4NF1A

Structure of n-acetyltransferase domain of x. fastidiosa nags/k without his-tag
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
146
structure length
146
Chain Sequence
b'VIRATTWKDLDLPRLQHLIQSSFRRTLIPHYFETTPLLRAYVSENYRAAVILTKLGNVPYLDKFAVLDDAQGEGLGRAVWSIMREETPQLFWRSRHNNQANAFYYAESDGYYKQDHWKIFWNGLHHFQQIQQCVAHCTQHPPTLID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Acetylglutamate kinase
publication title Structures of the N-acetyltransferase domain of Xylella fastidiosaN-acetyl-L-glutamate synthase/kinase with and without a His tag bound to N-acetyl-L-glutamate.
pubmed doi rcsb
source organism Xylella fastidiosa temecula1
molecule tags Transferase
total genus 48
structure length 146
sequence length 146
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.2.8: Acetylglutamate kinase.
pdb deposition date 2013-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4nf1A00
4AVAA 3FB3A 5HMNA 3EO4A 4PK3A 4KUBA 1MJAA 4I49A 1YREA 2FL4A 4MI4A 3IWGA 4HNXB 4CAXA 4JWPA 2R8VA 3DR6A 1RXTA 4YRHA 4U9ZA 5JQ4A 1M1DA 1S5KA 1XIXA 1B6BA 4KOSA 4YGOA 2PDOA 3R9GA 3F5BA 4FD6A 2JEVA 2OH1A 4XNHB 5JPHA 2A4NA 5C82A 1YR0A 3EXNA 1YLEA 5KTDA 2Z11A 4KLWA 3S6KA 1S7FA 4XPLA 3LD2A 1ON0A 1YGHA 2FXFA 1U6MA 4KORA 4KOWA 4H6ZA 2R1IA 1J4JA 2Q0YA 3I9SA 3DDDA 1NE9A 3EY5A 1M4IA 2NMTA 2OZGA 5F48A 1UFHA 4YFJA 3KKWA 3TTHA 4B5OA 1XEBA 4KOXA 1V0CA 3UY5A 4MY3A 3G3SA 2ZW7A 1S7LA 2O28A 2PR8A 2VZYA 2B4BA 2P6GA 3TOAA 4R9MA 2B5GB 3TT2A 1IYLA 2Q04A 4UA3A 1K4JA 1NMTA 2JDDA 4UWJA 1R57A 1L0CA 2FIWA 2R98A 4LX9A 3R96A 3FXTA 3GKRA 4XNHC 5HH1A 2GANA 1QSOA 4KVOE 2REFA 3C26A 2PR1A 4KUAA 1WK4A 3R1KA 4Y49B 2BSWA 1P4NA 1M4GA 3VWDA 3RYOA 2CNSA 4BMHA 4UWIA 4E8OA 2G3AA 4CS0B 4IUSA 2OZHA 5F46A 3F8KA 1YX0A 3TCVA 2J8NA 1CJWA 2B4DA 5FVJA 3T9YA 2G3TA 2Q4VA 3GY9A 5J8CA 1Z9UA 3CXQA 3S6GA 3CXPA 2VQYA 2GIVA 5H84A 4RI1A 1I1DA 4QC6A 4AG7A 2KCWA 3ZZIA 1B87A 1GHEA 2PRBA 4KZTA 1WWZA 2ZW4A 1PU9A 1Q2CA 2IL4A 4R87A 4E0AA 1KZFA 2R7HA 2VXKA 2REEA 1QSTA 2BL1A 4KOTA 2HUZA 3S6HA 4AVCA 2B3VA 4KVXA 4Y49C 4AB7A 3D3SA 2VZZA 1YVKA 3R95A 1XF8A 3I3GA 2PC1A 2CNTA 2P0WA 2PQ8A 5EBVA 1KUXA 2BUEA 4F0YA 2WPXA 2F5IA 3R9EA 5F49A 2ZW6A 3GYAA 1M4DA 3SHPA 4E2AA 2QIRA 2Z10A 1QSMA 1XE4A 1CM0A 4MY0A 4PSWA 2PSWA 1MJBA 3R9FA 2CY2A 5E96A 4KOUA 4QBJA 4QVTA 3WR7A 3BJ7A 4U9YA 2OU2A 2P6EA 4KVME 3TE4A 2VI7A 1IYKA 4IF5A 4NF1A 4H6UA 2HV2A 2B4DB 1S7NA 2AE6A 4JLYA 5IX3A 4PV6A 3NE7A 4QUSA 3G8WA 5IV0A 3H4QA 3TO6A 3T90A 2QMLA 3FYNA 1RO5A 2J8RA 2OB0A 2FCKA 1IICA 1S3ZA 5DWNA 2ZXVA 4CAVA 3D8PA 5H86A 2JDCA 2ZW5A 1IB1E 1VKCA 3QB8A 5IB0A 4B5PA 2EUIA 5KTAA 4L8AA 4NEXA 2QECA 2BEIA 4RS2A 4ORFA 4ONUA 2D4OA 1KUYA 3EFAA 1Y9KA 4M3SA 3EC4A 3PP9A 4MHDA 1NSLA 4R3LA 3FRMA 1Y9WA 3LODA 2J8MA 4H89A 4XPKA 1QSNA 3N7ZA 4JJXA 2C27A 3TO9A 3TO7A 3FIXA 2X7BA 2VEZA 1Q2DA 4CRZB 2DXQA 3W6XA 4M85A 4OAEA 5EC4A 4PK2A 3D2MA 3OWCA 4MJ8A 1S60A 2JLMA 4GS4A 1BO4A 1N71A 4F6AA 4KOVA 2FSRA 4KLVA 4K30A 3FNCA 3V8IA 1I21A 3JUWA 1VHSA 1BOBA 5I0CA 1YK3A 4X5KA 4JXQA 2WPWA 2K5TA 1MK4A 2CNMA 2FIAA 2ARHA 3PGPA 3IGRA 4LUAA 3F0AA 4NSQA 4ZBGA 2I79A 5F47A 3K9UA 2AJ6A 2RC4A 4R57A 2Q4YA 2FT0A 4NXYA 5J8FA 2GE3A 1QSRA 1IIDA 1Y7RA 4II9A 1KUVA 1OZPA 5DWMA 5ISVA 4XPDB 3JVNA 4HKFA 4NCZA 4B5PB 1XMTA 2B3UA 1Z4EA 3QAHA 4MBUA 2Q44A 2I00A 2FE7A 4HNYB 3P2HA 3S6FA 1Q2YA 2HQYA 3TFYA 2Z0ZA 5C88A 3BJ8A 4EVYA 1M44A 2ZPAA 1P0HA 4AG9A 2H5MA 4FD4A 1PUAA 2Y0MA 3BLNA 4CRYB 4DNCA 1TIQA 3SXNA 4PSXA 3DNSA 3ZJ0A 4AVBA 3D2PA 5GCNA 2Q7BA 5KTCA 4OLLA 1LRZA 3P2FA 4HNWB 4FD7A 3MGDA 2P6FA 2B5GA 3PZJA 1MJ9A 4FD5A 2FS5A 3W6SA 1S7KA 4L89A 2D4PA 4R3KA 3B8GA 2B58A 4U5YA 1YVOA 4XPDC 2EVNA 3TOBA 3FBUA 3CXSA 3DSBA 3VWEA 2OZUA 3E0KA 4UBRA 1Z4RA 4CAWA 5CNPA 2G0BA 4QB9A 1SQHA 4KOYA 4J3GA 2ATRA 4OADA 4JD6A 3W91A 3SXOA 4JXRA 1FY7A 1I12A 2VBQA 3DR8A
chains in the Genus database with same CATH superfamily
4AVAA 2DPTA 3FB3A 5HMNA 2Q4ZA 3S9NA 1VGYA 3EO4A 4PK3A 4KUBA 1MJAA 5THWA 4I49A 1YREA 2FL4A 4MI4A 3IWGA 4HNXB 4CAXA 4KS9A 4JWPA 4F8ZA 3JRUA 2R8VA 1Y0RA 3DR6A 1RXTA 2PJBA 2AFWA 4Q36A 4YRHA 4U9ZA 5JQ4A 1M1DA 1S5KA 1XIXA 2NYQA 1B6BA 4KOSA 1BPMA 3RAMA 4CAFA 4YGOA 4MHPA 4JZ0A 2PDOA 4PPZA 3IEHA 3R9GA 1X10A 3F5BA 4FD6A 2JEVA 2OH1A 4XNHB 4DJLA 5JPHA 4A33A 4OC2A 2O53A 2PJ6A 3B3SA 2A4NA 5C82A 1YR0A 2DEAA 2ZEGA 3EXNA 5G22A 1YLEA 4CGOA 2Z11A 5KTDA 4KLWA 3QAYA 1HEEA 3S6KA 1DE4C 4MFKA 1S7FA 5HVFA 4XPLA 2DPSA 4CYNA 3H8EA 1CX8A 4BD9A 3RO0A 1TF8A 3LD2A 4HPSA 1ON0A 5BWAB 2JBKA 3WC7A 1YGHA 2FXFA 5HVHA 1U6MA 4R7MA 4KORA 2IMOA 4KOWA 4H6ZA 2R1IA 3QNVA 1J4JA 2Q0YA 2QYVA 3DDDA 1NE9A 3EY5A 1UWYA 3I9SA 1M4IA 2NMTA 5IB9A 2OZGA 5F48A 1UFHA 2Z3KA 4YFJA 3KKWA 3TTHA 4B5OA 1ZG9A 2POKA 5G21A 1XEBA 4KOXA 4B10A 1V0CA 5I4MA 3V38A 4ZY0A 2EK9A 3ISXA 3UY5A 2PJ8A 8CPAA 4MY3A 1Z8TA 3G3SA 2AFSA 2ZW7A 1S7LA 5F09A 3FH4A 2AFZA 4DYOA 2O28A 2PR8A 3LACA 2VZYA 2B4BA 2Q7SA 4MCSA 2WSAA 2P6GA 3TOAA 1R43A 4R9MA 1H8LA 4EFDA 2B5GB 4UIAA 5ELYA 3TT2A 1IYLA 4F0XA 2Q04A 4UA3A 1K4JA 1IU8A 1NMTA 1VHOA 4H2KA 1CPSA 2JDDA 4UFXA 1Q7LA 4ZX9A 4UWJA 1R57A 4OC1A 1TXRA 2PJ9A 2ODFA 4A2ZA 4C68A 1L0CA 2FIWA 4EMEA 1NSAA 2CIJA 3IIBA 3KZWA 2R98A 3D67A 4LX9A 4UFWA 3FXTA 3KASA 3NFZA 3R96A 4B11A 3GKRA 4XNHC 4BINA 4CYOA 1ELMP 5HH1A 2GANA 1QSOA 2XEJA 4KVOE 2IQ6A 2REFA 4MCQA 3C26A 2ANPA 4B14A 1TKFA 2PR1A 3PB6X 1F2OA 2ZEEA 2FVGA 5CPAA 3FVLA 4KUAA 1WK4A 2GFQA 2PJ7A 4OIWA 4A95A 3R1KA 3B7IA 4Y49B 4W9YA 2BSWA 2JEWA 1P4NA 1M4GA 3VWDA 4MHYA 3RYOA 2CNSA 2O4HA 3JTKA 4NGRA 5D8NA 4UWIA 4BMHA 4E8OA 2G3AA 3FF3A 4CYQA 4CS0B 4IUSA 3KR4A 4M6HA 2YNDA 4P10A 5EMIA 4GM5A 2OZHA 5F46A 2GU2A 3LWUA 4JYWA 3F8KA 1QMUA 3T8WA 1YX0A 1LOKA 2J8NA 3TCVA 4GXHA 1CJWA 2ZEHA 2B4DA 5G20A 5FVJA 3T9YA 3S9MA 5HXDA 4KSAA 2G3TA 2Q4VA 3GY9A 5J8CA 3DLJA 1Z9UA 3CXQA 2CF4A 3S6GA 3CXPA 5D29A 1ZLIA 2PJ1A 2VQYA 4M6IA 2GIVA 2PJ4A 5H84A 4OC5A 2GLFA 4RI1A 4X2TA 1ARMA 4CAEA 1I1DA 5AGEA 4QC6A 2ZEMA 1VHEA 4AG7A 2KCWA 2GLJA 3FX6A 4NGPA 4PXCA 3ZZIA 1B87A 1GHEA 2PRBA 3KQZA 4KZTA 1WWZA 2ZW4A 1PU9A 2RB7A 2WYRA 1F2PA 4A37A 4IK2A 1Q2CA 4P4BA 2IL4A 1XFOA 4R87A 1XOVA 4TNUA 4E0AA 3B35A 3SI1A 5LYLA 1ZG7A 1KZFA 3SJEA 2R7HA 2VXKA 2REEA 1QSTA 4MFQA 4F9UA 2BL1A 3SI0A 1BLLE 4B12A 4B6ZA 3VH9A 2XEGA 2IJZA 2HUZA 4KOTA 3S6HA 4AVCA 4F9VA 5AG4A 2CXAA 2B3VA 4KVXA 4Y49C 1X12A 4AB7A 3D3SA 3TX8A 1YQEA 2VZZA 4RN7A 1YVKA 1JWQA 4LQGA 7CPAA 3R95A 1XF8A 3I3GA 2PC1A 2EBJA 4C7IA 1IOIA 2CNTA 2P0WA 2DF5A 2PQ8A 3RZAA 4CPAA 5EBVA 1KUXA 2QJ8A 2BUEA 4F0YA 2WPXA 3NH4A 1HDUA 2PJAA 2F5IA 3HLPA 3R9EA 3FMCA 4PXEA 3I1UA 3CPAA 1YSJA 3GLJA 5F49A 2V8GA 3PFOA 2ZW6A 3GYAA 2J9AA 3GB0A 2WZNA 3PB4X 1M4DA 4MFJA 2YNCA 4ZI6A 3GUXA 4OC4A 3VATA 3SHPA 2V8DA 3B3CA 4E2AA 3CZXA 2QIRA 4WWVA 2ZEOA 2Z10A 1QSMA 1BPNA 4CGMA 1PCAA 3D7DA 1XE4A 1CM0A 4MY0A 3IWWA 3IC1A 1CP7A 1Z8LA 2PSWA 4PSWA 4P6YA 3PRTA 1MJBA 2EWBA 3R9FA 2CY2A 1XBUA 5E96A 5A28A 3L2NA 3PB7X 4KOUA 4QBJA 5K8OA 3D4UA 1TKJA 5JGFA 4QVTA 4R8FA 3WR7A 2BCOA 2C1CA 2ZENA 3BJ7A 4NGTA 3K2KA 2V77A 3RNZA 4U9YA 2OU2A 2P6EA 1HDQA 4KVME 3TE4A 2VI7A 1IYKA 2BOAA 4IF5A 1XMBA 4MFLA 4NF1A 4H6UA 2HV2A 2B4DB 3B3TA 3KL9A 1S7NA 2HB6A 4P4DA 2AE6A 1QQ9A 1IOFA 4JLYA 3WC5A 5IX3A 1EE3P 4P45A 4PV6A 3NE7A 4QUSA 3G8WA 4OC3A 3HUVA 5IV0A 3H4QA 4FUUA 3T90A 3TO6A 3PFEA 2QMLA 1CPXA 3FECA 3FYNA 4MFZA 1RO5A 2Z3LA 4RUHA 4X8IA 2PJ2A 2J8RA 2OB0A 2FCKA 3PBBA 4P4JA 1IICA 1A2ZA 1S3ZA 2ZEPA 4UCMA 3MRUA 4MRIA 2ZXVA 5DWNA 4A39A 4CAVA 3LMSA 3D8PA 1FT7A 5H86A 3BXMA 2JDCA 3SI2A 2ZW5A 5AG7A 1IB1E 1VKCA 4C2YA 2YNEA 3CDXA 5JM6A 3QB8A 5IB0A 1IGBA 4B5PA 2EUIA 5KTAA 4L8AA 4NEXA 1YMEA 3NE8A 2QECA 5LYFA 2BEIA 4RS2A 4ORFA 4ONUA 2D4OA 1KUYA 1LAPA 1Y9KA 1BAVA 1Y7EA 3EFAA 4LQ6A 4K3NA 4M3SA 3EC4A 3PP9A 4MHDA 1NSLA 4R3LA 4UCNA 3FRMA 1Y9WA 3PB8X 3B3WA 4CGPA 1AMPA 2AFUA 3LODA 4C7HA 3ISZA 2J8MA 4PXBA 3FEDA 6CPAA 2VL1A 1Z5RA 4H89A 4XPKA 2Z3PA 2I3CA 2OR4A 2YGWA 1QSNA 4MFPA 4UFVA 3N7ZA 4JJXA 2C27A 5LRGA 3TO9A 4C2XA 3WC6A 3H5ZA 1ZLHA 3H8FA 4R6TA 3FIXA 2Z3OA 2X7BA 3TO7A 3VARA 4UF4A 2EK8A 2VEZA 5J1QA 3NH8A 1Q2DA 1OBRA 2PJ0A 4CRZB 2DXQA 3W6XA 2EO8A 4M85A 4FAIA 4OAEA 5EC4A 1YLOA 4PK2A 3BI1A 4A32A 3D2MA 3OWCA 4MHZA 4MJ8A 1S60A 2JLMA 3D7FA 4GS4A 4NGMA 5K8NA 4M6GA 4ZY2A 1Z8XA 2ZOGA 1BO4A 5LYIA 1N71A 4F6AA 4KOVA 5G1ZA 2FSRA 4C2ZA 4UEFA 3D68A 2QVPA 2XEIA 2C6PA 4KLVA 3A9LA 3NA6A 3DGVA 3PB9X 1CP6A 4K30A 4A30A 4P4FA 2CTBA 2Q43A 3FNCA 3V8IA 5LYDA 4FBEA 1I21A 3MN8A 3N5FA 4YU9A 3JUWA 3CPXA 1ZO0A 4UEZA 1VHSA 4MCPA 1BOBA 5I0CA 1YK3A 1PYTB 4X5KA 5K8MA 1VIXA 2CTCA 5A27A 5DS0A 4UEEA 5AG6A 3B2YA 4JXQA 5AG5A 2WPWA 2K5TA 1MK4A 1ZG8A 2CNMA 2JBJA 4P4EA 1LFWA 4O23A 4UCPA 2FIAA 2ARHA 3PGPA 3IGRA 4LUAA 1GYTA 3WT4A 3FEEA 4ZX8A 3F0AA 4NSQA 3SJGA 4ZBGA 4A38A 4FWUA 2PVVA 2I79A 1TF9A 1DTDA 4Z65A 2V8HA 5F47A 1FNOA 3K9UA 2AJ6A 4BBHA 2GREA 2RC4A 2C6GA 4Q7AA 2OOTA 4R57A 1CBXA 1AYEA 2Q4YA 1Z8WA 5HVGA 2FT0A 4NXYA 5J8FA 3KHZA 2GE3A 1QSRA 1IIDA 3CT9A 3K9TA 2ZEDA 1Y7RA 2PIYA 2ZEFA 4UIBA 4WJBA 4II9A 3BHXA 2BO9A 4ZY1A 1JQGA 4NGSA 1KUVA 3FJUA 1XJOA 1OZPA 4TWEA 4KSIA 5DWMA 4CGNA 4OMEA 5ISVA 4XPDB 2PJ5A 4MHNA 3JVNA 1IY7A 2YNCC 4HKFA 4NCZA 3TC8A 1LAMA 4B5PB 1XMTA 1KWMA 2PVWA 3GIUA 2B3UA 1Z4EA 2PJ3A 2RFHA 2AFOA 5LRJA 4NGNA 3S9LA 3QAHA 4MBUA 2Q44A 3D66A 4ZYQA 2I00A 2G9DA 2FE7A 3BI0A 3P2HA 4HNYB 4ONWA 1RTQA 3S6FA 1CG2A 1Q2YA 2ABZA 2C6CA 4PQAA 2HQYA 2ZELA 4NGQA 3TFYA 3IU2A 2Z0ZA 4MMOA 2PRQA 3KI9A 5C88A 3BJ8A 3IWEA 4YWYA 4AXVA 4EVYA 5CBMA 1YW4A 2F8HA 3KQXA 1M44A 2ZPAA 5LRKA 1P0HA 3IO1A 4AG9A 2H5MA 2PJCA 4FD4A 1R3NA 3NH5A 4P4IA 5JH9A 1F57A 3B3VA 3D7HA 1PUAA 2Y0MA 2Q51A 3BLNA 4CRYB 4IHMA 4DNCA 2PCUA 1TIQA 3SXNA 4PSXA 4OP4A 3DNSA 2AFMA 3ZJ0A 2PIZA 4AVBA 3D2PA 3H8GA 5GCNA 1YW6A 2Q7BA 4OLLA 5KTCA 1LRZA 4Q38A 5K8PA 4A94A 3V7ZA 3P2FA 4HNWB 3IFEA 4EWTA 3MGDA 4FD7A 2PE3A 2P6FA 2B5GA 3PZJA 1XRYA 1MJ9A 2ZOFA 4FD5A 2FS5A 3W6SA 1S7KA 4L89A 3WABA 4OKOA 3KGQA 4MXUA 4OC0A 2D4PA 4R3KA 3B8GA 4IAVA 2B58A 2V8VA 2WUUA 2NSMA 4U5YA 4A31A 1LCPA 3IJ3A 1YVOA 4XPDC 3SJXA 2EVNA 3KHXA 2Z3MA 4P44A 3TOBA 3FBUA 3CXSA 4R76A 1M4LA 3DSBA 3PBEA 3VWEA 2OZUA 4G1PA 3E0KA 4UBRA 1Z4RA 3D7GA 2F7VA 2Z3NA 4KSFA 1ARLA 1Z2LA 4CAWA 1Y0YA 5CNPA 4CGLA 2G0BA 4OIDA 4QB9A 1LANA 4B13A 1SQHA 3KR5A 4PXDA 2HC9A 4KOYA 4J3GA 2ATRA 3RBUA 1AUGA 4MCRA 4NJRA 4OADA 3SJFA 4JD6A 4NJQA 3W91A 1ELLP 3SXOA 4DUKA 4X3RA 2AFXA 4JXRA 1FY7A 3IU1A 1I12A 4CYPA 4ZGYB 3PEIA 2VBQA 4NFRA 1TKHA 2XEFA 3DR8A
chains in the Genus database with same CATH topology
4AVAA 2DPTA 3FB3A 5HMNA 3EO4A 4PK3A 4KUBA 1MJAA 4I49A 1YREA 2FL4A 4MI4A 3IWGA 4HNXB 4CAXA 4KS9A 4JWPA 2R8VA 3DR6A 1RXTA 4Q36A 4YRHA 4U9ZA 5JQ4A 1M1DA 1S5KA 1XIXA 1B6BA 4KOSA 4CAFA 4YGOA 2PDOA 3R9GA 3F5BA 4FD6A 2JEVA 2OH1A 4XNHB 5JPHA 4A33A 2A4NA 5C82A 1YR0A 3EXNA 5G22A 1YLEA 4CGOA 2Z11A 5KTDA 4KLWA 3S6KA 4MFKA 1S7FA 4XPLA 2DPSA 4CYNA 3LD2A 1ON0A 5BWAB 1YGHA 2FXFA 1U6MA 4KORA 4KOWA 4H6ZA 2R1IA 1J4JA 2Q0YA 3I9SA 3DDDA 1NE9A 3EY5A 1M4IA 2NMTA 2OZGA 5F48A 1UFHA 2Z3KA 4YFJA 3KKWA 3TTHA 4B5OA 5G21A 1XEBA 4KOXA 4B10A 1V0CA 3UY5A 4MY3A 3G3SA 2ZW7A 1S7LA 2O28A 2PR8A 2VZYA 2B4BA 2WSAA 2P6GA 3TOAA 4R9MA 2B5GB 3TT2A 1IYLA 4F0XA 2Q04A 4UA3A 1K4JA 1NMTA 2JDDA 4UFXA 4UWJA 1R57A 4A2ZA 4C68A 1L0CA 2FIWA 2R98A 4LX9A 3R96A 4UFWA 3FXTA 4B11A 3GKRA 4XNHC 4CYOA 5HH1A 2GANA 1QSOA 4KVOE 2REFA 4B14A 3C26A 2PR1A 4KUAA 1WK4A 4A95A 3R1KA 4Y49B 2BSWA 1P4NA 1M4GA 3VWDA 3RYOA 2CNSA 3JTKA 4BMHA 4UWIA 4E8OA 2G3AA 4CYQA 4CS0B 4IUSA 2YNDA 2OZHA 5F46A 3F8KA 1YX0A 3TCVA 2J8NA 1CJWA 2B4DA 5G20A 5FVJA 3T9YA 4KSAA 2G3TA 2Q4VA 3GY9A 5J8CA 1Z9UA 3CXQA 3S6GA 3CXPA 2VQYA 2GIVA 5H84A 4RI1A 4CAEA 1I1DA 5AGEA 4QC6A 4AG7A 2KCWA 3ZZIA 1B87A 1GHEA 2PRBA 4KZTA 1WWZA 2ZW4A 1PU9A 1Q2CA 2IL4A 4R87A 4E0AA 1KZFA 2R7HA 2VXKA 2REEA 1QSTA 4MFQA 2BL1A 4B12A 4KOTA 2HUZA 3S6HA 4AVCA 5AG4A 2CXAA 2B3VA 4KVXA 4Y49C 4AB7A 3D3SA 2VZZA 1YVKA 3R95A 1XF8A 3I3GA 2PC1A 4C7IA 2CNTA 2P0WA 2PQ8A 5EBVA 1KUXA 2BUEA 4F0YA 2WPXA 2F5IA 3R9EA 5F49A 2ZW6A 3GYAA 1M4DA 4MFJA 2YNCA 3SHPA 4E2AA 2QIRA 2Z10A 1QSMA 4CGMA 1XE4A 1CM0A 4MY0A 4PSWA 2PSWA 1MJBA 5A28A 3R9FA 2CY2A 5E96A 4KOUA 4QBJA 4QVTA 3WR7A 3BJ7A 4U9YA 2OU2A 2P6EA 4KVME 3TE4A 2VI7A 1IYKA 4IF5A 4MFLA 4NF1A 4H6UA 2HV2A 2B4DB 1S7NA 2AE6A 4JLYA 5IX3A 4PV6A 3NE7A 4QUSA 3G8WA 5IV0A 3H4QA 3TO6A 3T90A 2QMLA 3FYNA 4MFZA 1RO5A 2Z3LA 2J8RA 2OB0A 2FCKA 1IICA 1S3ZA 4UCMA 5DWNA 2ZXVA 4CAVA 3D8PA 5H86A 2JDCA 2ZW5A 5AG7A 1IB1E 1VKCA 4C2YA 2YNEA 3QB8A 5IB0A 4B5PA 2EUIA 5KTAA 4L8AA 4NEXA 2QECA 2BEIA 4RS2A 4ORFA 4ONUA 2D4OA 1KUYA 3EFAA 1Y9KA 4M3SA 3EC4A 3PP9A 4MHDA 1NSLA 4R3LA 4UCNA 3FRMA 1Y9WA 4CGPA 4C7HA 3LODA 2J8MA 4H89A 4XPKA 2Z3PA 2YGWA 1QSNA 4MFPA 4UFVA 3N7ZA 4JJXA 2C27A 3TO9A 4C2XA 3H5ZA 3TO7A 3FIXA 2Z3OA 2X7BA 2VEZA 1Q2DA 4CRZB 2DXQA 3W6XA 4M85A 4OAEA 5EC4A 4PK2A 4A32A 3D2MA 3OWCA 4MJ8A 1S60A 2JLMA 4GS4A 1BO4A 1N71A 4F6AA 4KOVA 5G1ZA 2FSRA 4C2ZA 4KLVA 3A9LA 4K30A 4A30A 3FNCA 3V8IA 1I21A 3JUWA 1ZO0A 1VHSA 1BOBA 5I0CA 1YK3A 4X5KA 5A27A 5AG6A 4JXQA 5AG5A 2WPWA 2K5TA 1MK4A 2CNMA 4UCPA 2FIAA 2ARHA 3PGPA 3IGRA 4LUAA 3F0AA 4NSQA 4ZBGA 2I79A 5F47A 3K9UA 2AJ6A 4BBHA 2RC4A 4R57A 2Q4YA 2FT0A 4NXYA 5J8FA 2GE3A 1QSRA 1IIDA 1Y7RA 4II9A 1KUVA 1OZPA 5DWMA 4CGNA 5ISVA 4XPDB 3JVNA 2YNCC 4HKFA 4NCZA 4B5PB 1XMTA 2B3UA 1Z4EA 3QAHA 4MBUA 2Q44A 2I00A 2FE7A 4HNYB 3P2HA 3S6FA 1Q2YA 2HQYA 3TFYA 3IU2A 2Z0ZA 5C88A 3BJ8A 3IWEA 4EVYA 1M44A 2ZPAA 1P0HA 4AG9A 2H5MA 4FD4A 1PUAA 2Y0MA 3BLNA 4CRYB 4DNCA 1TIQA 3SXNA 4PSXA 3DNSA 3ZJ0A 4AVBA 3D2PA 5GCNA 2Q7BA 5KTCA 4OLLA 1LRZA 4Q38A 3P2FA 4HNWB 4FD7A 3MGDA 2P6FA 2B5GA 3PZJA 1MJ9A 4FD5A 2FS5A 3W6SA 1S7KA 4L89A 2D4PA 4R3KA 3B8GA 2B58A 2WUUA 4U5YA 4A31A 1YVOA 4XPDC 2EVNA 2Z3MA 3TOBA 3FBUA 3CXSA 3DSBA 3VWEA 2OZUA 3E0KA 4UBRA 1Z4RA 2Z3NA 4KSFA 4CGLA 4CAWA 5CNPA 2G0BA 4QB9A 4B13A 1SQHA 4KOYA 4J3GA 2ATRA 4OADA 4JD6A 3W91A 3SXOA 4JXRA 1FY7A 3IU1A 1I12A 4CYPA 4ZGYB 2VBQA 3DR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AVA A;  3FB3 A;  5HMN A;  3EO4 A;  4PK3 A;  4KUB A;  1MJA A;  4I49 A;  1YRE A;  2FL4 A;  4MI4 A;  3IWG A;  4HNX B;  4CAX A;  4JWP A;  2R8V A;  3DR6 A;  1RXT A;  4YRH A;  4U9Z A;  5JQ4 A;  1M1D A;  1S5K A;  1XIX A;  1B6B A;  4KOS A;  4YGO A;  2PDO A;  3R9G A;  3F5B A;  4FD6 A;  2JEV A;  2OH1 A;  4XNH B;  5JPH A;  2A4N A;  5C82 A;  1YR0 A;  3EXN A;  1YLE A;  5KTD A;  2Z11 A;  4KLW A;  3S6K A;  1S7F A;  4XPL A;  3LD2 A;  1ON0 A;  1YGH A;  2FXF A;  1U6M A;  4KOR A;  4KOW A;  4H6Z A;  2R1I A;  1J4J A;  2Q0Y A;  3I9S A;  3DDD A;  1NE9 A;  3EY5 A;  1M4I A;  2NMT A;  2OZG A;  5F48 A;  1UFH A;  4YFJ A;  3KKW A;  3TTH A;  4B5O A;  1XEB A;  4KOX A;  1V0C A;  3UY5 A;  4MY3 A;  3G3S A;  2ZW7 A;  1S7L A;  2O28 A;  2PR8 A;  2VZY A;  2B4B A;  2P6G A;  3TOA A;  4R9M A;  2B5G B;  3TT2 A;  1IYL A;  2Q04 A;  4UA3 A;  1K4J A;  1NMT A;  2JDD A;  4UWJ A;  1R57 A;  1L0C A;  2FIW A;  2R98 A;  4LX9 A;  3R96 A;  3FXT A;  3GKR A;  4XNH C;  5HH1 A;  2GAN A;  1QSO A;  4KVO E;  2REF A;  3C26 A;  2PR1 A;  4KUA A;  1WK4 A;  3R1K A;  4Y49 B;  2BSW A;  1P4N A;  1M4G A;  3VWD A;  3RYO A;  2CNS A;  4BMH A;  4UWI A;  4E8O A;  2G3A A;  4CS0 B;  4IUS A;  2OZH A;  5F46 A;  3F8K A;  1YX0 A;  3TCV A;  2J8N A;  1CJW A;  2B4D A;  5FVJ A;  3T9Y A;  2G3T A;  2Q4V A;  3GY9 A;  5J8C A;  1Z9U A;  3CXQ A;  3S6G A;  3CXP A;  2VQY A;  2GIV A;  5H84 A;  4RI1 A;  1I1D A;  4QC6 A;  4AG7 A;  2KCW A;  3ZZI A;  1B87 A;  1GHE A;  2PRB A;  4KZT A;  1WWZ A;  2ZW4 A;  1PU9 A;  1Q2C A;  2IL4 A;  4R87 A;  4E0A A;  1KZF A;  2R7H A;  2VXK A;  2REE A;  1QST A;  2BL1 A;  4KOT A;  2HUZ A;  3S6H A;  4AVC A;  2B3V A;  4KVX A;  4Y49 C;  4AB7 A;  3D3S A;  2VZZ A;  1YVK A;  3R95 A;  1XF8 A;  3I3G A;  2PC1 A;  2CNT A;  2P0W A;  2PQ8 A;  5EBV A;  1KUX A;  2BUE A;  4F0Y A;  2WPX A;  2F5I A;  3R9E A;  5F49 A;  2ZW6 A;  3GYA A;  1M4D A;  3SHP A;  4E2A A;  2QIR A;  2Z10 A;  1QSM A;  1XE4 A;  1CM0 A;  4MY0 A;  4PSW A;  2PSW A;  1MJB A;  3R9F A;  2CY2 A;  5E96 A;  4KOU A;  4QBJ A;  4QVT A;  3WR7 A;  3BJ7 A;  4U9Y A;  2OU2 A;  2P6E A;  4KVM E;  3TE4 A;  2VI7 A;  1IYK A;  4IF5 A;  4NF1 A;  4H6U A;  2HV2 A;  2B4D B;  1S7N A;  2AE6 A;  4JLY A;  5IX3 A;  4PV6 A;  3NE7 A;  4QUS A;  3G8W A;  5IV0 A;  3H4Q A;  3TO6 A;  3T90 A;  2QML A;  3FYN A;  1RO5 A;  2J8R A;  2OB0 A;  2FCK A;  1IIC A;  1S3Z A;  5DWN A;  2ZXV A;  4CAV A;  3D8P A;  5H86 A;  2JDC A;  2ZW5 A;  1IB1 E;  1VKC A;  3QB8 A;  5IB0 A;  4B5P A;  2EUI A;  5KTA A;  4L8A A;  4NEX A;  2QEC A;  2BEI A;  4RS2 A;  4ORF A;  4ONU A;  2D4O A;  1KUY A;  3EFA A;  1Y9K A;  4M3S A;  3EC4 A;  3PP9 A;  4MHD A;  1NSL A;  4R3L A;  3FRM A;  1Y9W A;  3LOD A;  2J8M A;  4H89 A;  4XPK A;  1QSN A;  3N7Z A;  4JJX A;  2C27 A;  3TO9 A;  3TO7 A;  3FIX A;  2X7B A;  2VEZ A;  1Q2D A;  4CRZ B;  2DXQ A;  3W6X A;  4M85 A;  4OAE A;  5EC4 A;  4PK2 A;  3D2M A;  3OWC A;  4MJ8 A;  1S60 A;  2JLM A;  4GS4 A;  1BO4 A;  1N71 A;  4F6A A;  4KOV A;  2FSR A;  4KLV A;  4K30 A;  3FNC A;  3V8I A;  1I21 A;  3JUW A;  1VHS A;  1BOB A;  5I0C A;  1YK3 A;  4X5K A;  4JXQ A;  2WPW A;  2K5T A;  1MK4 A;  2CNM A;  2FIA A;  2ARH A;  3PGP A;  3IGR A;  4LUA A;  3F0A A;  4NSQ A;  4ZBG A;  2I79 A;  5F47 A;  3K9U A;  2AJ6 A;  2RC4 A;  4R57 A;  2Q4Y A;  2FT0 A;  4NXY A;  5J8F A;  2GE3 A;  1QSR A;  1IID A;  1Y7R A;  4II9 A;  1KUV A;  1OZP A;  5DWM A;  5ISV A;  4XPD B;  3JVN A;  4HKF A;  4NCZ A;  4B5P B;  1XMT A;  2B3U A;  1Z4E A;  3QAH A;  4MBU A;  2Q44 A;  2I00 A;  2FE7 A;  4HNY B;  3P2H A;  3S6F A;  1Q2Y A;  2HQY A;  3TFY A;  2Z0Z A;  5C88 A;  3BJ8 A;  4EVY A;  1M44 A;  2ZPA A;  1P0H A;  4AG9 A;  2H5M A;  4FD4 A;  1PUA A;  2Y0M A;  3BLN A;  4CRY B;  4DNC A;  1TIQ A;  3SXN A;  4PSX A;  3DNS A;  3ZJ0 A;  4AVB A;  3D2P A;  5GCN A;  2Q7B A;  5KTC A;  4OLL A;  1LRZ A;  3P2F A;  4HNW B;  4FD7 A;  3MGD A;  2P6F A;  2B5G A;  3PZJ A;  1MJ9 A;  4FD5 A;  2FS5 A;  3W6S A;  1S7K A;  4L89 A;  2D4P A;  4R3K A;  3B8G A;  2B58 A;  4U5Y A;  1YVO A;  4XPD C;  2EVN A;  3TOB A;  3FBU A;  3CXS A;  3DSB A;  3VWE A;  2OZU A;  3E0K A;  4UBR A;  1Z4R A;  4CAW A;  5CNP A;  2G0B A;  4QB9 A;  1SQH A;  4KOY A;  4J3G A;  2ATR A;  4OAD A;  4JD6 A;  3W91 A;  3SXO A;  4JXR A;  1FY7 A;  1I12 A;  2VBQ A;  3DR8 A; 
#chains in the Genus database with same CATH topology
 4AVA A;  2DPT A;  3FB3 A;  5HMN A;  2Q4Z A;  3S9N A;  1VGY A;  3EO4 A;  4PK3 A;  4KUB A;  1MJA A;  5THW A;  4I49 A;  1YRE A;  2FL4 A;  4MI4 A;  3IWG A;  4HNX B;  4CAX A;  4KS9 A;  4JWP A;  4F8Z A;  3JRU A;  2R8V A;  1Y0R A;  3DR6 A;  1RXT A;  2PJB A;  2AFW A;  4Q36 A;  4YRH A;  4U9Z A;  5JQ4 A;  1M1D A;  1S5K A;  1XIX A;  2NYQ A;  1B6B A;  4KOS A;  1BPM A;  3RAM A;  4CAF A;  4YGO A;  4MHP A;  4JZ0 A;  2PDO A;  4PPZ A;  3IEH A;  3R9G A;  1X10 A;  3F5B A;  4FD6 A;  2JEV A;  2OH1 A;  4XNH B;  4DJL A;  5JPH A;  4A33 A;  4OC2 A;  2O53 A;  2PJ6 A;  3B3S A;  2A4N A;  5C82 A;  1YR0 A;  2DEA A;  2ZEG A;  3EXN A;  5G22 A;  1YLE A;  4CGO A;  2Z11 A;  5KTD A;  4KLW A;  3QAY A;  1HEE A;  3S6K A;  1DE4 C;  4MFK A;  1S7F A;  5HVF A;  4XPL A;  2DPS A;  4CYN A;  3H8E A;  1CX8 A;  4BD9 A;  3RO0 A;  1TF8 A;  3LD2 A;  4HPS A;  1ON0 A;  5BWA B;  2JBK A;  3WC7 A;  1YGH A;  2FXF A;  5HVH A;  1U6M A;  4R7M A;  4KOR A;  2IMO A;  4KOW A;  4H6Z A;  2R1I A;  3QNV A;  1J4J A;  2Q0Y A;  2QYV A;  3DDD A;  1NE9 A;  3EY5 A;  1UWY A;  3I9S A;  1M4I A;  2NMT A;  5IB9 A;  2OZG A;  5F48 A;  1UFH A;  2Z3K A;  4YFJ A;  3KKW A;  3TTH A;  4B5O A;  1ZG9 A;  2POK A;  5G21 A;  1XEB A;  4KOX A;  4B10 A;  1V0C A;  5I4M A;  3V38 A;  4ZY0 A;  2EK9 A;  3ISX A;  3UY5 A;  2PJ8 A;  8CPA A;  4MY3 A;  1Z8T A;  3G3S A;  2AFS A;  2ZW7 A;  1S7L A;  5F09 A;  3FH4 A;  2AFZ A;  4DYO A;  2O28 A;  2PR8 A;  3LAC A;  2VZY A;  2B4B A;  2Q7S A;  4MCS A;  2WSA A;  2P6G A;  3TOA A;  1R43 A;  4R9M A;  1H8L A;  4EFD A;  2B5G B;  4UIA A;  5ELY A;  3TT2 A;  1IYL A;  4F0X A;  2Q04 A;  4UA3 A;  1K4J A;  1IU8 A;  1NMT A;  1VHO A;  4H2K A;  1CPS A;  2JDD A;  4UFX A;  1Q7L A;  4ZX9 A;  4UWJ A;  1R57 A;  4OC1 A;  1TXR A;  2PJ9 A;  2ODF A;  4A2Z A;  4C68 A;  1L0C A;  2FIW A;  4EME A;  1NSA A;  2CIJ A;  3IIB A;  3KZW A;  2R98 A;  3D67 A;  4LX9 A;  4UFW A;  3FXT A;  3KAS A;  3NFZ A;  3R96 A;  4B11 A;  3GKR A;  4XNH C;  4BIN A;  4CYO A;  1ELM P;  5HH1 A;  2GAN A;  1QSO A;  2XEJ A;  4KVO E;  2IQ6 A;  2REF A;  4MCQ A;  3C26 A;  2ANP A;  4B14 A;  1TKF A;  2PR1 A;  3PB6 X;  1F2O A;  2ZEE A;  2FVG A;  5CPA A;  3FVL A;  4KUA A;  1WK4 A;  2GFQ A;  2PJ7 A;  4OIW A;  4A95 A;  3R1K A;  3B7I A;  4Y49 B;  4W9Y A;  2BSW A;  2JEW A;  1P4N A;  1M4G A;  3VWD A;  4MHY A;  3RYO A;  2CNS A;  2O4H A;  3JTK A;  4NGR A;  5D8N A;  4UWI A;  4BMH A;  4E8O A;  2G3A A;  3FF3 A;  4CYQ A;  4CS0 B;  4IUS A;  3KR4 A;  4M6H A;  2YND A;  4P10 A;  5EMI A;  4GM5 A;  2OZH A;  5F46 A;  2GU2 A;  3LWU A;  4JYW A;  3F8K A;  1QMU A;  3T8W A;  1YX0 A;  1LOK A;  2J8N A;  3TCV A;  4GXH A;  1CJW A;  2ZEH A;  2B4D A;  5G20 A;  5FVJ A;  3T9Y A;  3S9M A;  5HXD A;  4KSA A;  2G3T A;  2Q4V A;  3GY9 A;  5J8C A;  3DLJ A;  1Z9U A;  3CXQ A;  2CF4 A;  3S6G A;  3CXP A;  5D29 A;  1ZLI A;  2PJ1 A;  2VQY A;  4M6I A;  2GIV A;  2PJ4 A;  5H84 A;  4OC5 A;  2GLF A;  4RI1 A;  4X2T A;  1ARM A;  4CAE A;  1I1D A;  5AGE A;  4QC6 A;  2ZEM A;  1VHE A;  4AG7 A;  2KCW A;  2GLJ A;  3FX6 A;  4NGP A;  4PXC A;  3ZZI A;  1B87 A;  1GHE A;  2PRB A;  3KQZ A;  4KZT A;  1WWZ A;  2ZW4 A;  1PU9 A;  2RB7 A;  2WYR A;  1F2P A;  4A37 A;  4IK2 A;  1Q2C A;  4P4B A;  2IL4 A;  1XFO A;  4R87 A;  1XOV A;  4TNU A;  4E0A A;  3B35 A;  3SI1 A;  5LYL A;  1ZG7 A;  1KZF A;  3SJE A;  2R7H A;  2VXK A;  2REE A;  1QST A;  4MFQ A;  4F9U A;  2BL1 A;  3SI0 A;  1BLL E;  4B12 A;  4B6Z A;  3VH9 A;  2XEG A;  2IJZ A;  2HUZ A;  4KOT A;  3S6H A;  4AVC A;  4F9V A;  5AG4 A;  2CXA A;  2B3V A;  4KVX A;  4Y49 C;  1X12 A;  4AB7 A;  3D3S A;  3TX8 A;  1YQE A;  2VZZ A;  4RN7 A;  1YVK A;  1JWQ A;  4LQG A;  7CPA A;  3R95 A;  1XF8 A;  3I3G A;  2PC1 A;  2EBJ A;  4C7I A;  1IOI A;  2CNT A;  2P0W A;  2DF5 A;  2PQ8 A;  3RZA A;  4CPA A;  5EBV A;  1KUX A;  2QJ8 A;  2BUE A;  4F0Y A;  2WPX A;  3NH4 A;  1HDU A;  2PJA A;  2F5I A;  3HLP A;  3R9E A;  3FMC A;  4PXE A;  3I1U A;  3CPA A;  1YSJ A;  3GLJ A;  5F49 A;  2V8G A;  3PFO A;  2ZW6 A;  3GYA A;  2J9A A;  3GB0 A;  2WZN A;  3PB4 X;  1M4D A;  4MFJ A;  2YNC A;  4ZI6 A;  3GUX A;  4OC4 A;  3VAT A;  3SHP A;  2V8D A;  3B3C A;  4E2A A;  3CZX A;  2QIR A;  4WWV A;  2ZEO A;  2Z10 A;  1QSM A;  1BPN A;  4CGM A;  1PCA A;  3D7D A;  1XE4 A;  1CM0 A;  4MY0 A;  3IWW A;  3IC1 A;  1CP7 A;  1Z8L A;  2PSW A;  4PSW A;  4P6Y A;  3PRT A;  1MJB A;  2EWB A;  3R9F A;  2CY2 A;  1XBU A;  5E96 A;  5A28 A;  3L2N A;  3PB7 X;  4KOU A;  4QBJ A;  5K8O A;  3D4U A;  1TKJ A;  5JGF A;  4QVT A;  4R8F A;  3WR7 A;  2BCO A;  2C1C A;  2ZEN A;  3BJ7 A;  4NGT A;  3K2K A;  2V77 A;  3RNZ A;  4U9Y A;  2OU2 A;  2P6E A;  1HDQ A;  4KVM E;  3TE4 A;  2VI7 A;  1IYK A;  2BOA A;  4IF5 A;  1XMB A;  4MFL A;  4NF1 A;  4H6U A;  2HV2 A;  2B4D B;  3B3T A;  3KL9 A;  1S7N A;  2HB6 A;  4P4D A;  2AE6 A;  1QQ9 A;  1IOF A;  4JLY A;  3WC5 A;  5IX3 A;  1EE3 P;  4P45 A;  4PV6 A;  3NE7 A;  4QUS A;  3G8W A;  4OC3 A;  3HUV A;  5IV0 A;  3H4Q A;  4FUU A;  3T90 A;  3TO6 A;  3PFE A;  2QML A;  1CPX A;  3FEC A;  3FYN A;  4MFZ A;  1RO5 A;  2Z3L A;  4RUH A;  4X8I A;  2PJ2 A;  2J8R A;  2OB0 A;  2FCK A;  3PBB A;  4P4J A;  1IIC A;  1A2Z A;  1S3Z A;  2ZEP A;  4UCM A;  3MRU A;  4MRI A;  2ZXV A;  5DWN A;  4A39 A;  4CAV A;  3LMS A;  3D8P A;  1FT7 A;  5H86 A;  3BXM A;  2JDC A;  3SI2 A;  2ZW5 A;  5AG7 A;  1IB1 E;  1VKC A;  4C2Y A;  2YNE A;  3CDX A;  5JM6 A;  3QB8 A;  5IB0 A;  1IGB A;  4B5P A;  2EUI A;  5KTA A;  4L8A A;  4NEX A;  1YME A;  3NE8 A;  2QEC A;  5LYF A;  2BEI A;  4RS2 A;  4ORF A;  4ONU A;  2D4O A;  1KUY A;  1LAP A;  1Y9K A;  1BAV A;  1Y7E A;  3EFA A;  4LQ6 A;  4K3N A;  4M3S A;  3EC4 A;  3PP9 A;  4MHD A;  1NSL A;  4R3L A;  4UCN A;  3FRM A;  1Y9W A;  3PB8 X;  3B3W A;  4CGP A;  1AMP A;  2AFU A;  3LOD A;  4C7H A;  3ISZ A;  2J8M A;  4PXB A;  3FED A;  6CPA A;  2VL1 A;  1Z5R A;  4H89 A;  4XPK A;  2Z3P A;  2I3C A;  2OR4 A;  2YGW A;  1QSN A;  4MFP A;  4UFV A;  3N7Z A;  4JJX A;  2C27 A;  5LRG A;  3TO9 A;  4C2X A;  3WC6 A;  3H5Z A;  1ZLH A;  3H8F A;  4R6T A;  3FIX A;  2Z3O A;  2X7B A;  3TO7 A;  3VAR A;  4UF4 A;  2EK8 A;  2VEZ A;  5J1Q A;  3NH8 A;  1Q2D A;  1OBR A;  2PJ0 A;  4CRZ B;  2DXQ A;  3W6X A;  2EO8 A;  4M85 A;  4FAI A;  4OAE A;  5EC4 A;  1YLO A;  4PK2 A;  3BI1 A;  4A32 A;  3D2M A;  3OWC A;  4MHZ A;  4MJ8 A;  1S60 A;  2JLM A;  3D7F A;  4GS4 A;  4NGM A;  5K8N A;  4M6G A;  4ZY2 A;  1Z8X A;  2ZOG A;  1BO4 A;  5LYI A;  1N71 A;  4F6A A;  4KOV A;  5G1Z A;  2FSR A;  4C2Z A;  4UEF A;  3D68 A;  2QVP A;  2XEI A;  2C6P A;  4KLV A;  3A9L A;  3NA6 A;  3DGV A;  3PB9 X;  1CP6 A;  4K30 A;  4A30 A;  4P4F A;  2CTB A;  2Q43 A;  3FNC A;  3V8I A;  5LYD A;  4FBE A;  1I21 A;  3MN8 A;  3N5F A;  4YU9 A;  3JUW A;  3CPX A;  1ZO0 A;  4UEZ A;  1VHS A;  4MCP A;  1BOB A;  5I0C A;  1YK3 A;  1PYT B;  4X5K A;  5K8M A;  1VIX A;  2CTC A;  5A27 A;  5DS0 A;  4UEE A;  5AG6 A;  3B2Y A;  4JXQ A;  5AG5 A;  2WPW A;  2K5T A;  1MK4 A;  1ZG8 A;  2CNM A;  2JBJ A;  4P4E A;  1LFW A;  4O23 A;  4UCP A;  2FIA A;  2ARH A;  3PGP A;  3IGR A;  4LUA A;  1GYT A;  3WT4 A;  3FEE A;  4ZX8 A;  3F0A A;  4NSQ A;  3SJG A;  4ZBG A;  4A38 A;  4FWU A;  2PVV A;  2I79 A;  1TF9 A;  1DTD A;  4Z65 A;  2V8H A;  5F47 A;  1FNO A;  3K9U A;  2AJ6 A;  4BBH A;  2GRE A;  2RC4 A;  2C6G A;  4Q7A A;  2OOT A;  4R57 A;  1CBX A;  1AYE A;  2Q4Y A;  1Z8W A;  5HVG A;  2FT0 A;  4NXY A;  5J8F A;  3KHZ A;  2GE3 A;  1QSR A;  1IID A;  3CT9 A;  3K9T A;  2ZED A;  1Y7R A;  2PIY A;  2ZEF A;  4UIB A;  4WJB A;  4II9 A;  3BHX A;  2BO9 A;  4ZY1 A;  1JQG A;  4NGS A;  1KUV A;  3FJU A;  1XJO A;  1OZP A;  4TWE A;  4KSI A;  5DWM A;  4CGN A;  4OME A;  5ISV A;  4XPD B;  2PJ5 A;  4MHN A;  3JVN A;  1IY7 A;  2YNC C;  4HKF A;  4NCZ A;  3TC8 A;  1LAM A;  4B5P B;  1XMT A;  1KWM A;  2PVW A;  3GIU A;  2B3U A;  1Z4E A;  2PJ3 A;  2RFH A;  2AFO A;  5LRJ A;  4NGN A;  3S9L A;  3QAH A;  4MBU A;  2Q44 A;  3D66 A;  4ZYQ A;  2I00 A;  2G9D A;  2FE7 A;  3BI0 A;  3P2H A;  4HNY B;  4ONW A;  1RTQ A;  3S6F A;  1CG2 A;  1Q2Y A;  2ABZ A;  2C6C A;  4PQA A;  2HQY A;  2ZEL A;  4NGQ A;  3TFY A;  3IU2 A;  2Z0Z A;  4MMO A;  2PRQ A;  3KI9 A;  5C88 A;  3BJ8 A;  3IWE A;  4YWY A;  4AXV A;  4EVY A;  5CBM A;  1YW4 A;  2F8H A;  3KQX A;  1M44 A;  2ZPA A;  5LRK A;  1P0H A;  3IO1 A;  4AG9 A;  2H5M A;  2PJC A;  4FD4 A;  1R3N A;  3NH5 A;  4P4I A;  5JH9 A;  1F57 A;  3B3V A;  3D7H A;  1PUA A;  2Y0M A;  2Q51 A;  3BLN A;  4CRY B;  4IHM A;  4DNC A;  2PCU A;  1TIQ A;  3SXN A;  4PSX A;  4OP4 A;  3DNS A;  2AFM A;  3ZJ0 A;  2PIZ A;  4AVB A;  3D2P A;  3H8G A;  5GCN A;  1YW6 A;  2Q7B A;  4OLL A;  5KTC A;  1LRZ A;  4Q38 A;  5K8P A;  4A94 A;  3V7Z A;  3P2F A;  4HNW B;  3IFE A;  4EWT A;  3MGD A;  4FD7 A;  2PE3 A;  2P6F A;  2B5G A;  3PZJ A;  1XRY A;  1MJ9 A;  2ZOF A;  4FD5 A;  2FS5 A;  3W6S A;  1S7K A;  4L89 A;  3WAB A;  4OKO A;  3KGQ A;  4MXU A;  4OC0 A;  2D4P A;  4R3K A;  3B8G A;  4IAV A;  2B58 A;  2V8V A;  2WUU A;  2NSM A;  4U5Y A;  4A31 A;  1LCP A;  3IJ3 A;  1YVO A;  4XPD C;  3SJX A;  2EVN A;  3KHX A;  2Z3M A;  4P44 A;  3TOB A;  3FBU A;  3CXS A;  4R76 A;  1M4L A;  3DSB A;  3PBE A;  3VWE A;  2OZU A;  4G1P A;  3E0K A;  4UBR A;  1Z4R A;  3D7G A;  2F7V A;  2Z3N A;  4KSF A;  1ARL A;  1Z2L A;  4CAW A;  1Y0Y A;  5CNP A;  4CGL A;  2G0B A;  4OID A;  4QB9 A;  1LAN A;  4B13 A;  1SQH A;  3KR5 A;  4PXD A;  2HC9 A;  4KOY A;  4J3G A;  2ATR A;  3RBU A;  1AUG A;  4MCR A;  4NJR A;  4OAD A;  3SJF A;  4JD6 A;  4NJQ A;  3W91 A;  1ELL P;  3SXO A;  4DUK A;  4X3R A;  2AFX A;  4JXR A;  1FY7 A;  3IU1 A;  1I12 A;  4CYP A;  4ZGY B;  3PEI A;  2VBQ A;  4NFR A;  1TKH A;  2XEF A;  3DR8 A; 
#chains in the Genus database with same CATH homology
 4AVA A;  2DPT A;  3FB3 A;  5HMN A;  3EO4 A;  4PK3 A;  4KUB A;  1MJA A;  4I49 A;  1YRE A;  2FL4 A;  4MI4 A;  3IWG A;  4HNX B;  4CAX A;  4KS9 A;  4JWP A;  2R8V A;  3DR6 A;  1RXT A;  4Q36 A;  4YRH A;  4U9Z A;  5JQ4 A;  1M1D A;  1S5K A;  1XIX A;  1B6B A;  4KOS A;  4CAF A;  4YGO A;  2PDO A;  3R9G A;  3F5B A;  4FD6 A;  2JEV A;  2OH1 A;  4XNH B;  5JPH A;  4A33 A;  2A4N A;  5C82 A;  1YR0 A;  3EXN A;  5G22 A;  1YLE A;  4CGO A;  2Z11 A;  5KTD A;  4KLW A;  3S6K A;  4MFK A;  1S7F A;  4XPL A;  2DPS A;  4CYN A;  3LD2 A;  1ON0 A;  5BWA B;  1YGH A;  2FXF A;  1U6M A;  4KOR A;  4KOW A;  4H6Z A;  2R1I A;  1J4J A;  2Q0Y A;  3I9S A;  3DDD A;  1NE9 A;  3EY5 A;  1M4I A;  2NMT A;  2OZG A;  5F48 A;  1UFH A;  2Z3K A;  4YFJ A;  3KKW A;  3TTH A;  4B5O A;  5G21 A;  1XEB A;  4KOX A;  4B10 A;  1V0C A;  3UY5 A;  4MY3 A;  3G3S A;  2ZW7 A;  1S7L A;  2O28 A;  2PR8 A;  2VZY A;  2B4B A;  2WSA A;  2P6G A;  3TOA A;  4R9M A;  2B5G B;  3TT2 A;  1IYL A;  4F0X A;  2Q04 A;  4UA3 A;  1K4J A;  1NMT A;  2JDD A;  4UFX A;  4UWJ A;  1R57 A;  4A2Z A;  4C68 A;  1L0C A;  2FIW A;  2R98 A;  4LX9 A;  3R96 A;  4UFW A;  3FXT A;  4B11 A;  3GKR A;  4XNH C;  4CYO A;  5HH1 A;  2GAN A;  1QSO A;  4KVO E;  2REF A;  4B14 A;  3C26 A;  2PR1 A;  4KUA A;  1WK4 A;  4A95 A;  3R1K A;  4Y49 B;  2BSW A;  1P4N A;  1M4G A;  3VWD A;  3RYO A;  2CNS A;  3JTK A;  4BMH A;  4UWI A;  4E8O A;  2G3A A;  4CYQ A;  4CS0 B;  4IUS A;  2YND A;  2OZH A;  5F46 A;  3F8K A;  1YX0 A;  3TCV A;  2J8N A;  1CJW A;  2B4D A;  5G20 A;  5FVJ A;  3T9Y A;  4KSA A;  2G3T A;  2Q4V A;  3GY9 A;  5J8C A;  1Z9U A;  3CXQ A;  3S6G A;  3CXP A;  2VQY A;  2GIV A;  5H84 A;  4RI1 A;  4CAE A;  1I1D A;  5AGE A;  4QC6 A;  4AG7 A;  2KCW A;  3ZZI A;  1B87 A;  1GHE A;  2PRB A;  4KZT A;  1WWZ A;  2ZW4 A;  1PU9 A;  1Q2C A;  2IL4 A;  4R87 A;  4E0A A;  1KZF A;  2R7H A;  2VXK A;  2REE A;  1QST A;  4MFQ A;  2BL1 A;  4B12 A;  4KOT A;  2HUZ A;  3S6H A;  4AVC A;  5AG4 A;  2CXA A;  2B3V A;  4KVX A;  4Y49 C;  4AB7 A;  3D3S A;  2VZZ A;  1YVK A;  3R95 A;  1XF8 A;  3I3G A;  2PC1 A;  4C7I A;  2CNT A;  2P0W A;  2PQ8 A;  5EBV A;  1KUX A;  2BUE A;  4F0Y A;  2WPX A;  2F5I A;  3R9E A;  5F49 A;  2ZW6 A;  3GYA A;  1M4D A;  4MFJ A;  2YNC A;  3SHP A;  4E2A A;  2QIR A;  2Z10 A;  1QSM A;  4CGM A;  1XE4 A;  1CM0 A;  4MY0 A;  4PSW A;  2PSW A;  1MJB A;  5A28 A;  3R9F A;  2CY2 A;  5E96 A;  4KOU A;  4QBJ A;  4QVT A;  3WR7 A;  3BJ7 A;  4U9Y A;  2OU2 A;  2P6E A;  4KVM E;  3TE4 A;  2VI7 A;  1IYK A;  4IF5 A;  4MFL A;  4NF1 A;  4H6U A;  2HV2 A;  2B4D B;  1S7N A;  2AE6 A;  4JLY A;  5IX3 A;  4PV6 A;  3NE7 A;  4QUS A;  3G8W A;  5IV0 A;  3H4Q A;  3TO6 A;  3T90 A;  2QML A;  3FYN A;  4MFZ A;  1RO5 A;  2Z3L A;  2J8R A;  2OB0 A;  2FCK A;  1IIC A;  1S3Z A;  4UCM A;  5DWN A;  2ZXV A;  4CAV A;  3D8P A;  5H86 A;  2JDC A;  2ZW5 A;  5AG7 A;  1IB1 E;  1VKC A;  4C2Y A;  2YNE A;  3QB8 A;  5IB0 A;  4B5P A;  2EUI A;  5KTA A;  4L8A A;  4NEX A;  2QEC A;  2BEI A;  4RS2 A;  4ORF A;  4ONU A;  2D4O A;  1KUY A;  3EFA A;  1Y9K A;  4M3S A;  3EC4 A;  3PP9 A;  4MHD A;  1NSL A;  4R3L A;  4UCN A;  3FRM A;  1Y9W A;  4CGP A;  4C7H A;  3LOD A;  2J8M A;  4H89 A;  4XPK A;  2Z3P A;  2YGW A;  1QSN A;  4MFP A;  4UFV A;  3N7Z A;  4JJX A;  2C27 A;  3TO9 A;  4C2X A;  3H5Z A;  3TO7 A;  3FIX A;  2Z3O A;  2X7B A;  2VEZ A;  1Q2D A;  4CRZ B;  2DXQ A;  3W6X A;  4M85 A;  4OAE A;  5EC4 A;  4PK2 A;  4A32 A;  3D2M A;  3OWC A;  4MJ8 A;  1S60 A;  2JLM A;  4GS4 A;  1BO4 A;  1N71 A;  4F6A A;  4KOV A;  5G1Z A;  2FSR A;  4C2Z A;  4KLV A;  3A9L A;  4K30 A;  4A30 A;  3FNC A;  3V8I A;  1I21 A;  3JUW A;  1ZO0 A;  1VHS A;  1BOB A;  5I0C A;  1YK3 A;  4X5K A;  5A27 A;  5AG6 A;  4JXQ A;  5AG5 A;  2WPW A;  2K5T A;  1MK4 A;  2CNM A;  4UCP A;  2FIA A;  2ARH A;  3PGP A;  3IGR A;  4LUA A;  3F0A A;  4NSQ A;  4ZBG A;  2I79 A;  5F47 A;  3K9U A;  2AJ6 A;  4BBH A;  2RC4 A;  4R57 A;  2Q4Y A;  2FT0 A;  4NXY A;  5J8F A;  2GE3 A;  1QSR A;  1IID A;  1Y7R A;  4II9 A;  1KUV A;  1OZP A;  5DWM A;  4CGN A;  5ISV A;  4XPD B;  3JVN A;  2YNC C;  4HKF A;  4NCZ A;  4B5P B;  1XMT A;  2B3U A;  1Z4E A;  3QAH A;  4MBU A;  2Q44 A;  2I00 A;  2FE7 A;  4HNY B;  3P2H A;  3S6F A;  1Q2Y A;  2HQY A;  3TFY A;  3IU2 A;  2Z0Z A;  5C88 A;  3BJ8 A;  3IWE A;  4EVY A;  1M44 A;  2ZPA A;  1P0H A;  4AG9 A;  2H5M A;  4FD4 A;  1PUA A;  2Y0M A;  3BLN A;  4CRY B;  4DNC A;  1TIQ A;  3SXN A;  4PSX A;  3DNS A;  3ZJ0 A;  4AVB A;  3D2P A;  5GCN A;  2Q7B A;  5KTC A;  4OLL A;  1LRZ A;  4Q38 A;  3P2F A;  4HNW B;  4FD7 A;  3MGD A;  2P6F A;  2B5G A;  3PZJ A;  1MJ9 A;  4FD5 A;  2FS5 A;  3W6S A;  1S7K A;  4L89 A;  2D4P A;  4R3K A;  3B8G A;  2B58 A;  2WUU A;  4U5Y A;  4A31 A;  1YVO A;  4XPD C;  2EVN A;  2Z3M A;  3TOB A;  3FBU A;  3CXS A;  3DSB A;  3VWE A;  2OZU A;  3E0K A;  4UBR A;  1Z4R A;  2Z3N A;  4KSF A;  4CGL A;  4CAW A;  5CNP A;  2G0B A;  4QB9 A;  4B13 A;  1SQH A;  4KOY A;  4J3G A;  2ATR A;  4OAD A;  4JD6 A;  3W91 A;  3SXO A;  4JXR A;  1FY7 A;  3IU1 A;  1I12 A;  4CYP A;  4ZGY B;  2VBQ A;  3DR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...