A 3N5FA 3PB9X 4XPDB 3PBEA 5KTDA 3CXPA 5K8PA 4XPDC 3TFYA 4MFZA 1LAPA 5E96A 4KVOE 2EO8A 5G1ZA 3IIBA 4CAXA 3GY9A
chains in the Genus database with same CATH topology
2WSAA 3NE7A 4JJXA 4A95A 4FD4A 1S7KA 4MFJA 4I49A 4A33A 2YNCA 3B8GA 1S7LA 4E2AA 2R98A 1I21A 4XNHC 3F5BA 2P0WA 3H5ZA 4AVBA 4U9ZA 2G0BA 1XMTA 2Z11A 1FY7A 4A2ZA 2CNSA 3W91A 1R57A 4FD7A 2REFA 4KLVA 4RI1A 4Q38A 3TO7A 4M85A 5IX3A 4HKFA 4A30A 4CS0B 4KVXA 4H6ZA 3F8KA 1ON0A 4HNYB 2Z0ZA 3RYOA 2OZGA 4CRZB 3N7ZA 3D2PA 2Q04A 3T9YA 1IYKA 2BUEA 4KOUA 2Q44A 1NSLA 4R87A 2ZW4A 5HMNA 3ZZIA 3T90A 3BJ8A 4EVYA 5HH1A 4HNXB 4B5PA 4MI4A 4QBJA 5G20A 4OAEA 2QECA 1Y7RA 4LX9A 2DXQA 2AJ6A 4A32A 4MJ8A 1XE4A 3SXNA 1B6BA 3R1KA 4CYNA 4L8AA 4KVME 4CAFA 4ZBGA 2VZYA 4E0AA 1BOBA 2OZHA 3D8PA 3TTHA 2ZW7A 3FNCA 2REEA 4KOWA 2FT0A 3TOBA 1UFHA 4C68A 2H5MA 1I1DA 2HUZA 3S6GA 1IYLA 5J8CA 4UWJA 5DWMA 1Y9WA 5F49A 4IF5A 4CGLA 4CYQA 5F48A 3QAHA 4XPLA 1I12A 2GIVA 3OWCA 4CGNA 2ZW5A 4LUAA 3LD2A 3LODA 5BWAB 2B3VA 4IUSA 2R7HA 4MBUA 2D4PA 2OU2A 5DWNA 4MFKA 2GE3A 1Q2DA 3JUWA 4CAWA 2JLMA 1S7FA 1PUAA 1VHSA 3I3GA 4F0YA 4FD5A 3GKRA 2J8RA 2JDDA 4KUAA 5CNPA 3QB8A 1BO4A 2QIRA 1M1DA 2RC4A 3FXTA 1S5KA 4AVCA 3JTKA 2FIWA 1KUXA 2OZUA 2P6FA 2Z10A 3R9FA 2P6EA 3DR8A 3VWDA 2A4NA 4PK3A 1XF8A 3IWEA 3S6HA 2FSRA 3W6XA 3F0AA 3KKWA 2FS5A 3D2MA 4KZTA 5ISVA 1M4GA 2CXAA 4KLWA 2B3UA 2FE7A 2I00A 2EVNA 2YNDA 3PZJA 2ZPAA 4UCPA 1YREA 2YNCC 4FD6A 1IICA 4KORA 4CGMA 2VQYA 3VWEA 4MFLA 1S60A 1PU9A 1CM0A 5C82A 1P4NA 1Q2YA 3H4QA 4Y49B 3IU2A 2D4OA 4MHDA 3R9EA 4PK2A 2HQYA 1NMTA 3E0KA 3TCVA 1KZFA 2CY2A 4B14A 1YK3A 2CNTA 2PRBA 3S6FA 4B5PB 3UY5A 4NF1A 2B4DB 4R3KA 1MJ9A 4YFJA 2ARHA 2HV2A 4OADA 2I79A 2VZZA 2B5GA 1V0CA 4GS4A 4KOTA 1SQHA 2Z3MA 5C88A 3IU1A 4CYPA 3EXNA 5EC4A 4JD6A 4OLLA 3TOAA 2P6GA 4KOYA 4F6AA 2VBQA 1Y9KA 3TO6A 2OH1A 4KOXA 2F5IA 4ZGYB 1M4DA 4B13A 3C26A 3EC4A 4JXQA 2Y0MA 1QSMA 1MK4A 4QB9A 1K4JA 5H86A 2YNEA 1MJAA 2Z3PA 4ONUA 4NCZA 2ZW6A 3EFAA 4KSFA 2JDCA 3W6SA 5JQ4A 4C7IA 2AE6A 1M44A 3BLNA 3R96A 1YGHA 4Y49C 1XIXA 2B58A 1XEBA 2PR8A 1RO5A 3EO4A 3P2HA 4MFPA 5AGEA 1WWZA 2Z3KA 3MGDA 3ZJ0A 2J8MA 3DDDA 1QSTA 3IWGA 4F0XA 3V8IA 4UWIA 4PSXA 4XPKA 3DNSA 2PR1A 4C2ZA 2ZXVA 4UFWA 4YRHA 5F47A 1Q2CA 1YVKA 4HNWB 2Q4VA 1Z9UA 4UBRA 1KUVA 4AB7A 1GHEA 2BEIA 1P0HA 3R9GA 2ATRA 4BBHA 3S6KA 3A9LA 2OB0A 3TO9A 2O28A 4CAEA 1VKCA 2PDOA 3SXOA 3D3SA 2NMTA 4L89A 4J3GA 4XNHB 1Z4RA 4JXRA 4A31A 1N71A 1YR0A 3TT2A 4AG9A 3CXSA 4CAVA 1L0CA 5AG4A 2VXKA 5KTAA 3FYNA 5G21A 3G8WA 3FIXA 3PP9A 4H89A 4MY0A 4NSQA 2X7BA 2VI7A 1TIQA 4KUBA 3GYAA 1YLEA 4AG7A 4MFQA 4NEXA 1KUYA 5G22A 4C7HA 1J4JA 1OZPA 3FRMA 3SHPA 4UFVA 5H84A 2PSWA 2B5GB 5IB0A 4QUSA 1Z4EA 5JPHA 3TE4A 2WPXA 4NXYA 4UFXA 2CNMA 3BJ7A 5AG7A 2G3TA 4PV6A 3R95A 4QVTA 4ORFA 2Q4YA 4CYOA 4CGOA 4PSWA 2K5TA 2QMLA 5A28A 5A27A 5GCNA 4U5YA 4R9MA 4UCMA 2FIAA 2Q7BA 3I9SA 2Z3NA 1NE9A 4KOVA 2DPTA 4X5KA 1B87A 2BSWA 2B4DA 2IL4A 4KS9A 2PC1A 5J8FA 4JWPA 4E8OA 4R57A 1S7NA 2R1IA 4B11A 1RXTA 3DR6A 1WK4A 1YX0A 3G3SA 1S3ZA 2EUIA 5IV0A 4H6UA 4B5OA 5KTCA 2JEVA 1YVOA 4Q36A 4YGOA 2B4BA 1M4IA 3FBUA 4B12A 1IIDA 3IGRA 4M3SA 1LRZA 2G3AA 4MY3A 3P2FA 4CRYB 4UA3A 4U9YA 3DSBA 1MJBA 2WPWA 4R3LA 1U6MA 2R8VA 4C2XA 4II9A 2Z3OA 3EY5A 4K30A 4QC6A 1ZO0A 2FXFA 2J8NA 2VEZA 5AG6A 2FCKA 4KOSA 2YGWA 4B10A 4KSAA 2Z3LA 3WR7A 4C2YA 3PGPA 5EBVA 4BMHA 4CGPA 1CJWA 2WUUA 2Q0YA 5F46A 2KCWA 2C27A 5I0CA 2DPSA 4UCNA 2GANA 5FVJA 4AVAA 1QSRA 4RS2A 5AG5A 2BL1A 4JLYA 4DNCA 3CXQA 3FB3A 1IB1E 2PQ8A 3JVNA 1QSOA 1QSNA 2FL4A 4XPDB 5KTDA 3CXPA 4XPDC 3TFYA 4MFZA 5E96A 4KVOE 5G1ZA 3GY9A 4CAXA 3K9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NE7 A;  4JJX A;  4FD4 A;  1S7K A;  4I49 A;  3B8G A;  1S7L A;  4E2A A;  2R98 A;  1I21 A;  4XNH C;  3F5B A;  2P0W A;  4AVB A;  4U9Z A;  2G0B A;  1XMT A;  2Z11 A;  1FY7 A;  2CNS A;  3W91 A;  1R57 A;  4FD7 A;  2REF A;  4KLV A;  4RI1 A;  3TO7 A;  4M85 A;  5IX3 A;  4HKF A;  4CS0 B;  4KVX A;  4H6Z A;  3F8K A;  1ON0 A;  4HNY B;  2Z0Z A;  3RYO A;  2OZG A;  4CRZ B;  3N7Z A;  3D2P A;  2Q04 A;  3T9Y A;  1IYK A;  2BUE A;  4KOU A;  2Q44 A;  1NSL A;  4R87 A;  2ZW4 A;  5HMN A;  3ZZI A;  3T90 A;  3BJ8 A;  4EVY A;  5HH1 A;  4HNX B;  4B5P A;  4MI4 A;  4QBJ A;  4OAE A;  2QEC A;  1Y7R A;  4LX9 A;  2DXQ A;  2AJ6 A;  4MJ8 A;  1XE4 A;  3SXN A;  1B6B A;  3R1K A;  4L8A A;  4KVM E;  4ZBG A;  2VZY A;  4E0A A;  1BOB A;  2OZH A;  3D8P A;  3TTH A;  2ZW7 A;  3FNC A;  2REE A;  4KOW A;  2FT0 A;  3TOB A;  1UFH A;  2H5M A;  1I1D A;  2HUZ A;  3S6G A;  1IYL A;  5J8C A;  4UWJ A;  5DWM A;  1Y9W A;  5F49 A;  4IF5 A;  5F48 A;  3QAH A;  4XPL A;  1I12 A;  2GIV A;  3OWC A;  2ZW5 A;  4LUA A;  3LD2 A;  3LOD A;  2B3V A;  4IUS A;  2R7H A;  4MBU A;  2D4P A;  2OU2 A;  5DWN A;  2GE3 A;  1Q2D A;  3JUW A;  4CAW A;  2JLM A;  1S7F A;  1PUA A;  1VHS A;  3I3G A;  4F0Y A;  4FD5 A;  3GKR A;  2J8R A;  2JDD A;  4KUA A;  5CNP A;  3QB8 A;  1BO4 A;  2QIR A;  1M1D A;  2RC4 A;  3FXT A;  1S5K A;  4AVC A;  2FIW A;  1KUX A;  2OZU A;  2P6F A;  2Z10 A;  3R9F A;  2P6E A;  3DR8 A;  3VWD A;  2A4N A;  4PK3 A;  1XF8 A;  3S6H A;  2FSR A;  3W6X A;  3F0A A;  3KKW A;  2FS5 A;  3D2M A;  4KZT A;  5ISV A;  1M4G A;  4KLW A;  2B3U A;  2FE7 A;  2I00 A;  2EVN A;  3PZJ A;  2ZPA A;  1YRE A;  4FD6 A;  1IIC A;  4KOR A;  2VQY A;  3VWE A;  1S60 A;  1PU9 A;  1CM0 A;  5C82 A;  1P4N A;  1Q2Y A;  3H4Q A;  4Y49 B;  2D4O A;  4MHD A;  3R9E A;  4PK2 A;  2HQY A;  1NMT A;  3E0K A;  3TCV A;  1KZF A;  2CY2 A;  1YK3 A;  2CNT A;  2PRB A;  3S6F A;  4B5P B;  3UY5 A;  4NF1 A;  2B4D B;  4R3K A;  1MJ9 A;  4YFJ A;  2ARH A;  2HV2 A;  4OAD A;  2I79 A;  2VZZ A;  2B5G A;  1V0C A;  4GS4 A;  4KOT A;  1SQH A;  5C88 A;  3EXN A;  5EC4 A;  4JD6 A;  4OLL A;  3TOA A;  2P6G A;  4KOY A;  4F6A A;  2VBQ A;  1Y9K A;  3TO6 A;  2OH1 A;  4KOX A;  2F5I A;  1M4D A;  3C26 A;  3EC4 A;  4JXQ A;  2Y0M A;  1QSM A;  1MK4 A;  4QB9 A;  1K4J A;  5H86 A;  1MJA A;  4ONU A;  4NCZ A;  2ZW6 A;  3EFA A;  2JDC A;  3W6S A;  5JQ4 A;  2AE6 A;  1M44 A;  3BLN A;  3R96 A;  1YGH A;  4Y49 C;  1XIX A;  2B58 A;  1XEB A;  2PR8 A;  1RO5 A;  3EO4 A;  3P2H A;  1WWZ A;  3MGD A;  3ZJ0 A;  2J8M A;  3DDD A;  1QST A;  3IWG A;  3V8I A;  4UWI A;  4PSX A;  4XPK A;  3DNS A;  2PR1 A;  2ZXV A;  4YRH A;  5F47 A;  1Q2C A;  1YVK A;  4HNW B;  2Q4V A;  1Z9U A;  4UBR A;  1KUV A;  4AB7 A;  1GHE A;  2BEI A;  1P0H A;  3R9G A;  2ATR A;  3S6K A;  2OB0 A;  3TO9 A;  2O28 A;  1VKC A;  2PDO A;  3SXO A;  3D3S A;  2NMT A;  4L89 A;  4J3G A;  4XNH B;  1Z4R A;  4JXR A;  1N71 A;  1YR0 A;  3TT2 A;  4AG9 A;  3CXS A;  4CAV A;  1L0C A;  2VXK A;  5KTA A;  3FYN A;  3G8W A;  3FIX A;  3PP9 A;  4H89 A;  4MY0 A;  4NSQ A;  2X7B A;  2VI7 A;  1TIQ A;  4KUB A;  3GYA A;  1YLE A;  4AG7 A;  4NEX A;  1KUY A;  1J4J A;  1OZP A;  3FRM A;  3SHP A;  5H84 A;  2PSW A;  2B5G B;  5IB0 A;  4QUS A;  1Z4E A;  5JPH A;  3TE4 A;  2WPX A;  4NXY A;  2CNM A;  3BJ7 A;  2G3T A;  4PV6 A;  3R95 A;  4QVT A;  4ORF A;  2Q4Y A;  4PSW A;  2K5T A;  2QML A;  5GCN A;  4U5Y A;  4R9M A;  2FIA A;  2Q7B A;  3I9S A;  1NE9 A;  4KOV A;  4X5K A;  1B87 A;  2BSW A;  2B4D A;  2IL4 A;  5J8F A;  2PC1 A;  4JWP A;  4E8O A;  4R57 A;  1S7N A;  2R1I A;  1RXT A;  3DR6 A;  1WK4 A;  1YX0 A;  3G3S A;  1S3Z A;  2EUI A;  5IV0 A;  4H6U A;  4B5O A;  5KTC A;  2JEV A;  1YVO A;  4YGO A;  2B4B A;  1M4I A;  3FBU A;  1IID A;  3IGR A;  4M3S A;  1LRZ A;  2G3A A;  4MY3 A;  3P2F A;  4CRY B;  4UA3 A;  4U9Y A;  3DSB A;  1MJB A;  2WPW A;  4R3L A;  1U6M A;  2R8V A;  4II9 A;  3EY5 A;  4QC6 A;  4K30 A;  2FXF A;  2VEZ A;  2J8N A;  2FCK A;  4KOS A;  3WR7 A;  3PGP A;  5EBV A;  4BMH A;  1CJW A;  2Q0Y A;  5F46 A;  2KCW A;  2C27 A;  5I0C A;  2GAN A;  5FVJ A;  4AVA A;  1QSR A;  4RS2 A;  2BL1 A;  4JLY A;  4DNC A;  3CXQ A;  3FB3 A;  1IB1 E;  2PQ8 A;  3JVN A;  1QSO A;  1QSN A;  2FL4 A;  4XPD B;  5KTD A;  3CXP A;  4XPD C;  3TFY A;  5E96 A;  4KVO E;  3GY9 A;  4CAX A;  3K9U A; 
#chains in the Genus database with same CATH topology
 2WSA A;  1Z8X A;  3NE7 A;  4JJX A;  4A95 A;  3KZW A;  4FD4 A;  1S7K A;  4MFJ A;  4I49 A;  4A33 A;  2YNC A;  3B8G A;  1S7L A;  4E2A A;  2F7V A;  2R98 A;  4NFR A;  1I21 A;  3PB7 X;  2AFS A;  4XNH C;  4UIA A;  3F5B A;  2P0W A;  3CZX A;  4M6G A;  3TE4 A;  3H5Z A;  3S9N A;  2C1C A;  4AVB A;  4U9Z A;  4ZY0 A;  2PJ8 A;  3H8E A;  4X3R A;  2G0B A;  1XMT A;  2Z11 A;  4DJL A;  3IO1 A;  1FY7 A;  4A2Z A;  1VHE A;  2CNS A;  3W91 A;  1R57 A;  4FD7 A;  2REF A;  4KLV A;  4W9Y A;  4RI1 A;  4Q38 A;  4RN7 A;  3TO7 A;  4M85 A;  5HVF A;  5IX3 A;  3FX6 A;  4HKF A;  4A30 A;  2I3C A;  3PB8 X;  3H8G A;  4GXH A;  4B6Z A;  4CPA A;  4CS0 B;  4KVX A;  4H6Z A;  3F8K A;  1BPN A;  3CDX A;  1ON0 A;  4HNY B;  4OC0 A;  2Z0Z A;  2ODF A;  2OZG A;  1FNO A;  4X8I A;  3RYO A;  2ABZ A;  4CRZ B;  2ZEH A;  3N7Z A;  3D2P A;  2Q04 A;  3T9Y A;  2EK9 A;  3PFE A;  3VH9 A;  1IYK A;  2BUE A;  5IB9 A;  5K8M A;  4KOU A;  4MCS A;  2Q44 A;  2VL1 A;  1NSL A;  1VHO A;  4R87 A;  5HVH A;  2ZW4 A;  5HMN A;  3ZZI A;  2PJ2 A;  3T90 A;  3WAB A;  3KR5 A;  3BJ8 A;  4OC2 A;  3PB6 X;  2AFO A;  5HH1 A;  1DE4 C;  4HNX B;  3V38 A;  4B5P A;  4P4E A;  4EVY A;  2EBJ A;  4MI4 A;  4QBJ A;  2WYR A;  4OAE A;  5G20 A;  2PIZ A;  1HDQ A;  1Y0Y A;  1Y7R A;  2QEC A;  2V8D A;  4LX9 A;  2PJ5 A;  4MMO A;  4UF4 A;  2DXQ A;  1CX8 A;  2AJ6 A;  2ZEE A;  2ZEP A;  4A32 A;  4MJ8 A;  1Z2L A;  1PCA A;  1XE4 A;  3SXN A;  4A39 A;  3B3S A;  3FF3 A;  4M6I A;  1B6B A;  1VGY A;  2IMO A;  3R1K A;  2XEJ A;  4CYN A;  2XEG A;  3CT9 A;  4KVM E;  4L8A A;  2PJ4 A;  4ZBG A;  4CAF A;  2VZY A;  4E0A A;  1BOB A;  4MCR A;  2OZH A;  3B7I A;  2PJ3 A;  3D8P A;  3TTH A;  2ZW7 A;  3FNC A;  2REE A;  4KOW A;  4PXE A;  3RO0 A;  5F09 A;  1CBX A;  8CPA A;  3SJE A;  2FT0 A;  1Z8L A;  2HC9 A;  5LRK A;  3VAT A;  3TOB A;  1YLO A;  2PVV A;  4G1P A;  4TWE A;  1TKH A;  1AYE A;  5JH9 A;  1UFH A;  4C68 A;  4YU9 A;  2QJ8 A;  2H5M A;  1I1D A;  2HUZ A;  3S6G A;  1IYL A;  4OC1 A;  5J8C A;  4UWJ A;  5DWM A;  1Y9W A;  5F49 A;  4IF5 A;  4CGL A;  4CYQ A;  3K2K A;  5F48 A;  2GRE A;  3QAH A;  2GU2 A;  4NJQ A;  3KQZ A;  3FEE A;  2PJA A;  4NGQ A;  1KWM A;  4XPL A;  3K9U A;  1I12 A;  2GIV A;  2V8G A;  3OWC A;  4CGN A;  5K8N A;  2ZW5 A;  4LUA A;  3LD2 A;  3GB0 A;  3SJX A;  3LOD A;  5BWA B;  1ZG7 A;  2B3V A;  4IUS A;  1M4L A;  2R7H A;  4UEF A;  4MBU A;  4OC3 A;  4OC5 A;  3TX8 A;  2D4P A;  2OU2 A;  5DWN A;  3K9T A;  4MFK A;  4ONW A;  1XJO A;  3GIU A;  2GE3 A;  2ZEF A;  1Q2D A;  3PB4 X;  3JUW A;  1BLL E;  2AFM A;  2JBK A;  1TXR A;  4CAW A;  2JLM A;  1TKF A;  1S7F A;  4BIN A;  1PUA A;  1VHS A;  2V8V A;  7CPA A;  2EWB A;  3I3G A;  4F0Y A;  4FD5 A;  1HEE A;  1TF9 A;  3GKR A;  2J8R A;  2JDD A;  3D7D A;  4KUA A;  5CNP A;  3QB8 A;  2CTB A;  1BO4 A;  1NSA A;  1FT7 A;  2PJ9 A;  2QIR A;  3RZA A;  3NE8 A;  1M1D A;  2PJC A;  2RC4 A;  5DS0 A;  2RFH A;  3FXT A;  1S5K A;  3RAM A;  3FJU A;  4OKO A;  4AVC A;  3JTK A;  1JQG A;  4DYO A;  2FIW A;  1F2P A;  1KUX A;  2OZU A;  4WWV A;  4NGP A;  2P6F A;  2Z10 A;  3R9F A;  2P6E A;  3DR8 A;  3VWD A;  2Q7S A;  2V77 A;  2A4N A;  4PK3 A;  3H8F A;  1XF8 A;  2JBJ A;  3IWE A;  3S6H A;  4DUK A;  2FSR A;  3NFZ A;  3W6X A;  3IC1 A;  3F0A A;  3KKW A;  2FS5 A;  3D2M A;  4KZT A;  3LAC A;  5ISV A;  1M4G A;  2CXA A;  4KLW A;  1IOF A;  2B3U A;  3B2Y A;  2FE7 A;  2I00 A;  2EVN A;  2AFW A;  2YND A;  2O53 A;  3BI0 A;  1TF8 A;  2ZPA A;  2PJ1 A;  1YRE A;  3IWW A;  3PZJ A;  4UCP A;  2YNC C;  4FD6 A;  3KHZ A;  3PBB A;  1IIC A;  3S9L A;  2QYV A;  2JEW A;  2BOA A;  4KOR A;  4FUU A;  4NJR A;  4CGM A;  4MHN A;  3ISX A;  4BD9 A;  1CPS A;  2VQY A;  3VWE A;  3KI9 A;  4MFL A;  1S60 A;  2Q51 A;  1PU9 A;  3ISZ A;  4R76 A;  3FH4 A;  1CM0 A;  3KR4 A;  2PJ7 A;  2C6C A;  5C82 A;  1P4N A;  1Q2Y A;  3H4Q A;  4Y49 B;  3IU2 A;  3BI1 A;  2D4O A;  3CPX A;  1X12 A;  3GUX A;  4MHD A;  4NGN A;  3R9E A;  2QVP A;  3HLP A;  3SJG A;  4PK2 A;  2HQY A;  1NMT A;  3E0K A;  4ZI6 A;  3TCV A;  1KZF A;  1ZLH A;  2CY2 A;  4B14 A;  1YK3 A;  2CNT A;  2PRB A;  3S6F A;  2ZEN A;  4B5P B;  3UY5 A;  3KL9 A;  4NF1 A;  2B4D B;  4R3K A;  1MJ9 A;  4YFJ A;  2DEA A;  3NH4 A;  1XRY A;  2ARH A;  3IEH A;  2HV2 A;  3LWU A;  2PJ0 A;  2PJ6 A;  4OAD A;  2I79 A;  4R6T A;  2VZZ A;  2B5G A;  1AUG A;  1V0C A;  3B35 A;  4GS4 A;  3QAY A;  1SQH A;  4KOT A;  2Z3M A;  4LQG A;  4Q7A A;  5C88 A;  3IU1 A;  4CYP A;  3EXN A;  5EC4 A;  4JD6 A;  4OLL A;  3TOA A;  4A37 A;  2P6G A;  4UIB A;  4KOY A;  3JRU A;  4OIW A;  3SI0 A;  1CPX A;  4F6A A;  4ZYQ A;  2VBQ A;  4IAV A;  1Y9K A;  2CTC A;  3TO6 A;  2OH1 A;  4EME A;  4KOX A;  1QQ9 A;  1GYT A;  3PEI A;  2F5I A;  4ZGY B;  1M4D A;  4OP4 A;  4B13 A;  3C26 A;  3EC4 A;  4JXQ A;  2Y0M A;  1QSM A;  1UWY A;  1MK4 A;  2G9D A;  3NA6 A;  1K4J A;  3NH5 A;  4QB9 A;  5H86 A;  3IFE A;  1ZLI A;  3L2N A;  2YNE A;  1MJA A;  2Z3P A;  4MCQ A;  4NCZ A;  2O4H A;  4ONU A;  2ZW6 A;  3KGQ A;  3EFA A;  1EE3 P;  2JDC A;  4KSF A;  3W6S A;  5JQ4 A;  1IGB A;  1F57 A;  4C7I A;  2Q43 A;  2AE6 A;  5LYI A;  1M44 A;  3BLN A;  4IK2 A;  5JM6 A;  4P4I A;  3R96 A;  1BPM A;  2OR4 A;  1YGH A;  4AXV A;  4Y49 C;  1XIX A;  4NGM A;  3DGV A;  4M6H A;  3D7H A;  4KSI A;  2B58 A;  4P44 A;  1XEB A;  2PR8 A;  5IB0 A;  1RO5 A;  3EO4 A;  3P2H A;  4MXU A;  2ZOG A;  2ZED A;  5JPH A;  4MFP A;  3TC8 A;  1ZG8 A;  5AGE A;  1WWZ A;  2Z3K A;  3MGD A;  3WC5 A;  1YW4 A;  2ZEL A;  4P4B A;  4MRI A;  3ZJ0 A;  1LFW A;  3D68 A;  2J8M A;  3DDD A;  1LCP A;  1QST A;  3IWG A;  2PCU A;  2PJB A;  4GM5 A;  4F0X A;  3V8I A;  4UWI A;  4PSX A;  1ELM P;  4XPK A;  2C6G A;  1RTQ A;  3FMC A;  3DNS A;  1Y0R A;  2PR1 A;  4C2Z A;  2ZXV A;  3BXM A;  4UEZ A;  5HVG A;  3GLJ A;  4UFW A;  4YRH A;  5F47 A;  4A94 A;  2NYQ A;  4HPS A;  1CP6 A;  1Q2C A;  1YVK A;  5I4M A;  2FVG A;  4HNW B;  2Q4V A;  1Z9U A;  4UBR A;  1KUV A;  4F9U A;  4AB7 A;  5J1Q A;  1GHE A;  2IJZ A;  2BEI A;  4WJB A;  1P0H A;  3R9G A;  1XMB A;  2ATR A;  4BBH A;  4JZ0 A;  3S6K A;  5ELY A;  1BAV A;  3A9L A;  1ZG9 A;  2OB0 A;  4YWY A;  3TO9 A;  4P45 A;  2O28 A;  4CAE A;  1VKC A;  2J9A A;  3B3C A;  2PDO A;  3SXO A;  3D3S A;  2BO9 A;  4PXD A;  1X10 A;  5LYL A;  2NMT A;  1OBR A;  4RUH A;  4L89 A;  4J3G A;  4XNH B;  1Z4R A;  4JXR A;  4A31 A;  1N71 A;  5D29 A;  1YR0 A;  1IU8 A;  3TT2 A;  4NGR A;  3LMS A;  4AG9 A;  3CXS A;  4FAI A;  4CAV A;  1L0C A;  3MN8 A;  5AG4 A;  2VXK A;  2GLJ A;  5D8N A;  3FYN A;  2ANP A;  5KTA A;  4PPZ A;  1ARL A;  5G21 A;  3G8W A;  3FIX A;  3PP9 A;  4H89 A;  4MY0 A;  2PVW A;  4NSQ A;  5K8O A;  2X7B A;  2VI7 A;  1TIQ A;  4KUB A;  3GYA A;  3RNZ A;  1YLE A;  3CPA A;  1H8L A;  4AG7 A;  1ARM A;  4MFQ A;  4NEX A;  1KUY A;  1LAN A;  4PXB A;  4OID A;  3HUV A;  4TNU A;  5G22 A;  3PFO A;  4C7H A;  1J4J A;  4R8F A;  1OZP A;  3FRM A;  1Q7L A;  1YQE A;  5LRJ A;  3SHP A;  3QNV A;  5CBM A;  4UFV A;  5H84 A;  1R43 A;  2PSW A;  3D4U A;  3WT4 A;  2B5G B;  3I1U A;  4QUS A;  2PIY A;  1Z4E A;  1CP7 A;  1A2Z A;  4IHM A;  1AMP A;  1DTD A;  1CG2 A;  2IQ6 A;  2WPX A;  4MHZ A;  4P4D A;  3RBU A;  4NXY A;  4LQ6 A;  4UFX A;  2CNM A;  2NSM A;  3BJ7 A;  5CPA A;  5JGF A;  5AG7 A;  2G3T A;  3BHX A;  1LOK A;  2DF5 A;  2BCO A;  5EMI A;  4PV6 A;  4NGT A;  3KQX A;  3T8W A;  5HXD A;  3R95 A;  4QVT A;  2CIJ A;  3FED A;  3NH8 A;  4ORF A;  2Q4Y A;  4CYO A;  4PQA A;  4R7M A;  1ELL P;  4CGO A;  4PSW A;  2K5T A;  2QML A;  4K3N A;  4MCP A;  5A28 A;  5A27 A;  5GCN A;  4P10 A;  1JWQ A;  2HB6 A;  4U5Y A;  4R9M A;  3KHX A;  3V7Z A;  4EWT A;  4UCM A;  2FIA A;  2OOT A;  2AFZ A;  2AFX A;  3I9S A;  2Q7B A;  1IY7 A;  1F2O A;  2F8H A;  2Z3N A;  1NE9 A;  2CF4 A;  3D7G A;  2DPT A;  4FWU A;  4KOV A;  4X5K A;  4NGS A;  1B87 A;  2BSW A;  2B4D A;  2IL4 A;  4KS9 A;  2PC1 A;  4P4J A;  5J8F A;  4JWP A;  1Z8W A;  2RB7 A;  4E8O A;  2ZOF A;  2C6P A;  3B3W A;  4R57 A;  3FVL A;  1S7N A;  4Z65 A;  2R1I A;  2XEI A;  2PE3 A;  4ZX8 A;  2WZN A;  4B11 A;  1RXT A;  1HDU A;  3DR6 A;  3D7F A;  4OME A;  1WK4 A;  3WC6 A;  1XFO A;  4MHY A;  1YX0 A;  3G3S A;  1IOI A;  1S3Z A;  2V8H A;  2EUI A;  5IV0 A;  1YME A;  4H6U A;  5LYD A;  2JEV A;  4B5O A;  5KTC A;  1Z5R A;  1YVO A;  1YW6 A;  4JYW A;  4Q36 A;  2ZEO A;  4YGO A;  3KAS A;  2B4B A;  1M4I A;  4ZX9 A;  4ZY2 A;  3FBU A;  4B12 A;  2GLF A;  3B3V A;  1IID A;  3IGR A;  3PRT A;  1LRZ A;  4M3S A;  2G3A A;  4MY3 A;  4EFD A;  3P2F A;  4CRY B;  4P6Y A;  4UA3 A;  4U9Y A;  3DSB A;  1MJB A;  4UEE A;  2WPW A;  2AFU A;  4R3L A;  1XBU A;  1U6M A;  2R8V A;  1YSJ A;  2Q4Z A;  3SI2 A;  4FBE A;  4C2X A;  3SI1 A;  3MRU A;  4A38 A;  4II9 A;  2XEF A;  2Z3O A;  3EY5 A;  4K30 A;  4QC6 A;  1ZO0 A;  2FXF A;  2J8N A;  2VEZ A;  5AG6 A;  3FEC A;  2FCK A;  2ZEM A;  2YGW A;  4KOS A;  3B3T A;  4KSA A;  4B10 A;  1Y7E A;  2Z3L A;  3WR7 A;  5LYF A;  3D66 A;  4C2Y A;  3PGP A;  5EBV A;  4BMH A;  4CGP A;  1CJW A;  1TKJ A;  2WUU A;  2Q0Y A;  1PYT B;  5F46 A;  2KCW A;  2C27 A;  2ZEG A;  3DLJ A;  5I0C A;  4PXC A;  2DPS A;  4UCN A;  3S9M A;  2EK8 A;  2GAN A;  4ZY1 A;  5FVJ A;  4AVA A;  4OC4 A;  4F8Z A;  1QSR A;  1Z8T A;  4O23 A;  4F9V A;  4RS2 A;  4H2K A;  3IJ3 A;  5LRG A;  5AG5 A;  2BL1 A;  4JLY A;  4MHP A;  4DNC A;  1QMU A;  2PRQ A;  1LAM A;  5THW A;  2POK A;  3SJF A;  3CXQ A;  3FB3 A;  3WC7 A;  1VIX A;  6CPA A;  1IB1 E;  2PQ8 A;  1XOV A;  3JVN A;  4X2T A;  1QSO A;  2GFQ A;  1R3N A;  4P4F A;  3VAR A;  1QSN A;  2FL4 A;  3D67 A;  3N5F A;  3PB9 X;  4XPD B;  3PBE A;  5KTD A;  3CXP A;  5K8P A;  4XPD C;  3TFY A;  4MFZ A;  1LAP A;  5E96 A;  4KVO E;  2EO8 A;  5G1Z A;  3IIB A;  4CAX A;  3GY9 A; 
#chains in the Genus database with same CATH homology
 2WSA A;  3NE7 A;  4JJX A;  4A95 A;  4FD4 A;  1S7K A;  4MFJ A;  4I49 A;  4A33 A;  2YNC A;  3B8G A;  1S7L A;  4E2A A;  2R98 A;  1I21 A;  4XNH C;  3F5B A;  2P0W A;  3H5Z A;  4AVB A;  4U9Z A;  2G0B A;  1XMT A;  2Z11 A;  1FY7 A;  4A2Z A;  2CNS A;  3W91 A;  1R57 A;  4FD7 A;  2REF A;  4KLV A;  4RI1 A;  4Q38 A;  3TO7 A;  4M85 A;  5IX3 A;  4HKF A;  4A30 A;  4CS0 B;  4KVX A;  4H6Z A;  3F8K A;  1ON0 A;  4HNY B;  2Z0Z A;  3RYO A;  2OZG A;  4CRZ B;  3N7Z A;  3D2P A;  2Q04 A;  3T9Y A;  1IYK A;  2BUE A;  4KOU A;  2Q44 A;  1NSL A;  4R87 A;  2ZW4 A;  5HMN A;  3ZZI A;  3T90 A;  3BJ8 A;  4EVY A;  5HH1 A;  4HNX B;  4B5P A;  4MI4 A;  4QBJ A;  5G20 A;  4OAE A;  2QEC A;  1Y7R A;  4LX9 A;  2DXQ A;  2AJ6 A;  4A32 A;  4MJ8 A;  1XE4 A;  3SXN A;  1B6B A;  3R1K A;  4CYN A;  4L8A A;  4KVM E;  4CAF A;  4ZBG A;  2VZY A;  4E0A A;  1BOB A;  2OZH A;  3D8P A;  3TTH A;  2ZW7 A;  3FNC A;  2REE A;  4KOW A;  2FT0 A;  3TOB A;  1UFH A;  4C68 A;  2H5M A;  1I1D A;  2HUZ A;  3S6G A;  1IYL A;  5J8C A;  4UWJ A;  5DWM A;  1Y9W A;  5F49 A;  4IF5 A;  4CGL A;  4CYQ A;  5F48 A;  3QAH A;  4XPL A;  1I12 A;  2GIV A;  3OWC A;  4CGN A;  2ZW5 A;  4LUA A;  3LD2 A;  3LOD A;  5BWA B;  2B3V A;  4IUS A;  2R7H A;  4MBU A;  2D4P A;  2OU2 A;  5DWN A;  4MFK A;  2GE3 A;  1Q2D A;  3JUW A;  4CAW A;  2JLM A;  1S7F A;  1PUA A;  1VHS A;  3I3G A;  4F0Y A;  4FD5 A;  3GKR A;  2J8R A;  2JDD A;  4KUA A;  5CNP A;  3QB8 A;  1BO4 A;  2QIR A;  1M1D A;  2RC4 A;  3FXT A;  1S5K A;  4AVC A;  3JTK A;  2FIW A;  1KUX A;  2OZU A;  2P6F A;  2Z10 A;  3R9F A;  2P6E A;  3DR8 A;  3VWD A;  2A4N A;  4PK3 A;  1XF8 A;  3IWE A;  3S6H A;  2FSR A;  3W6X A;  3F0A A;  3KKW A;  2FS5 A;  3D2M A;  4KZT A;  5ISV A;  1M4G A;  2CXA A;  4KLW A;  2B3U A;  2FE7 A;  2I00 A;  2EVN A;  2YND A;  3PZJ A;  2ZPA A;  4UCP A;  1YRE A;  2YNC C;  4FD6 A;  1IIC A;  4KOR A;  4CGM A;  2VQY A;  3VWE A;  4MFL A;  1S60 A;  1PU9 A;  1CM0 A;  5C82 A;  1P4N A;  1Q2Y A;  3H4Q A;  4Y49 B;  3IU2 A;  2D4O A;  4MHD A;  3R9E A;  4PK2 A;  2HQY A;  1NMT A;  3E0K A;  3TCV A;  1KZF A;  2CY2 A;  4B14 A;  1YK3 A;  2CNT A;  2PRB A;  3S6F A;  4B5P B;  3UY5 A;  4NF1 A;  2B4D B;  4R3K A;  1MJ9 A;  4YFJ A;  2ARH A;  2HV2 A;  4OAD A;  2I79 A;  2VZZ A;  2B5G A;  1V0C A;  4GS4 A;  4KOT A;  1SQH A;  2Z3M A;  5C88 A;  3IU1 A;  4CYP A;  3EXN A;  5EC4 A;  4JD6 A;  4OLL A;  3TOA A;  2P6G A;  4KOY A;  4F6A A;  2VBQ A;  1Y9K A;  3TO6 A;  2OH1 A;  4KOX A;  2F5I A;  4ZGY B;  1M4D A;  4B13 A;  3C26 A;  3EC4 A;  4JXQ A;  2Y0M A;  1QSM A;  1MK4 A;  4QB9 A;  1K4J A;  5H86 A;  2YNE A;  1MJA A;  2Z3P A;  4ONU A;  4NCZ A;  2ZW6 A;  3EFA A;  4KSF A;  2JDC A;  3W6S A;  5JQ4 A;  4C7I A;  2AE6 A;  1M44 A;  3BLN A;  3R96 A;  1YGH A;  4Y49 C;  1XIX A;  2B58 A;  1XEB A;  2PR8 A;  1RO5 A;  3EO4 A;  3P2H A;  4MFP A;  5AGE A;  1WWZ A;  2Z3K A;  3MGD A;  3ZJ0 A;  2J8M A;  3DDD A;  1QST A;  3IWG A;  4F0X A;  3V8I A;  4UWI A;  4PSX A;  4XPK A;  3DNS A;  2PR1 A;  4C2Z A;  2ZXV A;  4UFW A;  4YRH A;  5F47 A;  1Q2C A;  1YVK A;  4HNW B;  2Q4V A;  1Z9U A;  4UBR A;  1KUV A;  4AB7 A;  1GHE A;  2BEI A;  1P0H A;  3R9G A;  2ATR A;  4BBH A;  3S6K A;  3A9L A;  2OB0 A;  3TO9 A;  2O28 A;  4CAE A;  1VKC A;  2PDO A;  3SXO A;  3D3S A;  2NMT A;  4L89 A;  4J3G A;  4XNH B;  1Z4R A;  4JXR A;  4A31 A;  1N71 A;  1YR0 A;  3TT2 A;  4AG9 A;  3CXS A;  4CAV A;  1L0C A;  5AG4 A;  2VXK A;  5KTA A;  3FYN A;  5G21 A;  3G8W A;  3FIX A;  3PP9 A;  4H89 A;  4MY0 A;  4NSQ A;  2X7B A;  2VI7 A;  1TIQ A;  4KUB A;  3GYA A;  1YLE A;  4AG7 A;  4MFQ A;  4NEX A;  1KUY A;  5G22 A;  4C7H A;  1J4J A;  1OZP A;  3FRM A;  3SHP A;  4UFV A;  5H84 A;  2PSW A;  2B5G B;  5IB0 A;  4QUS A;  1Z4E A;  5JPH A;  3TE4 A;  2WPX A;  4NXY A;  4UFX A;  2CNM A;  3BJ7 A;  5AG7 A;  2G3T A;  4PV6 A;  3R95 A;  4QVT A;  4ORF A;  2Q4Y A;  4CYO A;  4CGO A;  4PSW A;  2K5T A;  2QML A;  5A28 A;  5A27 A;  5GCN A;  4U5Y A;  4R9M A;  4UCM A;  2FIA A;  2Q7B A;  3I9S A;  2Z3N A;  1NE9 A;  4KOV A;  2DPT A;  4X5K A;  1B87 A;  2BSW A;  2B4D A;  2IL4 A;  4KS9 A;  2PC1 A;  5J8F A;  4JWP A;  4E8O A;  4R57 A;  1S7N A;  2R1I A;  4B11 A;  1RXT A;  3DR6 A;  1WK4 A;  1YX0 A;  3G3S A;  1S3Z A;  2EUI A;  5IV0 A;  4H6U A;  4B5O A;  5KTC A;  2JEV A;  1YVO A;  4Q36 A;  4YGO A;  2B4B A;  1M4I A;  3FBU A;  4B12 A;  1IID A;  3IGR A;  4M3S A;  1LRZ A;  2G3A A;  4MY3 A;  3P2F A;  4CRY B;  4UA3 A;  4U9Y A;  3DSB A;  1MJB A;  2WPW A;  4R3L A;  1U6M A;  2R8V A;  4C2X A;  4II9 A;  2Z3O A;  3EY5 A;  4K30 A;  4QC6 A;  1ZO0 A;  2FXF A;  2J8N A;  2VEZ A;  5AG6 A;  2FCK A;  4KOS A;  2YGW A;  4B10 A;  4KSA A;  2Z3L A;  3WR7 A;  4C2Y A;  3PGP A;  5EBV A;  4BMH A;  4CGP A;  1CJW A;  2WUU A;  2Q0Y A;  5F46 A;  2KCW A;  2C27 A;  5I0C A;  2DPS A;  4UCN A;  2GAN A;  5FVJ A;  4AVA A;  1QSR A;  4RS2 A;  5AG5 A;  2BL1 A;  4JLY A;  4DNC A;  3CXQ A;  3FB3 A;  1IB1 E;  2PQ8 A;  3JVN A;  1QSO A;  1QSN A;  2FL4 A;  4XPD B;  5KTD A;  3CXP A;  4XPD C;  3TFY A;  4MFZ A;  5E96 A;  4KVO E;  5G1Z A;  3GY9 A;  4CAX A;  3K9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...