4NF6A

Crystal structure of glun1/glun2a ligand-binding domain in complex with glycine and ppda
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
287
structure length
278
Chain Sequence
TRLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPVKKVICTGPNHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into Competitive Antagonism in NMDA Receptors.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein, receptor
molecule keywords Glutamate receptor ionotropic, NMDA 1
total genus 82
structure length 278
sequence length 287
ec nomenclature
pdb deposition date 2013-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4nf6A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4nf6A02
3OOAA 1I69A 3ZKLA 1EZPA 4DCXA 1PB8A 3EQ1A 3C33A 1SVXB 3RN8A 3FJGA 3O66A 1SW1A 2UVJA 3K1PA 4OMBA 5IAIA 1H44A 4MBPA 4F1YA 3CG1A 1Q35A 2VD3A 3MVZA 2VD2A 5CRYA 1FTJA 3IO4A 1B3HA 1LSTA 2UVHA 2HZLA 3TAJA 4FIMA 2ZYMA 1LCTA 3N5LA 4GFRA 3JV9A 2XX8A 3OD7A 3CFLA 4KCCA 1URGA 2OCUA 4LQ5A 4IY5A 5KDTB 1VR5A 5AA2A 1UQWA 2QPQA 1D3KA 2UVGA 3IB1A 3E3KA 1PEBA 4Q8RA 1ZJLA 1EZ9A 1DPPA 1T0KA 3IOUA 5H8FB 2PX1A 3RGYA 4X48A 5K2YA 4F29A 2Q89A 1II5A 1RKMA 3GLBA 4OXVA 1BIYA 1UIUA 1P1WA 3DM0A 3H6UA 3MBPA 3VLWA 3C4MA 5EHSA 1GV8A 3ZSFA 2UYEA 2Q2CA 2XXXA 1BLFA 2Y84A 3C34A 3L6HA 3PD8A 4H8JA 3RTFB 4ZE8A 3FUZA 4OHNA 1IITA 1GTKA 3W9VA 3VLUA 4ZEIA 3TTRA 2BJJX 2ABHA 2XXTA 4G8NA 4EUOA 2D3IA 3JZJA 5DVFA 1NL5A 3TCFA 3H6VA 4JWXA 3FJ7A 2ZYOA 3FV2A 1FQEA 3D4CA 1VFEA 4FEDA 4TQUQ 1I6AA 3PUYE 2OWTA 2I4CA 3FASA 3DP6A 3KSJA 4GXSB 4IGRA 4P0GA 4U4SA 2RF1A 3OEKA 4MF3A 5A5XA 1B4HA 1UIVA 3G3KA 1ANFA 2O68A 1MXWA 4TLMB 2V3TA 4BDRA 1IXCA 1LGBC 1CB6A 2ALUA 2IA4A 3HSTA 4GOTA 3C32A 1VSOA 4H5GA 3SEVA 3IR1A 4UACA 3A3UA 1N7WA 4F1VA 1EH3A 2I0CA 1MQIA 4LA9A 5H8NB 2XX7A 4IO5A 4RK2A 3S4UA 3VDFA 2OWSA 2Y7IA 4YB5A 4F19A 3BFUA 1ZTYA 3K6WA 3KG2A 3ONMA 5CMBA 5ELVA 5I84A 1JETA 1B2HA 1H76A 1B5HA 2F5XA 4OTEA 3S2VA 3TTMA 1B32A 1S9TA 3H4ZA 4KYDA 1IXIA 1NNTA 2B65A 3CSBA 3IAZA 3OSRA 4O3AA 2NXOA 5CMMA 5L9MA 3MZ1A 2Z8EA 3KN3A 3R6UA 1R9LA 4H1XA 2O1MA 4NF8A 5TP9B 5H8NA 4GQOA 3SERA 1KWHA 2F7AA 4KI0E 4F3PA 4Q30B 3BBRA 3K1NA 1NH8A 3QIMA 2B3FA 3CR9A 2QSXA 4POXA 3TQLA 1LBBA 4OYVA 2Z8FA 4YZZA 3ECRA 2XHDA 3T22A 4L17A 4ZEDA 3ZS6A 2NWJA 2X7PA 1GVCA 1YPNA 4DZ1A 4F3BA 5DVIA 3PUXE 1HSEA 3FXRA 3FVGA 3VV5A 1B05A 3G7WA 2F8DA 2H5YA 2ZNTA 4O3CA 5DT6A 3S9LC 1B58A 3GBBA 4R72A 3MP8A 1B7HA 3Q29A 2G29A 3G3JA 2VOZA 4LQ2A 4U4XA 3TCHA 4F3GA 1MM7A 2Z22A 1HSLA 3O6HA 4OETA 1B6HA 3RPWA 2QS3A 4HS7A 1BTJA 4MLQA 4C1TA 3QYTA 4C0RA 2HAVA 1FQAA 1SQYA 3U8QA 1PBQA 5CBSA 1NNFA 2F34A 1IUDA 4YB6A 5I56A 4UA8A 1IIWA 2AL5A 4YICA 2REJA 2I3WA 1TFAA 2FNCA 2OBGA 3UIFA 3MVYA 4YB7A 2REGA 4IO2A 3T93B 3I3VA 2H4IA 3C36A 3TZAA 1MPCA 3S9NC 1IQ7A 3IJXB 4YU0A 2F7BA 3FXQA 3LR1A 5I58B 3KZGA 3PV0E 2H25A 5I2KA 1WODA 1BKAA 1D9YA 5KDTA 4JXIA 4ZECA 3MVWA 1SI1A 3OO7A 1B1XA 2RKMA 3PUZE 4N13A 1MDQA 5ITOA 3LSWA 2DS9A 1JW4A 4GF8A 2X26A 4ZS9A 4JDFA 2H98A 2V93A 3K02A 4R73A 2DXYA 3VVFA 1FTLA 2YJPA 4JWYA 4NF5B 4U21A 3TMGA 4ELRA 4GVOA 1LFGA 4FAJA 3T9VA 2O1LA 4G68A 4GWOA 4P0IA 2RC7A 1OIBA 4OFOA 1UTBB 4NWCA 5M2VA 1USYH 4LONB 4Z7EA 4QHQA 4OQOA 4RXLA 3IJOB 5KCJA 1ZKBA 2D5WA 3WAEA 1N3XA 1N84A 1J1NA 1XVYA 3B6WA 2DWHA 4FEBA 2P1SA 3PUVE 5H8QB 5CM6A 1O63A 3CVGA 5EYFA 4LUBA 4ZZEA 3IX1A 5AA1A 4OEVA 4PE5B 3SETA 3TYHA 1M5EA 1XOCA 3U94A 2RCAA 4RY1A 5H8FA 4OWDA 1ZIUA 4WEPA 4O3BA 2IEEA 1MM6A 3UA8A 4ELOA 3IO6A 1H43A 1LB9A 2KLFA 1AH5A 3OXNA 3O29A 5TPAB 1FTKA 2ZMBA 4Q5TA 1O64A 3ZKKA 2ZYKA 1N0TA 3EHUA 3K1MA 3KFMA 4LVQA 2HCAA 3P7IA 4YKIA 1DTGA 4QFKA 4F2QA 3O2AA 1WVJA 1UTHB 2PBWA 4KPTA 4ZEKA 1PB9A 3TFLA 3VXCA 4HW8A 4DE8A 1ZBMA 3G3GA 3HHGA 1N7XA 3ILTB 2O6AA 4NE4A 2O84X 3HO7A 3FZVA 3Q25A 3TTNA 3IL1B 2QRYA 1RYXA 4EDPA 3QUFA 2YPNA 1URSA 1WDNA 3K6VA 4I1DA 2F6GA 2ZNUA 3LSLA 1A54A 3VE1B 1ZU0A 3HCQA 3N94A 3OO6A 3VVEA 1H45A 5I2NA 3T9UA 4ZEBA 5FHMA 4KCDA 5FHOA 1MXZA 1Q1KA 1B3LA 1QULA 1Y3PA 3HHFA 4R74A 4ELQA 4F39A 4NF6B 1IZ1A 4GIZA 3G3IA 1S7YA 3TKDA 2QS1A 4NF4A 2YLNA 3CRBA 3FVKA 4OERA 2VP1A 3H3GA 2H99A 1JQFA 4U23A 3U92A 4BDMA 1QKBA 3MUQA 3PGFA 4R75A 1OLAA 4QFOA 2DXRA 2PT1A 2F36A 3PMVA 2DYXA 4JSDA 4GXAA 1M5CA 3VVDA 2XXWA 1GGGA 1QJMA 2DE2A 2O69A 3EF7A 3PPRA 4WEDA 5EHMA 4ZEFA 3V83A 4POWA 2F6PA 4HCYA 5DTBA 5HBCA 2XXVA 4PP0A 2HQ0A 3V5AA 2X7QA 2HAUA 3PPPA 5ISUA 3USDA 1N04A 3QAXA 4PFTA 1S50A 3SDFA 2F35A 2Y7WA 3TTLA 4QF9A 4F18A 1YTVA 3TPAA 4NWDA 5CMKA 1DPEA 1MG1A 1AOVA 1LLSA 2XD2A 1O7TA 1URDA 2O7UA 3Q27A 3SEUA 3F11A 2E1SA 4X1BA 1SD3A 5K2XA 3SEYA 1SI0A 3IOVA 5AA4B 2HXWA 4U2RA 4RPOA 4TLLB 3CIJA 1MPBA 3DP8A 1OVBA 4RA1A 2DVZA 2Q88A 3E9XA 3IB0A 5DEXB 3M3FA 3QUJA 1A7LA 4N6PA 2Z23A 2D21A 1JEVA 1MDP1 1SYIA 3I6VA 3MZBA 4GRKA 4MFIA 4OESA 1XVXA 4LP2B 3UK4A 5F1QA 3V89B 4R2BA 2Y7RA 1JW1A 1P1UA 1MY1A 2V3QA 3K00A 3RUMA 1B3GA 2QS2A 2F78A 4WXJA 2I6EA 3LUYA 3PUWE 2DE3A 2I48A 3K6XA 5H8SA 1L5TA 2NVUB 3UP9A 5DEXA 3FV1A 3PMXA 4Z0IA 3IOWA 1P1NA 3K0VA 2A5TA 3EHSA 3O97A 2PMSA 4PFWA 3H03A 1B40A 3C31A 4ELPA 2GRVA 5J1DA 1QKAA 4G77A 4OEUA 4FECA 4YKKA 2GH9A 4E0WA 5I59A 3MW0A 2AYSA 1P99A 4HCWA 3T96B 1F9BA 4K3FA 4PFUA 4QRZA 4BDNA 3H06B 4ECFA 2RINA 4PQJA 3B7DA 1PB7A 3IB2A 1VFDA 4WKMA 1H3DA 1XHYA 1MQHA 4AB6A 3FGSA 2AL4A 4P11A 2O7IA 4I62A 1FTOA 2OLBA 1I6BA 1LFIA 4OZ9A 4F31B 1B7ZA 1FQDA 1R1NA 1B5JA 1JNFA 2RC8A 4ISUA 3N26A 4THIA 2ONRA 1US5A 4BDLA 3MJNA 3TEPA 1B0LA 4QSCA 5F7VA 5H8HA 4XKRA 4U1OA 1A8FA 2NOOA 1OQHA 5BUUA 1QVSA 4NEDA 3QXMA 2ZYNA 1JVYA 2PVUA 3PPNA 1CE2A 5TPAA 3OENA 5CMCA 1B1HA 1Y9UA 5I57B 1SBPA 1ZLQA 1IXHA 3D4GA 3EPEA 1POY1 1FW0A 3FVNA 3LC8A 1B7UA 4G4PA 3K4UA 4IB2A 4NF5A 3K6UA 3OO8A 1B9JA 5JTYB 5DYHA 3UGWA 5L9SA 3S9MC 1TXFA 1Y3NA 2CMOA 4I8CA 1MY3A 4BDOA 2HFBA 1JW5A 1QUKA 1AMFA 1XS5A 2GHAA 1I6QA 2OZZA 3HPIA 3KOTA 2A5TB 2DWIA 2XXQA 3FD3A 3M3KA 3OO9A 1Y4CA 4NF4B 3KSXA 1SYHA 1NFTA 1N3WA 2QS4A 2DOJA 1OQGA 1Y20A 1RYOA 3FJMA 1B0HA 3MC2A 3N6UA 5DVJA 4EQ7A 4GLIA 3C9HA 4IO7A 4RNSA 1FCKA 1OVTA 3U93A 2PT2A 3MWBA 3MPKA 3QK6A 1MY2A 4H0WA 1MXVA 4OENA 4R2FA 3TELA 1MQJA 2DP8A 5AA2B 5B70A 3GXAA 4I9DA 3H6WA 3B6TA 1FQBA 1D4NA 4G8MA 4R9FA 3QSLA 1D9VA 1YCJA 5FTIA 4AQ4A 4EQBA 1ELJA 5H8HB 3B6QA 1MQDA 4YAHX 4ZE9A 2DSFA 3OSQA 5L9OA 1B52A 2GHBA 2V3UA 3RTWB 2QMWA 3TCGA 5L8DA 4YKJA 4DIGA 4DXBA 2I58A 3CG3A 4OFJA 4XIGQ 3PPQA 3L6GA 4LATA 3VXBA 1NKXA 4YMBA 5AA4A 1B3EA 4XKQA 4H67A 4EXKA 2XXUA 5FTHA 3ILUB 1NNPA 1P1OA 2RC9A 1A55A 4OFLA 3TTKA 4GL0A 3CSGA 4F2OA 2DE4A 1OMPA 2DQVA 3MAMA 1DSNA 3SESA 3E13X 3FVOA 3BFTA 3CI8A 3H7MA 3KGCA 4RPNA 4ZZAA 4EXLA 2XXYA 2F97A 2VHAA 1QW0A 2I49A 1ATGA 3K2DA 4JB7A 2QL3A 3KN7A 3RNNA 2XXPA 5AA2D 2DVCA 1JVXA 2B3BA 3T9XB 3MPLA 1SDXA 4E0XA 2M8CA 1N76A 3Q26A 4F1UA 4IO6A 1JEUA 3TUSA 4G68B 2XX9A 5TU0A 2V84A 3Q28A 3SEWA 1TFDA 3OELA 2ANJA 1B46A 1FQCA 1PC3A 2CZLA 2UVIA 3MP6A 4OVJA 3WAFA 2HZKA 4AB5A 4DCYA 5IKBA 4BLAA 1R6ZA 1Y3QA 3DLNA 1MXYA 4H65A 4KYSA 4MH5A 1MQGA 4QSDA 2HEUA 5I59B 4RJZA 1A99A 1YAEA 3MP1A 4NF6A 1PBPA 2UXAA 3MVXA 3KOSA 2I0BA 2F7CA 2P2AA 3KJ7A 2W7YA 5KZTA 2R6GE 3FATA 4ESWA 1NMUA 1BP5A 1UTHA 1DTZA 1Y4TA 3A3CA 5I2NB 3O9PA 4KYEA 1EU8A 3TDJA 5JEIA 3OMBA 3SEXA 3W9WA 2ZNSA 3G3HA 1DMBA 1Y1ZA 3AXFA 4TOZA 1FQFA 4KHZE 4FORA 4XKPA 4DXUA 4GL8A 4YKPA 1POTA 2R9JA 4HTGA 1A40A 4NF8B 4KD5A 3RT6B 3PPOA 5HPQA 3E4RA 2NUVA 2AIXA 4NTLA 4DDDA 1LAXA 1PDAA 4KFQA 3R7XA 3KN8A 4X9TA 3RQTA 1Y1MA 1IXGA 2Y7KA 1LB8A 3KBRA 2XD3A 3MQ9A 5ITPA 4DXCA 4LZ5A 3N6TA 4R6YA 5CC2A 4RYAA 4GD5A 1M5BA 4EQ9A 3CFXA 4ESXA 2A5SA 4FATA 1UTBA 2P0SA 4R9GA 3THIA 1HSJA 1QUIA 3K01A 3RLFE 3TODA 2UYFA 4H8IA 1AIVA 3CFZA 2LAOA 3TQWA 1B4ZA 3V8XB 1MPDA 3IORA 2ZXTA 3M8UA 4BDQA 2ONSA 4N07A 1MS7A 2ESNA 4Q0CA 4EF2A 5CBRA 2XXIA 1NNKA 4G2ZA 4H6DA 3UORA 5ICTA 2PYYA 1US4A 2R71A 4QSEA 3HN0A 2Q8JA 1P1QA 1ZMGA 2QMXA 1QUJA 2RCBA 4DLDA 2OK2A 1MXUA 3BKIB 3IK6B 4ZDMA 5HM4B 4EF1A 3FIRA 3DELB 4H5FA 4F22A 3RY3A 2ONKE 5CI5A 1IEJA 5TP9A 1M5FA 4G8HA 1R9QA 5FHNA 4U1ZA 1B3FA 5ICQA 4X1DA 4ND9A 3U72A 1OLCA 1VE4A 2QJEA 2G93A 4PFYA 3O28A 3VLVA 2I4BA 2Q2AA 3OEMA 2DWAA 1MRPA 3O6IA 4JSOA 4R6KA 2VGQA 3EHTA 2FYIA 5I2KB 4XTCQ 3G3FA 4IO3A 5JTYA 4QFNA 3JYRA 2I3VA 2THIA 5KCJB 2XXRA 1MH4A 1GR2A 1XT8A 3O6GA 4JWOA 1Z7ME 3S9EA 4MLVA 4RK9A 4PETA 4NMYA 1B51A 3M3LA 4G68C 3H6TA 3R26A 2WKYA 4XKNA 3U1OA 5I57A 1XC1A 3KJTA 4R6HA 1AL3A 3GZGA 5LOMA 1SW4A 3EN3A 3ODBA 4IO4A 2Y7PA 4LZ7A 1MY0A 4QFLA 1LCFA 2O51A 3DP4A 3PD9A 1Z7NE 3HV1A 2GFEA 1MY4A 3A09A 3GBAA 4LZ8A 1SW5A 4ONYA 1LAHE 3T66A 3VFJA 5A5XB 4FE8A 1LAFE 4KQPA 4U22A 3PMWA 1M5DA 3MZ9A 4QFPA 4C1UA 3RT8A 1B5IA 3PU5A 1MXXA 1A8EA 1NH7A 1LBCA 1LAGE 2Z8DA 5I58A 4FJPA 1SW2A 5H8QA 4IGTA 5AE4A 2Q9TA 5BWJA 1EZOA 2E0SA 2V25A 3KEIA 4M1VA 1DOTA 1TT1A 4F3SA 2XXHA 3LSFB 1TWYA 1USYE 1LFHA 3FXUA 3C35A 2H9BA 5AA3A 4KR5A 4JBZA 2DWJA 3SKPA 3I5OA 4YMAA 3LSXA 3UN6A 5B7DA 1FTMA 2FA7A 3LBSA 5I56B 3IOTA 4XXUA 4IY6A 1MH3A 2OJTA 3T9HB 4M4GA 5JK4A 3W15C
chains in the Genus database with same CATH superfamily
3ZKLA 4DCXA 3EQ1A 2FBPA 2UVJA 4F1YA 2QFLA 3CG1A 1RDXA 2VD3A 2UVHA 4FIMA 2ZYMA 3OD7A 4KCCA 1UQWA 3IB1A 2Q74A 1ZJLA 5H8FB 2PX1A 4F29A 2Q89A 1II5A 3GLBA 4OXVA 1UIUA 1P1WA 2Y84A 2XXXA 4H8JA 4GX3A 2XXTA 4G8NA 4I3EA 3TCFA 1VFEA 4FEDA 4YU0A 3PUYE 2OWTA 2WYKA 3FASA 4P0GA 4O8MA 3OEKA 1UIVA 1IXCA 3SEVA 2ALUA 2IA4A 3HSTA 4H5GA 2XWIA 3RPLA 3ROJA 1EH3A 2XX7A 4IO5A 3S4UA 3VDFA 2OWSA 5ELVA 5I84A 1JETA 1H76A 1B5HA 2F5XA 3TTMA 1B32A 3H4ZA 1IXIA 1NNTA 3OSRA 5IZ3A 2Z8EA 1R9LA 2O1MA 3SERA 4KI0E 2B3FA 2QSXA 3ECRA 3ZS6A 2NWJA 2X7PA 1YPNA 3ISPA 4O7MA 3FXRA 1B05A 2H5YA 3BIGA 1B58A 3BIHA 3T0JA 4U4XA 1MM7A 4PC9A 4HS7A 4N81A 1SQYA 5I56A 4UA8A 2I3WA 3UIFA 2KQZA 4YB7A 4IO2A 3C36A 4KXPA 4GX4A 3KZGA 3PV0E 3LSWA 4ZS9A 2V93A 2CEYA 4FAJA 2O1LA 4G68A 4GWOA 1USYH 4OQOA 1N84A 3QMFA 1O63A 3MYUA 3SETA 4ZZEA 5AA1A 4OEVA 3TYHA 4OWDA 2IEEA 1NV6A 3IO6A 2WBBA 5TPAB 3ZKKA 2ZYKA 3P7IA 1WVJA 3TFLA 4HW8A 3HHGA 4NE4A 3HO7A 3FZVA 5IZ3B 3QUFA 3K6VA 2ZNUA 3N94A 4KCDA 1QULA 1B3LA 3HHFA 4ELQA 3TKDA 1S7YA 4NF4A 2YLNA 5EQ9A 4MNIA 1NV2A 1JQFA 3PGFA 1M5CA 3VVDA 4WEDA 3V5AA 5EQAA 5ISUA 1S50A 3SDFA 2F35A 3TTLA 4F18A 3TPAA 1MG1A 1AOVA 5LDZA 1URDA 2O7UA 4X1BA 4U2RA 1OVBA 3E9XA 3IB0A 5DEXB 4N6PA 3MZBA 2D21A 1JEVA 1JW1A 3RUMA 2QS2A 4PCDA 3LUYA 2DE3A 3K6XA 5DEXA 3O97A 4MMPA 3LUZA 1B40A 2GRVA 4G77A 4OEUA 4E0WA 3MW0A 3T96B 1P99A 4HCWA 2FIXA 1LBXA 3B7DA 1DCUA 1XHYA 4OVSA 2AL4A 4N8YA 4OZ9A 1LFIA 4THIA 2ONRA 3TEPA 2ZYNA 1JVYA 5CMCA 1B1HA 1Y9UA 1SBPA 4G4PA 4IB2A 3FVNA 4NF6A 1B7UA 5JTYB 3S9MC 5L9SA 3OO8A 2CMOA 1QUKA 2GHAA 2OZZA 4JVDA 5JK4A 1Y4CA 1SYHA 1N3WA 1OQGA 1B0HA 4IO7A 3U93A 4H0WA 5B70A 3GXAA 3H6WA 3B6TA 1D4NA 4R9FA 1D9VA 1MQDA 4YAHX 4GBWA 1IMAA 3RTWB 4DIGA 4PAFA 3PPQA 3L6GA 4H67A 5FTHA 1A55A 4OFLA 4F2OA 3MAMA 4RPNA 3CI8A 2F97A 4JB7A 1ATGA 5AA2D 2QL3A 2XXPA 2JJKA 1SDXA 4E0XA 2M8CA 1JEUA 3Q28A 1G0HA 1B46A 4DCYA 4AB5A 5IKBA 5EQ7A 1MQGA 4UABA 3MVXA 3KOSA 2F7CA 3FATA 4ESWA 1UTHA 1Y4TA 3A3CA 5I2NB 3O9PA 2CZHA 4PTKA 2ZNSA 1Y1ZA 4KHZE 4YKPA 5HPQA 4NF8B 3PPOA 4GBVA 4NTLA 4DDDA 1LAXA 4KFQA 2Y5KA 1IXGA 2WYPA 2XD3A 4DXCA 4LZ5A 4ESXA 4EQ9A 3CFXA 1UTBA 2ZZXA 4HE1A 4MIJA 1DK4A 2UYFA 4H8IA 3TQWA 1MPDA 2ZXTA 4BDQA 1NNKA 3KC0A 2XWKA 3HN0A 2OK2A 3BKIB 4ZDMA 3FIRA 3DELB 2ONKE 1IEJA 1M5FA 5FHNA 4X1DA 4JSOA 2DWAA 4JVCA 3S9EA 4RK9A 3R26A 2XWOA 3B50A 5LOMA 3EN3A 1LCFA 2O51A 2GFEA 3A09A 3T66A 3VFJA 4U22A 3PMWA 3MZ9A 4QFPA 1B5IA 2XWVA 1NH7A 1LBCA 2Z8DA 4GX6A 1SW2A 3KEIA 1TT1A 2XXHA 1LFHA 5AA3A 4KR5A 3I5OA 2FA7A 3IOTA 5LTCA 2OJTA 4M4GA 1NUWA 1EZPA 1PB8A 2FIEA 3FJGA 1H44A 3MVZA 2VD2A 1B3HA 1LSTA 4P9KA 3CFLA 4XFEA 2OCUA 5KDTB 1VR5A 5AA2A 1PEBA 1RKMA 3CHGA 3DM0A 3ZSFA 1GV8A 3C34A 3RTFB 1IITA 1GTKA 3TTRA 2BJJX 1FBCA 2ABHA 2D3IA 2DDKA 1NL5A 4PFBA 3FJ7A 3FV2A 1FQEA 4TQUQ 1I6AA 3KSJA 2I4CA 4GXSB 4MF3A 5A5XA 3G3KA 1LBVA 3IR1A 4YB5A 3K6WA 3KG2A 5CMBA 1B2HA 4OTEA 4KYDA 5CMMA 3CSBA 3MZ1A 5JEIA 3KN3A 4NF8A 5H8NA 1KWHA 4Q30B 3BBRA 2Z8FA 4YZZA 2XHDA 4ZEDA 3FVGA 3GBBA 4GWUA 3Q29A 3G3JA 2VOZA 4GWXA 4OETA 1B6HA 3QYTA 3U8QA 5CBSA 1IUDA 2AL5A 4YICA 2REJA 1TFAA 3SZPA 3MVYA 2H4IA 3TZAA 4OANA 3IJXB 3LR1A 5I58B 5I2KA 3OO7A 5ITOA 3PUZE 2RKMA 2X26A 4AS5A 4JDFA 2H98A 3K02A 4R73A 2DXYA 1FTLA 5I3SA 4ELRA 4GVOA 1LFGA 4P0IA 2RC7A 4OFOA 1UTBB 4LONB 4QHQA 4RXLA 3IJOB 4PBHA 4PDHA 1ZKBA 2D5WA 2DWHA 2P1SA 5CM6A 5H8FA 4WEPA 1H43A 1LB9A 3OXNA 3KFMA 2HCAA 3O2AA 5J16A 4KPTA 1UTHB 3VXCA 4ZEKA 1YXIA 1ZBMA 2O6AA 3Q25A 3IL1B 2YPNA 4I1DA 1KZ8A 3LSLA 2WX9A 2OX3A 1H45A 5EYHA 3T9UA 4ZEBA 5FHMA 1MXZA 1Q1KA 1Y3PA 1IZ1A 4GIZA 4OERA 2VP1A 2H99A 1QKBA 1QJMA 1QGXA 3V83A 2F6PA 5DTBA 2XXVA 1FBPA 4MAGA 2X7QA 3PTYA 2QVVA 3QAXA 2Y7WA 1LLSA 2XD2A 3Q27A 3SEUA 3F11A 2E1SA 1SD3A 3IOVA 5AA4B 4QBAA 3DP8A 4RA1A 2DVZA 3QUJA 1A7LA 3V89B 2Y7RA 1B3GA 4H46A 2I6EA 4N4UA 2I48A 5H8SA 2NVUB 1FPBA 4FBPA 1P1NA 4PFWA 2A5TA 3EHSA 5I59A 1LBYA 4G61A 4ELPA 5J1DA 1QKAA 4PF6A 4YKKA 2GH9A 4MHFA 2RINA 1PB7A 3IB2A 1H3DA 4P1LA 1AWBA 4P11A 2O7IA 4I62A 1FBFA 1I6BA 1B7ZA 1R1NA 4ISUA 3N26A 1SPIA 1US5A 3MJNA 1B0LA 4NEDA 2PVUA 2R8TA 3OENA 5I57B 3D4GA 3K6UA 1Y3NA 1MY3A 1JW5A 1AMFA 3D1RA 4XF5A 1I6QA 1L5TA 3OO9A 2XXQA 4HE2A 4NF4B 1NFTA 3FJMA 3MC2A 1Y20A 1RYOA 1FPGA 4GLIA 3MPKA 1K9YA 4OENA 4F1UA 1MXVA 1MQJA 4G8MA 2BJIA 3QSLA 1YCJA 4EQBA 4AQ4A 5H8HB 2DSFA 1K9ZA 3OSQA 5L9OA 1B52A 2GHBA 4DXBA 2QMWA 5L8DA 4YMBA 3VXBA 4LATA 1NKXA 2XXUA 4NGUA 3ILUB 4P56A 4AS4A 3CSGA 2DE4A 1OMPA 3SESA 4ZZAA 2XXYA 3RNNA 3K2DA 3KN7A 4IO6A 4G68B 2XX9A 3OELA 2UVIA 3WAFA 2B4LA 4MH5A 1Y3QA 4KYSA 2HEUA 1YAEA 3MP1A 2UXAA 2I0BA 2HPGA 4NG7A 2P2AA 3KJ7A 2R6GE 1NMUA 3OMBA 4TOZA 3G3HA 4PFIA 3AXFA 1FQFA 4FORA 4XKPA 1POTA 1FPKA 4HTGA 1A40A 4KD5A 2B4MA 2NUVA 3R7XA 3KN8A 3N6TA 4R6YA 4RYAA 2A5SA 2P0SA 4R9GA 1HSJA 1QUIA 3K01A 3V8XB 1B4ZA 2ESNA 4PGPA 1US4A 3T1BA 1P1QA 2P3NA 1ZMGA 2QMXA 4DLDA 3IK6B 1BK4A 4H5FA 4G8HA 1R9QA 2ZZWA 1OLCA 4PFYA 3O28A 3O6IA 4N17A 3EHTA 1GR2A 1XT8A 4JWOA 4MLVA 4PETA 2VPNA 3M3LA 3H6TA 4XKNA 3U1OA 1FJ6A 1XC1A 3KJTA 1FSAA 4IO4A 2Y7PA 4LZ7A 1NV1A 3IFAA 1Z7NE 3HV1A 3GBAA 4ONYA 1SW5A 1MXXA 4N8GA 1FBHA 1LAGE 5I58A 5H8QA 4IGTA 2Q9TA 1EZOA 4M1VA 1DOTA 3LSFB 2H9BA 4PAIA 4JBZA 2DWJA 3LBSA 4IY6A 1FJ9A 3W15C 3OOAA 3K1PA 5IAIA 5CRYA 1FTJA 3IO4A 2HZLA 1LCTA 3N5LA 4GFRA 4IY5A 3E79A 1RDZA 1DPPA 1T0KA 4X48A 3H6UA 3MBPA 3C4MA 5EHSA 3KC1A 1BLFA 3PD8A 4ZE8A 3FUZA 3VLUA 4ZEIA 3KBZA 3JZJA 5DVFA 2ZYOA 3D4CA 4IGRA 4U4SA 2RF1A 1B4HA 4P3LA 1ANFA 2V3TA 3C32A 1VSOA 4UACA 3A3UA 4F1VA 5H8NB 2OWZA 4LA9A 4RK2A 4F19A 2Y7IA 1ZTYA 3S2VA 3R6UA 5TP9B 3W9VA 4H1XA 4GQOA 2F7AA 4F3PA 3K1NA 1NH8A 3QIMA 4POXA 3CR9A 3RPLB 4OYVA 3T22A 4DZ1A 1GVCA 2PFYA 4F3BA 5EQ8A 3VV5A 3G7WA 2F8DA 2ZNTA 4O3CA 5DT6A 3S9LC 4R72A 4LQ2A 3A29A 4MLQA 1FQAA 4XEQA 2QVRA 4YB6A 4X04A 1IIWA 2FNCA 2REGA 3T93B 1MPCA 1IQ7A 4P47A 4DI4B 2F7BA 3FXQA 1WODA 1BKAA 5KDTA 4JXIA 2F3DA 3NOHA 4ZECA 3MVWA 5I5PA 4OVTA 1MDQA 2DS9A 1JW4A 3HFUA 1NV5A 4GF8A 4PF8A 3VVFA 2YJPA 4GWYA 4NF5B 4U21A 3TMGA 4NWCA 5M2VA 4Z7EA 5KCJA 3WAEA 1N3XA 1J1NA 1XVYA 3B6WA 3PUVE 5EYFA 4BDNA 3IX1A 2CZKA 4OA4A 1XOCA 2MKZA 2RCAA 1ZIUA 1MM6A 3UA8A 4GWSA 1AH5A 2ZMBA 1O64A 1N0TA 5EYGA 3K1MA 4YKIA 1DTGA 2PBWA 1KA1A 4DE8A 2O84X 4JVIA 3TTNA 1RYXA 2QVUA 1URSA 2Q8MA 4PE3A 3VE1B 1ZU0A 3OO6A 4NAPA 5I2NA 4PAKA 1AIVA 4R74A 2VT5A 2P3VA 3FVKA 4LN5A 3U92A 1IMCA 4BDMA 3MUQA 1OLAA 2DXRA 2DYXA 2DE2A 3EF7A 4POWA 1FPIA 4HCYA 5HBCA 4PP0A 2HAUA 3PPPA 3USDA 4PFTA 1DBZA 4NWDA 5CMKA 1DPEA 5K2XA 3SEYA 2HXWA 1EYJA 1MPBA 3E78A 2Z23A 4GRKA 1MDP1 3I6VA 4NX1A 1XVXA 3UK4A 5F1QA 2CEXA 1P1UA 1EYKA 3PUWE 3MSTA 3U65A 5DW8A 3PMXA 2PMSA 3H03A 3GYYA 4FECA 4K3FA 4PFUA 4QRZA 4ECFA 2FHYA 5A5LA 1MQHA 4N15A 3FGSA 2OLBA 4F31B 1B5JA 1JNFA 5ESYA 5F7VA 4QSCA 5IM2A 2NOOA 5BUUA 5TPAA 3PPNA 4NQ8A 4QFLA 3EPEA 4NF5A 4IR8A 1TXFA 4I8CA 3FD3A 3KSXA 4GD5A 4EUOA 4EQ7A 1FCKA 1OVTA 3QK6A 5KZTA 2DP8A 1FQBA 2PCRA 1ELJA 3B6QA 1IMDA 3FXBA 1NV3A 2V3UA 4XIGQ 4OFJA 5AA4A 4EXKA 1NNPA 4FATA 4ELOA 1DSNA 3E13X 3H7MA 3BFTA 2VHAA 1QW0A 2I49A 5T3JA 1JVXA 2B3BA 3T9XB 1TFDA 2ANJA 1FQCA 1FBDA 2CZLA 2HZKA 4BLAA 3DLNA 4H65A 1MXYA 4MCOA 4QSDA 1FPFA 4RJZA 1A99A 1G0IA 1PBPA 2W7YA 1BP5A 1JP4A 1DTZA 4O7IA 1EU8A 3W9WA 1NUXA 1VDWA 4DXUA 2R9JA 4GWWA 1IMEA 2Y7KA 5ITPA 1FPEA 3IORA 4N07A 2XXIA 4H6DA 3UORA 5ICTA 2R71A 2RCBA 4EF1A 4F22A 3RY3A 5CI5A 4U1ZA 4ND9A 3U72A 2QJEA 2G93A 5F24A 2Q2AA 3OEMA 3VLVA 1MRPA 5I2KB 4XTCQ 3G3FA 4QFNA 3JYRA 5KCJB 1MH4A 2XA5A 1Z7ME 1B51A 2WKYA 4R6HA 1AL3A 3GZGA 1SW4A 1NV0A 3IFCA 4X8RA 1MY4A 5A5XB 1LAHE 4KQPA 1M5DA 4C1UA 5BWJA 2E0SA 3LV0A 4PBQA 3C35A 3SKPA 5B7DA 1FTMA 1MH3A 1I69A 3C33A 1SVXB 3RN8A 3O66A 1SW1A 4OMBA 4MBPA 1Q35A 1FPLA 3TAJA 3JV9A 2XX8A 1URGA 4LQ5A 2QPQA 1D3KA 2UVGA 3E3KA 1IMFA 4Q8RA 1EZ9A 3IOUA 3RGYA 4O94A 5K2YA 2V4CA 1BIYA 3VLWA 2UYEA 2Q2CA 3L6HA 4OHNA 1LBWA 3H6VA 4JWXA 1FTAA 3DP6A 2VPOA 1KA0A 4P1EA 2O68A 1MXWA 4TLMB 4BDRA 1LGBC 1CB6A 4GOTA 5AA2B 1YZ0A 1N7WA 2I0CA 4HXVA 1MQIA 4OVPA 3BFUA 3ONMA 1S9TA 2WEFA 2B65A 3IAZA 4O3AA 5L9MA 2NXOA 1NUYA 3TQLA 1LBBA 4L17A 5DVIA 3PUXE 1HSEA 1LBZA 2HHMA 3MP8A 1B7HA 2WBDA 2G29A 3TCHA 4F3GA 3EKIA 2Z22A 1HSLA 3O6HA 3RPWA 2QS3A 1BTJA 4C1TA 4C0RA 2HAVA 1PBQA 1NNFA 2F34A 5ET7A 2OBGA 3I3VA 3S9NC 1FRPA 2H25A 5I7IA 1D9YA 1SI1A 4N13A 1B1XA 1RDYA 4JWYA 4H45A 1CNQA 3T9VA 1OIBA 2PFZA 4FEBA 5H8QB 2L5VA 3CVGA 2ZZVA 4LUBA 3U94A 4PE5B 1M5EA 4RY1A 4O3BA 4NHBA 2KLFA 4PFRA 3O29A 1FTKA 4Q5TA 4OVQA 3EHUA 4LVQA 4QFKA 4F2QA 1PB9A 3G3GA 1N7XA 3ILTB 4NN3A 2QRYA 4EDPA 1FBEA 1WDNA 4I3YA 2F6GA 1A54A 3HCQA 3VVEA 5FHOA 3TUSA 4F39A 5IGAA 4NF6B 3G3IA 2QS1A 3CRBA 3H3GA 4U23A 4R75A 4QFOA 2PT1A 2F36A 2FVZA 3PMVA 4JSDA 4GXAA 2XXWA 1GGGA 2O69A 4ZEFA 3PPRA 5EHMA 3FBPA 2HQ0A 1N04A 4QF9A 1YTVA 2XXKA 1O7TA 5ET5A 1SI0A 4P8BA 4RPOA 4TLLB 3CIJA 2Q88A 3M3FA 4OESA 1SYIA 4MFIA 4LP2B 4R2BA 1FPJA 1MY1A 2V3QA 3K00A 2F78A 4WXJA 3UP9A 1NV7A 3FV1A 4Z0IA 1YYZA 3IOWA 3K0VA 3C31A 2AYSA 1F9BA 1Q9DA 3H06B 4N6DA 4PQJA 1VFDA 4WKMA 4AB6A 1FTOA 1FQDA 2RC8A 4PGNA 4BDLA 4GWZA 5H8HA 2Y5LA 4U1OA 1A8FA 1OQHA 1QVSA 3QXMA 1CE2A 4MNCA 1ZLQA 1IXHA 3LC8A 1POY1 1FW0A 5ET6A 3K4UA 3UGWA 5IZ1A 1B9JA 5DYHA 4BDOA 2HFBA 1XS5A 3KOTA 1NI9A 3HPIA 2A5TB 2DWIA 3M3KA 4XKRA 2QS4A 2DOJA 4N6KA 3N6UA 5DVJA 3B8BA 3C9HA 4RNSA 1NV4A 4R2FA 2PT2A 3MWBA 4MJOA 1MY2A 3TELA 5I57A 4I9DA 1IMBA 5FTIA 4DI3D 1FBGA 4MNPA 4ZE9A 2F3BA 3TCGA 4YKJA 2I58A 3CG3A 1INPA 4NF0A 1B3EA 4XKQA 4MEVA 1P1OA 2RC9A 4HE0A 4MX6A 3TTKA 4GL0A 2DQVA 4EXLA 3FVOA 3KGCA 1D9QA 2DVCA 3MPLA 4PDDA 3Q26A 1N76A 5TU0A 2V84A 3SEWA 1PC3A 3MP6A 4OVJA 1NUZA 1R6ZA 5I59B 2HXRA 2CZIA 4KYEA 3TDJA 3SEXA 2KR0A 1DMBA 4GL8A 1LEVA 3RT6B 3E4RA 2AIXA 4OVRA 1PDAA 3RQTA 4X9TA 1Y1MA 3MQ9A 3KBRA 1LB8A 1EYIA 5CC2A 1M5BA 3THIA 3RLFE 3TODA 5FBPA 3CFZA 2LAOA 3M8UA 2ONSA 4EF2A 1MS7A 4Q0CA 2GQ1A 5CBRA 4G2ZA 2PYYA 5ET8A 2Q8JA 1QUJA 1MXUA 5HM4B 5TP9A 1B3FA 5ICQA 1FPDA 1VE4A 2I4BA 4QXDA 4R6KA 2VGQA 2FYIA 5JTYA 4IO3A 3RYDA 2I3VA 2THIA 2XXRA 3O6GA 4NMYA 4G68C 4N91A 3ODBA 1MY0A 3DP4A 3PD9A 4LZ8A 4FE8A 1LAFE 3RT8A 3PU5A 1A8EA 4FJPA 5AE4A 2V25A 4F3SA 1TWYA 1USYE 3FXUA 4YMAA 3LSXA 3UN6A 4I40A 5I56B 5IZZA 1XI6A 3T9HB 4XXUA 4QSEA
chains in the Genus database with same CATH topology
3OOAA 1I69A 3ZKLA 1EZPA 4DCXA 1PB8A 3EQ1A 3C33A 1SVXB 3RN8A 3FJGA 3O66A 1SW1A 2UVJA 3K1PA 4OMBA 5IAIA 1H44A 4MBPA 4F1YA 3CG1A 1Q35A 2VD3A 3MVZA 2VD2A 5CRYA 1FTJA 3IO4A 1B3HA 1LSTA 2UVHA 2HZLA 3TAJA 4FIMA 2ZYMA 1LCTA 3N5LA 4GFRA 3JV9A 2XX8A 3OD7A 3CFLA 4KCCA 1URGA 2OCUA 4LQ5A 4IY5A 5KDTB 1VR5A 5AA2A 1UQWA 2QPQA 1D3KA 2UVGA 3IB1A 3E3KA 1PEBA 4Q8RA 1ZJLA 1EZ9A 1DPPA 1T0KA 3IOUA 5H8FB 2PX1A 3RGYA 4X48A 5K2YA 4F29A 2Q89A 1II5A 1RKMA 3GLBA 4OXVA 1BIYA 1UIUA 1P1WA 3DM0A 3H6UA 3MBPA 3VLWA 3C4MA 5EHSA 1GV8A 3ZSFA 2UYEA 2Q2CA 2XXXA 1BLFA 2Y84A 3C34A 3L6HA 3PD8A 4H8JA 3RTFB 4ZE8A 3FUZA 4OHNA 1IITA 1GTKA 3W9VA 3VLUA 4ZEIA 3TTRA 2BJJX 2ABHA 2XXTA 4G8NA 4EUOA 2D3IA 3JZJA 5DVFA 1NL5A 3TCFA 3H6VA 4JWXA 3FJ7A 2ZYOA 3FV2A 1FQEA 3D4CA 1VFEA 4FEDA 4TQUQ 1I6AA 3PUYE 2OWTA 2I4CA 3FASA 3DP6A 3KSJA 4GXSB 4IGRA 4P0GA 4U4SA 2RF1A 3OEKA 4MF3A 5A5XA 1B4HA 1UIVA 3G3KA 1ANFA 2O68A 1MXWA 4TLMB 2V3TA 4BDRA 1IXCA 1LGBC 1CB6A 2ALUA 2IA4A 3HSTA 4GOTA 3C32A 1VSOA 4H5GA 3SEVA 3IR1A 4UACA 3A3UA 1N7WA 4F1VA 1EH3A 2I0CA 1MQIA 4LA9A 5H8NB 2XX7A 4IO5A 4RK2A 3S4UA 3VDFA 2OWSA 2Y7IA 4YB5A 4F19A 3BFUA 1ZTYA 3K6WA 3KG2A 3ONMA 5CMBA 5ELVA 5I84A 1JETA 1B2HA 1H76A 1B5HA 2F5XA 4OTEA 3S2VA 3TTMA 1B32A 1S9TA 3H4ZA 4KYDA 1IXIA 1NNTA 2B65A 3CSBA 3IAZA 3OSRA 4O3AA 2NXOA 5CMMA 5L9MA 3MZ1A 2Z8EA 3KN3A 3R6UA 1R9LA 4H1XA 2O1MA 4NF8A 5TP9B 5H8NA 4GQOA 3SERA 1KWHA 2F7AA 4KI0E 4F3PA 4Q30B 3BBRA 3K1NA 1NH8A 3QIMA 2B3FA 3CR9A 2QSXA 4POXA 3TQLA 1LBBA 4OYVA 2Z8FA 4YZZA 3ECRA 2XHDA 3T22A 4L17A 4ZEDA 3ZS6A 2NWJA 2X7PA 1GVCA 1YPNA 4DZ1A 4F3BA 5DVIA 3PUXE 1HSEA 3FXRA 3FVGA 3VV5A 1B05A 3G7WA 2F8DA 2H5YA 2ZNTA 4O3CA 5DT6A 3S9LC 1B58A 3GBBA 4R72A 3MP8A 1B7HA 3Q29A 2G29A 3G3JA 2VOZA 4LQ2A 4U4XA 3TCHA 4F3GA 1MM7A 2Z22A 1HSLA 3O6HA 4OETA 1B6HA 3RPWA 2QS3A 4HS7A 1BTJA 4MLQA 4C1TA 3QYTA 4C0RA 2HAVA 1FQAA 1SQYA 3U8QA 1PBQA 5CBSA 1NNFA 2F34A 1IUDA 4YB6A 5I56A 4UA8A 1IIWA 2AL5A 4YICA 2REJA 2I3WA 1TFAA 2FNCA 2OBGA 3UIFA 3MVYA 4YB7A 2REGA 4IO2A 3T93B 3I3VA 2H4IA 3C36A 3TZAA 1MPCA 3S9NC 1IQ7A 3IJXB 4YU0A 2F7BA 3FXQA 3LR1A 5I58B 3KZGA 3PV0E 2H25A 5I2KA 1WODA 1BKAA 1D9YA 5KDTA 4JXIA 4ZECA 3MVWA 1SI1A 3OO7A 1B1XA 2RKMA 3PUZE 4N13A 1MDQA 5ITOA 3LSWA 2DS9A 1JW4A 4GF8A 2X26A 4ZS9A 4JDFA 2H98A 2V93A 3K02A 4R73A 2DXYA 3VVFA 1FTLA 2YJPA 4JWYA 4NF5B 4U21A 3TMGA 4ELRA 4GVOA 1LFGA 4FAJA 3T9VA 2O1LA 4G68A 4GWOA 4P0IA 2RC7A 1OIBA 4OFOA 1UTBB 4NWCA 5M2VA 1USYH 4LONB 4Z7EA 4QHQA 4OQOA 4RXLA 3IJOB 5KCJA 1ZKBA 2D5WA 3WAEA 1N3XA 1N84A 1J1NA 1XVYA 3B6WA 2DWHA 4FEBA 2P1SA 3PUVE 5H8QB 5CM6A 1O63A 3CVGA 5EYFA 4LUBA 4ZZEA 3IX1A 5AA1A 4OEVA 4PE5B 3SETA 3TYHA 1M5EA 1XOCA 3U94A 2RCAA 4RY1A 5H8FA 4OWDA 1ZIUA 4WEPA 4O3BA 2IEEA 1MM6A 3UA8A 4ELOA 3IO6A 1H43A 1LB9A 2KLFA 1AH5A 3OXNA 3O29A 5TPAB 1FTKA 2ZMBA 4Q5TA 1O64A 3ZKKA 2ZYKA 1N0TA 3EHUA 3K1MA 3KFMA 4LVQA 2HCAA 3P7IA 4YKIA 1DTGA 4QFKA 4F2QA 3O2AA 1WVJA 1UTHB 2PBWA 4KPTA 4ZEKA 1PB9A 3TFLA 3VXCA 4HW8A 4DE8A 1ZBMA 3G3GA 3HHGA 1N7XA 3ILTB 2O6AA 4NE4A 2O84X 3HO7A 3FZVA 3Q25A 3TTNA 3IL1B 2QRYA 1RYXA 4EDPA 3QUFA 2YPNA 1URSA 1WDNA 3K6VA 4I1DA 2F6GA 2ZNUA 3LSLA 1A54A 3VE1B 1ZU0A 3HCQA 3N94A 3OO6A 3VVEA 1H45A 5I2NA 3T9UA 4ZEBA 5FHMA 4KCDA 5FHOA 1MXZA 1Q1KA 1B3LA 1QULA 1Y3PA 3HHFA 4R74A 4ELQA 4F39A 4NF6B 1IZ1A 4GIZA 3G3IA 1S7YA 3TKDA 2QS1A 4NF4A 2YLNA 3CRBA 3FVKA 4OERA 2VP1A 3H3GA 2H99A 1JQFA 4U23A 3U92A 4BDMA 1QKBA 3MUQA 3PGFA 4R75A 1OLAA 4QFOA 2DXRA 2PT1A 2F36A 3PMVA 2DYXA 4JSDA 4GXAA 1M5CA 3VVDA 2XXWA 1GGGA 1QJMA 2DE2A 2O69A 3EF7A 3PPRA 4WEDA 5EHMA 4ZEFA 3V83A 4POWA 2F6PA 4HCYA 5DTBA 5HBCA 2XXVA 4PP0A 2HQ0A 3V5AA 2X7QA 2HAUA 3PPPA 5ISUA 3USDA 1N04A 3QAXA 4PFTA 1S50A 3SDFA 2F35A 2Y7WA 3TTLA 4QF9A 4F18A 1YTVA 3TPAA 4NWDA 5CMKA 1DPEA 1MG1A 1AOVA 1LLSA 2XD2A 1O7TA 1URDA 2O7UA 3Q27A 3SEUA 3F11A 2E1SA 4X1BA 1SD3A 5K2XA 3SEYA 1SI0A 3IOVA 5AA4B 2HXWA 4U2RA 4RPOA 4TLLB 3CIJA 1MPBA 3DP8A 1OVBA 4RA1A 2DVZA 2Q88A 3E9XA 3IB0A 5DEXB 3M3FA 3QUJA 1A7LA 4N6PA 2Z23A 2D21A 1JEVA 1MDP1 1SYIA 3I6VA 3MZBA 4GRKA 4MFIA 4OESA 1XVXA 4LP2B 3UK4A 5F1QA 3V89B 4R2BA 2Y7RA 1JW1A 1P1UA 1MY1A 2V3QA 3K00A 3RUMA 1B3GA 2QS2A 2F78A 4WXJA 2I6EA 3LUYA 3PUWE 2DE3A 2I48A 3K6XA 5H8SA 1L5TA 2NVUB 3UP9A 5DEXA 3FV1A 3PMXA 4Z0IA 3IOWA 1P1NA 3K0VA 2A5TA 3EHSA 3O97A 2PMSA 4PFWA 3H03A 1B40A 3C31A 4ELPA 2GRVA 5J1DA 1QKAA 4G77A 4OEUA 4FECA 4YKKA 2GH9A 4E0WA 5I59A 3MW0A 2AYSA 1P99A 4HCWA 3T96B 1F9BA 4K3FA 4PFUA 4QRZA 4BDNA 3H06B 4ECFA 2RINA 4PQJA 3B7DA 1PB7A 3IB2A 1VFDA 4WKMA 1H3DA 1XHYA 1MQHA 4AB6A 3FGSA 2AL4A 4P11A 2O7IA 4I62A 1FTOA 2OLBA 1I6BA 1LFIA 4OZ9A 4F31B 1B7ZA 1FQDA 1R1NA 1B5JA 1JNFA 2RC8A 4ISUA 3N26A 4THIA 2ONRA 1US5A 4BDLA 3MJNA 3TEPA 1B0LA 4QSCA 5F7VA 5H8HA 4XKRA 4U1OA 1A8FA 2NOOA 1OQHA 5BUUA 1QVSA 4NEDA 3QXMA 2ZYNA 1JVYA 2PVUA 3PPNA 1CE2A 5TPAA 3OENA 5CMCA 1B1HA 1Y9UA 5I57B 1SBPA 1ZLQA 1IXHA 3D4GA 3EPEA 1POY1 1FW0A 3FVNA 3LC8A 1B7UA 4G4PA 3K4UA 4IB2A 4NF5A 3K6UA 3OO8A 1B9JA 5JTYB 5DYHA 3UGWA 5L9SA 3S9MC 1TXFA 1Y3NA 2CMOA 4I8CA 1MY3A 4BDOA 2HFBA 1JW5A 1QUKA 1AMFA 1XS5A 2GHAA 1I6QA 2OZZA 3HPIA 3KOTA 2A5TB 2DWIA 2XXQA 3FD3A 3M3KA 3OO9A 1Y4CA 4NF4B 3KSXA 1SYHA 1NFTA 1N3WA 2QS4A 2DOJA 1OQGA 1Y20A 1RYOA 3FJMA 1B0HA 3MC2A 3N6UA 5DVJA 4EQ7A 4GLIA 3C9HA 4IO7A 4RNSA 1FCKA 1OVTA 3U93A 2PT2A 3MWBA 3MPKA 3QK6A 1MY2A 4H0WA 1MXVA 4OENA 4R2FA 3TELA 1MQJA 2DP8A 5AA2B 5B70A 3GXAA 4I9DA 3H6WA 3B6TA 1FQBA 1D4NA 4G8MA 4R9FA 3QSLA 1D9VA 1YCJA 5FTIA 4AQ4A 4EQBA 1ELJA 5H8HB 3B6QA 1MQDA 4YAHX 4ZE9A 2DSFA 3OSQA 5L9OA 1B52A 2GHBA 2V3UA 3RTWB 2QMWA 3TCGA 5L8DA 4YKJA 4DIGA 4DXBA 2I58A 3CG3A 4OFJA 4XIGQ 3PPQA 3L6GA 4LATA 3VXBA 1NKXA 4YMBA 5AA4A 1B3EA 4XKQA 4H67A 4EXKA 2XXUA 5FTHA 3ILUB 1NNPA 1P1OA 2RC9A 1A55A 4OFLA 3TTKA 4GL0A 3CSGA 4F2OA 2DE4A 1OMPA 2DQVA 3MAMA 1DSNA 3SESA 3E13X 3FVOA 3BFTA 3CI8A 3H7MA 3KGCA 4RPNA 4ZZAA 4EXLA 2XXYA 2F97A 2VHAA 1QW0A 2I49A 1ATGA 3K2DA 4JB7A 2QL3A 3KN7A 3RNNA 2XXPA 5AA2D 2DVCA 1JVXA 2B3BA 3T9XB 3MPLA 1SDXA 4E0XA 2M8CA 1N76A 3Q26A 4F1UA 4IO6A 1JEUA 3TUSA 4G68B 2XX9A 5TU0A 2V84A 3Q28A 3SEWA 1TFDA 3OELA 2ANJA 1B46A 1FQCA 1PC3A 2CZLA 2UVIA 3MP6A 4OVJA 3WAFA 2HZKA 4AB5A 4DCYA 5IKBA 4BLAA 1R6ZA 1Y3QA 3DLNA 1MXYA 4H65A 4KYSA 4MH5A 1MQGA 4QSDA 2HEUA 5I59B 4RJZA 1A99A 1YAEA 3MP1A 4NF6A 1PBPA 2UXAA 3MVXA 3KOSA 2I0BA 2F7CA 2P2AA 3KJ7A 2W7YA 5KZTA 2R6GE 3FATA 4ESWA 1NMUA 1BP5A 1UTHA 1DTZA 1Y4TA 3A3CA 5I2NB 3O9PA 4KYEA 1EU8A 3TDJA 5JEIA 3OMBA 3SEXA 3W9WA 2ZNSA 3G3HA 1DMBA 1Y1ZA 3AXFA 4TOZA 1FQFA 4KHZE 4FORA 4XKPA 4DXUA 4GL8A 4YKPA 1POTA 2R9JA 4HTGA 1A40A 4NF8B 4KD5A 3RT6B 3PPOA 5HPQA 3E4RA 2NUVA 2AIXA 4NTLA 4DDDA 1LAXA 1PDAA 4KFQA 3R7XA 3KN8A 4X9TA 3RQTA 1Y1MA 1IXGA 2Y7KA 1LB8A 3KBRA 2XD3A 3MQ9A 5ITPA 4DXCA 4LZ5A 3N6TA 4R6YA 5CC2A 4RYAA 4GD5A 1M5BA 4EQ9A 3CFXA 4ESXA 2A5SA 4FATA 1UTBA 2P0SA 4R9GA 3THIA 1HSJA 1QUIA 3K01A 3RLFE 3TODA 2UYFA 4H8IA 1AIVA 3CFZA 2LAOA 3TQWA 1B4ZA 3V8XB 1MPDA 3IORA 2ZXTA 3M8UA 4BDQA 2ONSA 4N07A 1MS7A 2ESNA 4Q0CA 4EF2A 5CBRA 2XXIA 1NNKA 4G2ZA 4H6DA 3UORA 5ICTA 2PYYA 1US4A 2R71A 4QSEA 3HN0A 2Q8JA 1P1QA 1ZMGA 2QMXA 1QUJA 2RCBA 4DLDA 2OK2A 1MXUA 3BKIB 3IK6B 4ZDMA 5HM4B 4EF1A 3FIRA 3DELB 4H5FA 4F22A 3RY3A 2ONKE 5CI5A 1IEJA 5TP9A 1M5FA 4G8HA 1R9QA 5FHNA 4U1ZA 1B3FA 5ICQA 4X1DA 4ND9A 3U72A 1OLCA 1VE4A 2QJEA 2G93A 4PFYA 3O28A 3VLVA 2I4BA 2Q2AA 3OEMA 2DWAA 1MRPA 3O6IA 4JSOA 4R6KA 2VGQA 3EHTA 2FYIA 5I2KB 4XTCQ 3G3FA 4IO3A 5JTYA 4QFNA 3JYRA 2I3VA 2THIA 5KCJB 2XXRA 1MH4A 1GR2A 1XT8A 3O6GA 4JWOA 1Z7ME 3S9EA 4MLVA 4RK9A 4PETA 4NMYA 1B51A 3M3LA 4G68C 3H6TA 3R26A 2WKYA 4XKNA 3U1OA 5I57A 1XC1A 3KJTA 4R6HA 1AL3A 3GZGA 5LOMA 1SW4A 3EN3A 3ODBA 4IO4A 2Y7PA 4LZ7A 1MY0A 4QFLA 1LCFA 2O51A 3DP4A 3PD9A 1Z7NE 3HV1A 2GFEA 1MY4A 3A09A 3GBAA 4LZ8A 1SW5A 4ONYA 1LAHE 3T66A 3VFJA 5A5XB 4FE8A 1LAFE 4KQPA 4U22A 3PMWA 1M5DA 3MZ9A 4QFPA 4C1UA 3RT8A 1B5IA 3PU5A 1MXXA 1A8EA 1NH7A 1LBCA 1LAGE 2Z8DA 5I58A 4FJPA 1SW2A 5H8QA 4IGTA 5AE4A 2Q9TA 5BWJA 1EZOA 2E0SA 2V25A 3KEIA 4M1VA 1DOTA 1TT1A 4F3SA 2XXHA 3LSFB 1TWYA 1USYE 1LFHA 3FXUA 3C35A 2H9BA 5AA3A 4KR5A 4JBZA 2DWJA 3SKPA 3I5OA 4YMAA 3LSXA 3UN6A 5B7DA 1FTMA 2FA7A 3LBSA 5I56B 3IOTA 4XXUA 4IY6A 1MH3A 2OJTA 3T9HB 4M4GA 5JK4A 3W15C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OOA A;  1I69 A;  3ZKL A;  1EZP A;  4DCX A;  1PB8 A;  3EQ1 A;  3C33 A;  1SVX B;  3RN8 A;  3FJG A;  3O66 A;  1SW1 A;  2UVJ A;  3K1P A;  4OMB A;  5IAI A;  1H44 A;  4MBP A;  4F1Y A;  3CG1 A;  1Q35 A;  2VD3 A;  3MVZ A;  2VD2 A;  5CRY A;  1FTJ A;  3IO4 A;  1B3H A;  1LST A;  2UVH A;  2HZL A;  3TAJ A;  4FIM A;  2ZYM A;  1LCT A;  3N5L A;  4GFR A;  3JV9 A;  2XX8 A;  3OD7 A;  3CFL A;  4KCC A;  1URG A;  2OCU A;  4LQ5 A;  4IY5 A;  5KDT B;  1VR5 A;  5AA2 A;  1UQW A;  2QPQ A;  1D3K A;  2UVG A;  3IB1 A;  3E3K A;  1PEB A;  4Q8R A;  1ZJL A;  1EZ9 A;  1DPP A;  1T0K A;  3IOU A;  5H8F B;  2PX1 A;  3RGY A;  4X48 A;  5K2Y A;  4F29 A;  2Q89 A;  1II5 A;  1RKM A;  3GLB A;  4OXV A;  1BIY A;  1UIU A;  1P1W A;  3DM0 A;  3H6U A;  3MBP A;  3VLW A;  3C4M A;  5EHS A;  1GV8 A;  3ZSF A;  2UYE A;  2Q2C A;  2XXX A;  1BLF A;  2Y84 A;  3C34 A;  3L6H A;  3PD8 A;  4H8J A;  3RTF B;  4ZE8 A;  3FUZ A;  4OHN A;  1IIT A;  1GTK A;  3W9V A;  3VLU A;  4ZEI A;  3TTR A;  2BJJ X;  2ABH A;  2XXT A;  4G8N A;  4EUO A;  2D3I A;  3JZJ A;  5DVF A;  1NL5 A;  3TCF A;  3H6V A;  4JWX A;  3FJ7 A;  2ZYO A;  3FV2 A;  1FQE A;  3D4C A;  1VFE A;  4FED A;  4TQU Q;  1I6A A;  3PUY E;  2OWT A;  2I4C A;  3FAS A;  3DP6 A;  3KSJ A;  4GXS B;  4IGR A;  4P0G A;  4U4S A;  2RF1 A;  3OEK A;  4MF3 A;  5A5X A;  1B4H A;  1UIV A;  3G3K A;  1ANF A;  2O68 A;  1MXW A;  4TLM B;  2V3T A;  4BDR A;  1IXC A;  1LGB C;  1CB6 A;  2ALU A;  2IA4 A;  3HST A;  4GOT A;  3C32 A;  1VSO A;  4H5G A;  3SEV A;  3IR1 A;  4UAC A;  3A3U A;  1N7W A;  4F1V A;  1EH3 A;  2I0C A;  1MQI A;  4LA9 A;  5H8N B;  2XX7 A;  4IO5 A;  4RK2 A;  3S4U A;  3VDF A;  2OWS A;  2Y7I A;  4YB5 A;  4F19 A;  3BFU A;  1ZTY A;  3K6W A;  3KG2 A;  3ONM A;  5CMB A;  5ELV A;  5I84 A;  1JET A;  1B2H A;  1H76 A;  1B5H A;  2F5X A;  4OTE A;  3S2V A;  3TTM A;  1B32 A;  1S9T A;  3H4Z A;  4KYD A;  1IXI A;  1NNT A;  2B65 A;  3CSB A;  3IAZ A;  3OSR A;  4O3A A;  2NXO A;  5CMM A;  5L9M A;  3MZ1 A;  2Z8E A;  3KN3 A;  3R6U A;  1R9L A;  4H1X A;  2O1M A;  4NF8 A;  5TP9 B;  5H8N A;  4GQO A;  3SER A;  1KWH A;  2F7A A;  4KI0 E;  4F3P A;  4Q30 B;  3BBR A;  3K1N A;  1NH8 A;  3QIM A;  2B3F A;  3CR9 A;  2QSX A;  4POX A;  3TQL A;  1LBB A;  4OYV A;  2Z8F A;  4YZZ A;  3ECR A;  2XHD A;  3T22 A;  4L17 A;  4ZED A;  3ZS6 A;  2NWJ A;  2X7P A;  1GVC A;  1YPN A;  4DZ1 A;  4F3B A;  5DVI A;  3PUX E;  1HSE A;  3FXR A;  3FVG A;  3VV5 A;  1B05 A;  3G7W A;  2F8D A;  2H5Y A;  2ZNT A;  4O3C A;  5DT6 A;  3S9L C;  1B58 A;  3GBB A;  4R72 A;  3MP8 A;  1B7H A;  3Q29 A;  2G29 A;  3G3J A;  2VOZ A;  4LQ2 A;  4U4X A;  3TCH A;  4F3G A;  1MM7 A;  2Z22 A;  1HSL A;  3O6H A;  4OET A;  1B6H A;  3RPW A;  2QS3 A;  4HS7 A;  1BTJ A;  4MLQ A;  4C1T A;  3QYT A;  4C0R A;  2HAV A;  1FQA A;  1SQY A;  3U8Q A;  1PBQ A;  5CBS A;  1NNF A;  2F34 A;  1IUD A;  4YB6 A;  5I56 A;  4UA8 A;  1IIW A;  2AL5 A;  4YIC A;  2REJ A;  2I3W A;  1TFA A;  2FNC A;  2OBG A;  3UIF A;  3MVY A;  4YB7 A;  2REG A;  4IO2 A;  3T93 B;  3I3V A;  2H4I A;  3C36 A;  3TZA A;  1MPC A;  3S9N C;  1IQ7 A;  3IJX B;  4YU0 A;  2F7B A;  3FXQ A;  3LR1 A;  5I58 B;  3KZG A;  3PV0 E;  2H25 A;  5I2K A;  1WOD A;  1BKA A;  1D9Y A;  5KDT A;  4JXI A;  4ZEC A;  3MVW A;  1SI1 A;  3OO7 A;  1B1X A;  2RKM A;  3PUZ E;  4N13 A;  1MDQ A;  5ITO A;  3LSW A;  2DS9 A;  1JW4 A;  4GF8 A;  2X26 A;  4ZS9 A;  4JDF A;  2H98 A;  2V93 A;  3K02 A;  4R73 A;  2DXY A;  3VVF A;  1FTL A;  2YJP A;  4JWY A;  4NF5 B;  4U21 A;  3TMG A;  4ELR A;  4GVO A;  1LFG A;  4FAJ A;  3T9V A;  2O1L A;  4G68 A;  4GWO A;  4P0I A;  2RC7 A;  1OIB A;  4OFO A;  1UTB B;  4NWC A;  5M2V A;  1USY H;  4LON B;  4Z7E A;  4QHQ A;  4OQO A;  4RXL A;  3IJO B;  5KCJ A;  1ZKB A;  2D5W A;  3WAE A;  1N3X A;  1N84 A;  1J1N A;  1XVY A;  3B6W A;  2DWH A;  4FEB A;  2P1S A;  3PUV E;  5H8Q B;  5CM6 A;  1O63 A;  3CVG A;  5EYF A;  4LUB A;  4ZZE A;  3IX1 A;  5AA1 A;  4OEV A;  4PE5 B;  3SET A;  3TYH A;  1M5E A;  1XOC A;  3U94 A;  2RCA A;  4RY1 A;  5H8F A;  4OWD A;  1ZIU A;  4WEP A;  4O3B A;  2IEE A;  1MM6 A;  3UA8 A;  4ELO A;  3IO6 A;  1H43 A;  1LB9 A;  2KLF A;  1AH5 A;  3OXN A;  3O29 A;  5TPA B;  1FTK A;  2ZMB A;  4Q5T A;  1O64 A;  3ZKK A;  2ZYK A;  1N0T A;  3EHU A;  3K1M A;  3KFM A;  4LVQ A;  2HCA A;  3P7I A;  4YKI A;  1DTG A;  4QFK A;  4F2Q A;  3O2A A;  1WVJ A;  1UTH B;  2PBW A;  4KPT A;  4ZEK A;  1PB9 A;  3TFL A;  3VXC A;  4HW8 A;  4DE8 A;  1ZBM A;  3G3G A;  3HHG A;  1N7X A;  3ILT B;  2O6A A;  4NE4 A;  2O84 X;  3HO7 A;  3FZV A;  3Q25 A;  3TTN A;  3IL1 B;  2QRY A;  1RYX A;  4EDP A;  3QUF A;  2YPN A;  1URS A;  1WDN A;  3K6V A;  4I1D A;  2F6G A;  2ZNU A;  3LSL A;  1A54 A;  3VE1 B;  1ZU0 A;  3HCQ A;  3N94 A;  3OO6 A;  3VVE A;  1H45 A;  5I2N A;  3T9U A;  4ZEB A;  5FHM A;  4KCD A;  5FHO A;  1MXZ A;  1Q1K A;  1B3L A;  1QUL A;  1Y3P A;  3HHF A;  4R74 A;  4ELQ A;  4F39 A;  4NF6 B;  1IZ1 A;  4GIZ A;  3G3I A;  1S7Y A;  3TKD A;  2QS1 A;  4NF4 A;  2YLN A;  3CRB A;  3FVK A;  4OER A;  2VP1 A;  3H3G A;  2H99 A;  1JQF A;  4U23 A;  3U92 A;  4BDM A;  1QKB A;  3MUQ A;  3PGF A;  4R75 A;  1OLA A;  4QFO A;  2DXR A;  2PT1 A;  2F36 A;  3PMV A;  2DYX A;  4JSD A;  4GXA A;  1M5C A;  3VVD A;  2XXW A;  1GGG A;  1QJM A;  2DE2 A;  2O69 A;  3EF7 A;  3PPR A;  4WED A;  5EHM A;  4ZEF A;  3V83 A;  4POW A;  2F6P A;  4HCY A;  5DTB A;  5HBC A;  2XXV A;  4PP0 A;  2HQ0 A;  3V5A A;  2X7Q A;  2HAU A;  3PPP A;  5ISU A;  3USD A;  1N04 A;  3QAX A;  4PFT A;  1S50 A;  3SDF A;  2F35 A;  2Y7W A;  3TTL A;  4QF9 A;  4F18 A;  1YTV A;  3TPA A;  4NWD A;  5CMK A;  1DPE A;  1MG1 A;  1AOV A;  1LLS A;  2XD2 A;  1O7T A;  1URD A;  2O7U A;  3Q27 A;  3SEU A;  3F11 A;  2E1S A;  4X1B A;  1SD3 A;  5K2X A;  3SEY A;  1SI0 A;  3IOV A;  5AA4 B;  2HXW A;  4U2R A;  4RPO A;  4TLL B;  3CIJ A;  1MPB A;  3DP8 A;  1OVB A;  4RA1 A;  2DVZ A;  2Q88 A;  3E9X A;  3IB0 A;  5DEX B;  3M3F A;  3QUJ A;  1A7L A;  4N6P A;  2Z23 A;  2D21 A;  1JEV A;  1MDP 1;  1SYI A;  3I6V A;  3MZB A;  4GRK A;  4MFI A;  4OES A;  1XVX A;  4LP2 B;  3UK4 A;  5F1Q A;  3V89 B;  4R2B A;  2Y7R A;  1JW1 A;  1P1U A;  1MY1 A;  2V3Q A;  3K00 A;  3RUM A;  1B3G A;  2QS2 A;  2F78 A;  4WXJ A;  2I6E A;  3LUY A;  3PUW E;  2DE3 A;  2I48 A;  3K6X A;  5H8S A;  1L5T A;  2NVU B;  3UP9 A;  5DEX A;  3FV1 A;  3PMX A;  4Z0I A;  3IOW A;  1P1N A;  3K0V A;  2A5T A;  3EHS A;  3O97 A;  2PMS A;  4PFW A;  3H03 A;  1B40 A;  3C31 A;  4ELP A;  2GRV A;  5J1D A;  1QKA A;  4G77 A;  4OEU A;  4FEC A;  4YKK A;  2GH9 A;  4E0W A;  5I59 A;  3MW0 A;  2AYS A;  1P99 A;  4HCW A;  3T96 B;  1F9B A;  4K3F A;  4PFU A;  4QRZ A;  4BDN A;  3H06 B;  4ECF A;  2RIN A;  4PQJ A;  3B7D A;  1PB7 A;  3IB2 A;  1VFD A;  4WKM A;  1H3D A;  1XHY A;  1MQH A;  4AB6 A;  3FGS A;  2AL4 A;  4P11 A;  2O7I A;  4I62 A;  1FTO A;  2OLB A;  1I6B A;  1LFI A;  4OZ9 A;  4F31 B;  1B7Z A;  1FQD A;  1R1N A;  1B5J A;  1JNF A;  2RC8 A;  4ISU A;  3N26 A;  4THI A;  2ONR A;  1US5 A;  4BDL A;  3MJN A;  3TEP A;  1B0L A;  4QSC A;  5F7V A;  5H8H A;  4XKR A;  4U1O A;  1A8F A;  2NOO A;  1OQH A;  5BUU A;  1QVS A;  4NED A;  3QXM A;  2ZYN A;  1JVY A;  2PVU A;  3PPN A;  1CE2 A;  5TPA A;  3OEN A;  5CMC A;  1B1H A;  1Y9U A;  5I57 B;  1SBP A;  1ZLQ A;  1IXH A;  3D4G A;  3EPE A;  1POY 1;  1FW0 A;  3FVN A;  3LC8 A;  1B7U A;  4G4P A;  3K4U A;  4IB2 A;  4NF5 A;  3K6U A;  3OO8 A;  1B9J A;  5JTY B;  5DYH A;  3UGW A;  5L9S A;  3S9M C;  1TXF A;  1Y3N A;  2CMO A;  4I8C A;  1MY3 A;  4BDO A;  2HFB A;  1JW5 A;  1QUK A;  1AMF A;  1XS5 A;  2GHA A;  1I6Q A;  2OZZ A;  3HPI A;  3KOT A;  2A5T B;  2DWI A;  2XXQ A;  3FD3 A;  3M3K A;  3OO9 A;  1Y4C A;  4NF4 B;  3KSX A;  1SYH A;  1NFT A;  1N3W A;  2QS4 A;  2DOJ A;  1OQG A;  1Y20 A;  1RYO A;  3FJM A;  1B0H A;  3MC2 A;  3N6U A;  5DVJ A;  4EQ7 A;  4GLI A;  3C9H A;  4IO7 A;  4RNS A;  1FCK A;  1OVT A;  3U93 A;  2PT2 A;  3MWB A;  3MPK A;  3QK6 A;  1MY2 A;  4H0W A;  1MXV A;  4OEN A;  4R2F A;  3TEL A;  1MQJ A;  2DP8 A;  5AA2 B;  5B70 A;  3GXA A;  4I9D A;  3H6W A;  3B6T A;  1FQB A;  1D4N A;  4G8M A;  4R9F A;  3QSL A;  1D9V A;  1YCJ A;  5FTI A;  4AQ4 A;  4EQB A;  1ELJ A;  5H8H B;  3B6Q A;  1MQD A;  4YAH X;  4ZE9 A;  2DSF A;  3OSQ A;  5L9O A;  1B52 A;  2GHB A;  2V3U A;  3RTW B;  2QMW A;  3TCG A;  5L8D A;  4YKJ A;  4DIG A;  4DXB A;  2I58 A;  3CG3 A;  4OFJ A;  4XIG Q;  3PPQ A;  3L6G A;  4LAT A;  3VXB A;  1NKX A;  4YMB A;  5AA4 A;  1B3E A;  4XKQ A;  4H67 A;  4EXK A;  2XXU A;  5FTH A;  3ILU B;  1NNP A;  1P1O A;  2RC9 A;  1A55 A;  4OFL A;  3TTK A;  4GL0 A;  3CSG A;  4F2O A;  2DE4 A;  1OMP A;  2DQV A;  3MAM A;  1DSN A;  3SES A;  3E13 X;  3FVO A;  3BFT A;  3CI8 A;  3H7M A;  3KGC A;  4RPN A;  4ZZA A;  4EXL A;  2XXY A;  2F97 A;  2VHA A;  1QW0 A;  2I49 A;  1ATG A;  3K2D A;  4JB7 A;  2QL3 A;  3KN7 A;  3RNN A;  2XXP A;  5AA2 D;  2DVC A;  1JVX A;  2B3B A;  3T9X B;  3MPL A;  1SDX A;  4E0X A;  2M8C A;  1N76 A;  3Q26 A;  4F1U A;  4IO6 A;  1JEU A;  3TUS A;  4G68 B;  2XX9 A;  5TU0 A;  2V84 A;  3Q28 A;  3SEW A;  1TFD A;  3OEL A;  2ANJ A;  1B46 A;  1FQC A;  1PC3 A;  2CZL A;  2UVI A;  3MP6 A;  4OVJ A;  3WAF A;  2HZK A;  4AB5 A;  4DCY A;  5IKB A;  4BLA A;  1R6Z A;  1Y3Q A;  3DLN A;  1MXY A;  4H65 A;  4KYS A;  4MH5 A;  1MQG A;  4QSD A;  2HEU A;  5I59 B;  4RJZ A;  1A99 A;  1YAE A;  3MP1 A;  4NF6 A;  1PBP A;  2UXA A;  3MVX A;  3KOS A;  2I0B A;  2F7C A;  2P2A A;  3KJ7 A;  2W7Y A;  5KZT A;  2R6G E;  3FAT A;  4ESW A;  1NMU A;  1BP5 A;  1UTH A;  1DTZ A;  1Y4T A;  3A3C A;  5I2N B;  3O9P A;  4KYE A;  1EU8 A;  3TDJ A;  5JEI A;  3OMB A;  3SEX A;  3W9W A;  2ZNS A;  3G3H A;  1DMB A;  1Y1Z A;  3AXF A;  4TOZ A;  1FQF A;  4KHZ E;  4FOR A;  4XKP A;  4DXU A;  4GL8 A;  4YKP A;  1POT A;  2R9J A;  4HTG A;  1A40 A;  4NF8 B;  4KD5 A;  3RT6 B;  3PPO A;  5HPQ A;  3E4R A;  2NUV A;  2AIX A;  4NTL A;  4DDD A;  1LAX A;  1PDA A;  4KFQ A;  3R7X A;  3KN8 A;  4X9T A;  3RQT A;  1Y1M A;  1IXG A;  2Y7K A;  1LB8 A;  3KBR A;  2XD3 A;  3MQ9 A;  5ITP A;  4DXC A;  4LZ5 A;  3N6T A;  4R6Y A;  5CC2 A;  4RYA A;  4GD5 A;  1M5B A;  4EQ9 A;  3CFX A;  4ESX A;  2A5S A;  4FAT A;  1UTB A;  2P0S A;  4R9G A;  3THI A;  1HSJ A;  1QUI A;  3K01 A;  3RLF E;  3TOD A;  2UYF A;  4H8I A;  1AIV A;  3CFZ A;  2LAO A;  3TQW A;  1B4Z A;  3V8X B;  1MPD A;  3IOR A;  2ZXT A;  3M8U A;  4BDQ A;  2ONS A;  4N07 A;  1MS7 A;  2ESN A;  4Q0C A;  4EF2 A;  5CBR A;  2XXI A;  1NNK A;  4G2Z A;  4H6D A;  3UOR A;  5ICT A;  2PYY A;  1US4 A;  2R71 A;  4QSE A;  3HN0 A;  2Q8J A;  1P1Q A;  1ZMG A;  2QMX A;  1QUJ A;  2RCB A;  4DLD A;  2OK2 A;  1MXU A;  3BKI B;  3IK6 B;  4ZDM A;  5HM4 B;  4EF1 A;  3FIR A;  3DEL B;  4H5F A;  4F22 A;  3RY3 A;  2ONK E;  5CI5 A;  1IEJ A;  5TP9 A;  1M5F A;  4G8H A;  1R9Q A;  5FHN A;  4U1Z A;  1B3F A;  5ICQ A;  4X1D A;  4ND9 A;  3U72 A;  1OLC A;  1VE4 A;  2QJE A;  2G93 A;  4PFY A;  3O28 A;  3VLV A;  2I4B A;  2Q2A A;  3OEM A;  2DWA A;  1MRP A;  3O6I A;  4JSO A;  4R6K A;  2VGQ A;  3EHT A;  2FYI A;  5I2K B;  4XTC Q;  3G3F A;  4IO3 A;  5JTY A;  4QFN A;  3JYR A;  2I3V A;  2THI A;  5KCJ B;  2XXR A;  1MH4 A;  1GR2 A;  1XT8 A;  3O6G A;  4JWO A;  1Z7M E;  3S9E A;  4MLV A;  4RK9 A;  4PET A;  4NMY A;  1B51 A;  3M3L A;  4G68 C;  3H6T A;  3R26 A;  2WKY A;  4XKN A;  3U1O A;  5I57 A;  1XC1 A;  3KJT A;  4R6H A;  1AL3 A;  3GZG A;  5LOM A;  1SW4 A;  3EN3 A;  3ODB A;  4IO4 A;  2Y7P A;  4LZ7 A;  1MY0 A;  4QFL A;  1LCF A;  2O51 A;  3DP4 A;  3PD9 A;  1Z7N E;  3HV1 A;  2GFE A;  1MY4 A;  3A09 A;  3GBA A;  4LZ8 A;  1SW5 A;  4ONY A;  1LAH E;  3T66 A;  3VFJ A;  5A5X B;  4FE8 A;  1LAF E;  4KQP A;  4U22 A;  3PMW A;  1M5D A;  3MZ9 A;  4QFP A;  4C1U A;  3RT8 A;  1B5I A;  3PU5 A;  1MXX A;  1A8E A;  1NH7 A;  1LBC A;  1LAG E;  2Z8D A;  5I58 A;  4FJP A;  1SW2 A;  5H8Q A;  4IGT A;  5AE4 A;  2Q9T A;  5BWJ A;  1EZO A;  2E0S A;  2V25 A;  3KEI A;  4M1V A;  1DOT A;  1TT1 A;  4F3S A;  2XXH A;  3LSF B;  1TWY A;  1USY E;  1LFH A;  3FXU A;  3C35 A;  2H9B A;  5AA3 A;  4KR5 A;  4JBZ A;  2DWJ A;  3SKP A;  3I5O A;  4YMA A;  3LSX A;  3UN6 A;  5B7D A;  1FTM A;  2FA7 A;  3LBS A;  5I56 B;  3IOT A;  4XXU A;  4IY6 A;  1MH3 A;  2OJT A;  3T9H B;  4M4G A;  5JK4 A;  3W15 C; 
#chains in the Genus database with same CATH topology
 3ZKL A;  4DCX A;  3EQ1 A;  2FBP A;  2UVJ A;  4F1Y A;  2QFL A;  3CG1 A;  1RDX A;  2VD3 A;  2UVH A;  4FIM A;  2ZYM A;  3OD7 A;  4KCC A;  1UQW A;  3IB1 A;  2Q74 A;  1ZJL A;  5H8F B;  2PX1 A;  4F29 A;  2Q89 A;  1II5 A;  3GLB A;  4OXV A;  1UIU A;  1P1W A;  2Y84 A;  2XXX A;  4H8J A;  4GX3 A;  2XXT A;  4G8N A;  4I3E A;  3TCF A;  1VFE A;  4FED A;  4YU0 A;  3PUY E;  2OWT A;  2WYK A;  3FAS A;  4P0G A;  4O8M A;  3OEK A;  1UIV A;  1IXC A;  3SEV A;  2ALU A;  2IA4 A;  3HST A;  4H5G A;  2XWI A;  3RPL A;  3ROJ A;  1EH3 A;  2XX7 A;  4IO5 A;  3S4U A;  3VDF A;  2OWS A;  5ELV A;  5I84 A;  1JET A;  1H76 A;  1B5H A;  2F5X A;  3TTM A;  1B32 A;  3H4Z A;  1IXI A;  1NNT A;  3OSR A;  5IZ3 A;  2Z8E A;  1R9L A;  2O1M A;  3SER A;  4KI0 E;  2B3F A;  2QSX A;  3ECR A;  3ZS6 A;  2NWJ A;  2X7P A;  1YPN A;  3ISP A;  4O7M A;  3FXR A;  1B05 A;  2H5Y A;  3BIG A;  1B58 A;  3BIH A;  3T0J A;  4U4X A;  1MM7 A;  4PC9 A;  4HS7 A;  4N81 A;  1SQY A;  5I56 A;  4UA8 A;  2I3W A;  3UIF A;  2KQZ A;  4YB7 A;  4IO2 A;  3C36 A;  4KXP A;  4GX4 A;  3KZG A;  3PV0 E;  3LSW A;  4ZS9 A;  2V93 A;  2CEY A;  4FAJ A;  2O1L A;  4G68 A;  4GWO A;  1USY H;  4OQO A;  1N84 A;  3QMF A;  1O63 A;  3MYU A;  3SET A;  4ZZE A;  5AA1 A;  4OEV A;  3TYH A;  4OWD A;  2IEE A;  1NV6 A;  3IO6 A;  2WBB A;  5TPA B;  3ZKK A;  2ZYK A;  3P7I A;  1WVJ A;  3TFL A;  4HW8 A;  3HHG A;  4NE4 A;  3HO7 A;  3FZV A;  5IZ3 B;  3QUF A;  3K6V A;  2ZNU A;  3N94 A;  4KCD A;  1QUL A;  1B3L A;  3HHF A;  4ELQ A;  3TKD A;  1S7Y A;  4NF4 A;  2YLN A;  5EQ9 A;  4MNI A;  1NV2 A;  1JQF A;  3PGF A;  1M5C A;  3VVD A;  4WED A;  3V5A A;  5EQA A;  5ISU A;  1S50 A;  3SDF A;  2F35 A;  3TTL A;  4F18 A;  3TPA A;  1MG1 A;  1AOV A;  5LDZ A;  1URD A;  2O7U A;  4X1B A;  4U2R A;  1OVB A;  3E9X A;  3IB0 A;  5DEX B;  4N6P A;  3MZB A;  2D21 A;  1JEV A;  1JW1 A;  3RUM A;  2QS2 A;  4PCD A;  3LUY A;  2DE3 A;  3K6X A;  5DEX A;  3O97 A;  4MMP A;  3LUZ A;  1B40 A;  2GRV A;  4G77 A;  4OEU A;  4E0W A;  3MW0 A;  3T96 B;  1P99 A;  4HCW A;  2FIX A;  1LBX A;  3B7D A;  1DCU A;  1XHY A;  4OVS A;  2AL4 A;  4N8Y A;  4OZ9 A;  1LFI A;  4THI A;  2ONR A;  3TEP A;  2ZYN A;  1JVY A;  5CMC A;  1B1H A;  1Y9U A;  1SBP A;  4G4P A;  4IB2 A;  3FVN A;  4NF6 A;  1B7U A;  5JTY B;  3S9M C;  5L9S A;  3OO8 A;  2CMO A;  1QUK A;  2GHA A;  2OZZ A;  4JVD A;  5JK4 A;  1Y4C A;  1SYH A;  1N3W A;  1OQG A;  1B0H A;  4IO7 A;  3U93 A;  4H0W A;  5B70 A;  3GXA A;  3H6W A;  3B6T A;  1D4N A;  4R9F A;  1D9V A;  1MQD A;  4YAH X;  4GBW A;  1IMA A;  3RTW B;  4DIG A;  4PAF A;  3PPQ A;  3L6G A;  4H67 A;  5FTH A;  1A55 A;  4OFL A;  4F2O A;  3MAM A;  4RPN A;  3CI8 A;  2F97 A;  4JB7 A;  1ATG A;  5AA2 D;  2QL3 A;  2XXP A;  2JJK A;  1SDX A;  4E0X A;  2M8C A;  1JEU A;  3Q28 A;  1G0H A;  1B46 A;  4DCY A;  4AB5 A;  5IKB A;  5EQ7 A;  1MQG A;  4UAB A;  3MVX A;  3KOS A;  2F7C A;  3FAT A;  4ESW A;  1UTH A;  1Y4T A;  3A3C A;  5I2N B;  3O9P A;  2CZH A;  4PTK A;  2ZNS A;  1Y1Z A;  4KHZ E;  4YKP A;  5HPQ A;  4NF8 B;  3PPO A;  4GBV A;  4NTL A;  4DDD A;  1LAX A;  4KFQ A;  2Y5K A;  1IXG A;  2WYP A;  2XD3 A;  4DXC A;  4LZ5 A;  4ESX A;  4EQ9 A;  3CFX A;  1UTB A;  2ZZX A;  4HE1 A;  4MIJ A;  1DK4 A;  2UYF A;  4H8I A;  3TQW A;  1MPD A;  2ZXT A;  4BDQ A;  1NNK A;  3KC0 A;  2XWK A;  3HN0 A;  2OK2 A;  3BKI B;  4ZDM A;  3FIR A;  3DEL B;  2ONK E;  1IEJ A;  1M5F A;  5FHN A;  4X1D A;  4JSO A;  2DWA A;  4JVC A;  3S9E A;  4RK9 A;  3R26 A;  2XWO A;  3B50 A;  5LOM A;  3EN3 A;  1LCF A;  2O51 A;  2GFE A;  3A09 A;  3T66 A;  3VFJ A;  4U22 A;  3PMW A;  3MZ9 A;  4QFP A;  1B5I A;  2XWV A;  1NH7 A;  1LBC A;  2Z8D A;  4GX6 A;  1SW2 A;  3KEI A;  1TT1 A;  2XXH A;  1LFH A;  5AA3 A;  4KR5 A;  3I5O A;  2FA7 A;  3IOT A;  5LTC A;  2OJT A;  4M4G A;  1NUW A;  1EZP A;  1PB8 A;  2FIE A;  3FJG A;  1H44 A;  3MVZ A;  2VD2 A;  1B3H A;  1LST A;  4P9K A;  3CFL A;  4XFE A;  2OCU A;  5KDT B;  1VR5 A;  5AA2 A;  1PEB A;  1RKM A;  3CHG A;  3DM0 A;  3ZSF A;  1GV8 A;  3C34 A;  3RTF B;  1IIT A;  1GTK A;  3TTR A;  2BJJ X;  1FBC A;  2ABH A;  2D3I A;  2DDK A;  1NL5 A;  4PFB A;  3FJ7 A;  3FV2 A;  1FQE A;  4TQU Q;  1I6A A;  3KSJ A;  2I4C A;  4GXS B;  4MF3 A;  5A5X A;  3G3K A;  1LBV A;  3IR1 A;  4YB5 A;  3K6W A;  3KG2 A;  5CMB A;  1B2H A;  4OTE A;  4KYD A;  5CMM A;  3CSB A;  3MZ1 A;  5JEI A;  3KN3 A;  4NF8 A;  5H8N A;  1KWH A;  4Q30 B;  3BBR A;  2Z8F A;  4YZZ A;  2XHD A;  4ZED A;  3FVG A;  3GBB A;  4GWU A;  3Q29 A;  3G3J A;  2VOZ A;  4GWX A;  4OET A;  1B6H A;  3QYT A;  3U8Q A;  5CBS A;  1IUD A;  2AL5 A;  4YIC A;  2REJ A;  1TFA A;  3SZP A;  3MVY A;  2H4I A;  3TZA A;  4OAN A;  3IJX B;  3LR1 A;  5I58 B;  5I2K A;  3OO7 A;  5ITO A;  3PUZ E;  2RKM A;  2X26 A;  4AS5 A;  4JDF A;  2H98 A;  3K02 A;  4R73 A;  2DXY A;  1FTL A;  5I3S A;  4ELR A;  4GVO A;  1LFG A;  4P0I A;  2RC7 A;  4OFO A;  1UTB B;  4LON B;  4QHQ A;  4RXL A;  3IJO B;  4PBH A;  4PDH A;  1ZKB A;  2D5W A;  2DWH A;  2P1S A;  5CM6 A;  5H8F A;  4WEP A;  1H43 A;  1LB9 A;  3OXN A;  3KFM A;  2HCA A;  3O2A A;  5J16 A;  4KPT A;  1UTH B;  3VXC A;  4ZEK A;  1YXI A;  1ZBM A;  2O6A A;  3Q25 A;  3IL1 B;  2YPN A;  4I1D A;  1KZ8 A;  3LSL A;  2WX9 A;  2OX3 A;  1H45 A;  5EYH A;  3T9U A;  4ZEB A;  5FHM A;  1MXZ A;  1Q1K A;  1Y3P A;  1IZ1 A;  4GIZ A;  4OER A;  2VP1 A;  2H99 A;  1QKB A;  1QJM A;  1QGX A;  3V83 A;  2F6P A;  5DTB A;  2XXV A;  1FBP A;  4MAG A;  2X7Q A;  3PTY A;  2QVV A;  3QAX A;  2Y7W A;  1LLS A;  2XD2 A;  3Q27 A;  3SEU A;  3F11 A;  2E1S A;  1SD3 A;  3IOV A;  5AA4 B;  4QBA A;  3DP8 A;  4RA1 A;  2DVZ A;  3QUJ A;  1A7L A;  3V89 B;  2Y7R A;  1B3G A;  4H46 A;  2I6E A;  4N4U A;  2I48 A;  5H8S A;  2NVU B;  1FPB A;  4FBP A;  1P1N A;  4PFW A;  2A5T A;  3EHS A;  5I59 A;  1LBY A;  4G61 A;  4ELP A;  5J1D A;  1QKA A;  4PF6 A;  4YKK A;  2GH9 A;  4MHF A;  2RIN A;  1PB7 A;  3IB2 A;  1H3D A;  4P1L A;  1AWB A;  4P11 A;  2O7I A;  4I62 A;  1FBF A;  1I6B A;  1B7Z A;  1R1N A;  4ISU A;  3N26 A;  1SPI A;  1US5 A;  3MJN A;  1B0L A;  4NED A;  2PVU A;  2R8T A;  3OEN A;  5I57 B;  3D4G A;  3K6U A;  1Y3N A;  1MY3 A;  1JW5 A;  1AMF A;  3D1R A;  4XF5 A;  1I6Q A;  1L5T A;  3OO9 A;  2XXQ A;  4HE2 A;  4NF4 B;  1NFT A;  3FJM A;  3MC2 A;  1Y20 A;  1RYO A;  1FPG A;  4GLI A;  3MPK A;  1K9Y A;  4OEN A;  4F1U A;  1MXV A;  1MQJ A;  4G8M A;  2BJI A;  3QSL A;  1YCJ A;  4EQB A;  4AQ4 A;  5H8H B;  2DSF A;  1K9Z A;  3OSQ A;  5L9O A;  1B52 A;  2GHB A;  4DXB A;  2QMW A;  5L8D A;  4YMB A;  3VXB A;  4LAT A;  1NKX A;  2XXU A;  4NGU A;  3ILU B;  4P56 A;  4AS4 A;  3CSG A;  2DE4 A;  1OMP A;  3SES A;  4ZZA A;  2XXY A;  3RNN A;  3K2D A;  3KN7 A;  4IO6 A;  4G68 B;  2XX9 A;  3OEL A;  2UVI A;  3WAF A;  2B4L A;  4MH5 A;  1Y3Q A;  4KYS A;  2HEU A;  1YAE A;  3MP1 A;  2UXA A;  2I0B A;  2HPG A;  4NG7 A;  2P2A A;  3KJ7 A;  2R6G E;  1NMU A;  3OMB A;  4TOZ A;  3G3H A;  4PFI A;  3AXF A;  1FQF A;  4FOR A;  4XKP A;  1POT A;  1FPK A;  4HTG A;  1A40 A;  4KD5 A;  2B4M A;  2NUV A;  3R7X A;  3KN8 A;  3N6T A;  4R6Y A;  4RYA A;  2A5S A;  2P0S A;  4R9G A;  1HSJ A;  1QUI A;  3K01 A;  3V8X B;  1B4Z A;  2ESN A;  4PGP A;  1US4 A;  3T1B A;  1P1Q A;  2P3N A;  1ZMG A;  2QMX A;  4DLD A;  3IK6 B;  1BK4 A;  4H5F A;  4G8H A;  1R9Q A;  2ZZW A;  1OLC A;  4PFY A;  3O28 A;  3O6I A;  4N17 A;  3EHT A;  1GR2 A;  1XT8 A;  4JWO A;  4MLV A;  4PET A;  2VPN A;  3M3L A;  3H6T A;  4XKN A;  3U1O A;  1FJ6 A;  1XC1 A;  3KJT A;  1FSA A;  4IO4 A;  2Y7P A;  4LZ7 A;  1NV1 A;  3IFA A;  1Z7N E;  3HV1 A;  3GBA A;  4ONY A;  1SW5 A;  1MXX A;  4N8G A;  1FBH A;  1LAG E;  5I58 A;  5H8Q A;  4IGT A;  2Q9T A;  1EZO A;  4M1V A;  1DOT A;  3LSF B;  2H9B A;  4PAI A;  4JBZ A;  2DWJ A;  3LBS A;  4IY6 A;  1FJ9 A;  3W15 C;  3OOA A;  3K1P A;  5IAI A;  5CRY A;  1FTJ A;  3IO4 A;  2HZL A;  1LCT A;  3N5L A;  4GFR A;  4IY5 A;  3E79 A;  1RDZ A;  1DPP A;  1T0K A;  4X48 A;  3H6U A;  3MBP A;  3C4M A;  5EHS A;  3KC1 A;  1BLF A;  3PD8 A;  4ZE8 A;  3FUZ A;  3VLU A;  4ZEI A;  3KBZ A;  3JZJ A;  5DVF A;  2ZYO A;  3D4C A;  4IGR A;  4U4S A;  2RF1 A;  1B4H A;  4P3L A;  1ANF A;  2V3T A;  3C32 A;  1VSO A;  4UAC A;  3A3U A;  4F1V A;  5H8N B;  2OWZ A;  4LA9 A;  4RK2 A;  4F19 A;  2Y7I A;  1ZTY A;  3S2V A;  3R6U A;  5TP9 B;  3W9V A;  4H1X A;  4GQO A;  2F7A A;  4F3P A;  3K1N A;  1NH8 A;  3QIM A;  4POX A;  3CR9 A;  3RPL B;  4OYV A;  3T22 A;  4DZ1 A;  1GVC A;  2PFY A;  4F3B A;  5EQ8 A;  3VV5 A;  3G7W A;  2F8D A;  2ZNT A;  4O3C A;  5DT6 A;  3S9L C;  4R72 A;  4LQ2 A;  3A29 A;  4MLQ A;  1FQA A;  4XEQ A;  2QVR A;  4YB6 A;  4X04 A;  1IIW A;  2FNC A;  2REG A;  3T93 B;  1MPC A;  1IQ7 A;  4P47 A;  4DI4 B;  2F7B A;  3FXQ A;  1WOD A;  1BKA A;  5KDT A;  4JXI A;  2F3D A;  3NOH A;  4ZEC A;  3MVW A;  5I5P A;  4OVT A;  1MDQ A;  2DS9 A;  1JW4 A;  3HFU A;  1NV5 A;  4GF8 A;  4PF8 A;  3VVF A;  2YJP A;  4GWY A;  4NF5 B;  4U21 A;  3TMG A;  4NWC A;  5M2V A;  4Z7E A;  5KCJ A;  3WAE A;  1N3X A;  1J1N A;  1XVY A;  3B6W A;  3PUV E;  5EYF A;  4BDN A;  3IX1 A;  2CZK A;  4OA4 A;  1XOC A;  2MKZ A;  2RCA A;  1ZIU A;  1MM6 A;  3UA8 A;  4GWS A;  1AH5 A;  2ZMB A;  1O64 A;  1N0T A;  5EYG A;  3K1M A;  4YKI A;  1DTG A;  2PBW A;  1KA1 A;  4DE8 A;  2O84 X;  4JVI A;  3TTN A;  1RYX A;  2QVU A;  1URS A;  2Q8M A;  4PE3 A;  3VE1 B;  1ZU0 A;  3OO6 A;  4NAP A;  5I2N A;  4PAK A;  1AIV A;  4R74 A;  2VT5 A;  2P3V A;  3FVK A;  4LN5 A;  3U92 A;  1IMC A;  4BDM A;  3MUQ A;  1OLA A;  2DXR A;  2DYX A;  2DE2 A;  3EF7 A;  4POW A;  1FPI A;  4HCY A;  5HBC A;  4PP0 A;  2HAU A;  3PPP A;  3USD A;  4PFT A;  1DBZ A;  4NWD A;  5CMK A;  1DPE A;  5K2X A;  3SEY A;  2HXW A;  1EYJ A;  1MPB A;  3E78 A;  2Z23 A;  4GRK A;  1MDP 1;  3I6V A;  4NX1 A;  1XVX A;  3UK4 A;  5F1Q A;  2CEX A;  1P1U A;  1EYK A;  3PUW E;  3MST A;  3U65 A;  5DW8 A;  3PMX A;  2PMS A;  3H03 A;  3GYY A;  4FEC A;  4K3F A;  4PFU A;  4QRZ A;  4ECF A;  2FHY A;  5A5L A;  1MQH A;  4N15 A;  3FGS A;  2OLB A;  4F31 B;  1B5J A;  1JNF A;  5ESY A;  5F7V A;  4QSC A;  5IM2 A;  2NOO A;  5BUU A;  5TPA A;  3PPN A;  4NQ8 A;  4QFL A;  3EPE A;  4NF5 A;  4IR8 A;  1TXF A;  4I8C A;  3FD3 A;  3KSX A;  4GD5 A;  4EUO A;  4EQ7 A;  1FCK A;  1OVT A;  3QK6 A;  5KZT A;  2DP8 A;  1FQB A;  2PCR A;  1ELJ A;  3B6Q A;  1IMD A;  3FXB A;  1NV3 A;  2V3U A;  4XIG Q;  4OFJ A;  5AA4 A;  4EXK A;  1NNP A;  4FAT A;  4ELO A;  1DSN A;  3E13 X;  3H7M A;  3BFT A;  2VHA A;  1QW0 A;  2I49 A;  5T3J A;  1JVX A;  2B3B A;  3T9X B;  1TFD A;  2ANJ A;  1FQC A;  1FBD A;  2CZL A;  2HZK A;  4BLA A;  3DLN A;  4H65 A;  1MXY A;  4MCO A;  4QSD A;  1FPF A;  4RJZ A;  1A99 A;  1G0I A;  1PBP A;  2W7Y A;  1BP5 A;  1JP4 A;  1DTZ A;  4O7I A;  1EU8 A;  3W9W A;  1NUX A;  1VDW A;  4DXU A;  2R9J A;  4GWW A;  1IME A;  2Y7K A;  5ITP A;  1FPE A;  3IOR A;  4N07 A;  2XXI A;  4H6D A;  3UOR A;  5ICT A;  2R71 A;  2RCB A;  4EF1 A;  4F22 A;  3RY3 A;  5CI5 A;  4U1Z A;  4ND9 A;  3U72 A;  2QJE A;  2G93 A;  5F24 A;  2Q2A A;  3OEM A;  3VLV A;  1MRP A;  5I2K B;  4XTC Q;  3G3F A;  4QFN A;  3JYR A;  5KCJ B;  1MH4 A;  2XA5 A;  1Z7M E;  1B51 A;  2WKY A;  4R6H A;  1AL3 A;  3GZG A;  1SW4 A;  1NV0 A;  3IFC A;  4X8R A;  1MY4 A;  5A5X B;  1LAH E;  4KQP A;  1M5D A;  4C1U A;  5BWJ A;  2E0S A;  3LV0 A;  4PBQ A;  3C35 A;  3SKP A;  5B7D A;  1FTM A;  1MH3 A;  1I69 A;  3C33 A;  1SVX B;  3RN8 A;  3O66 A;  1SW1 A;  4OMB A;  4MBP A;  1Q35 A;  1FPL A;  3TAJ A;  3JV9 A;  2XX8 A;  1URG A;  4LQ5 A;  2QPQ A;  1D3K A;  2UVG A;  3E3K A;  1IMF A;  4Q8R A;  1EZ9 A;  3IOU A;  3RGY A;  4O94 A;  5K2Y A;  2V4C A;  1BIY A;  3VLW A;  2UYE A;  2Q2C A;  3L6H A;  4OHN A;  1LBW A;  3H6V A;  4JWX A;  1FTA A;  3DP6 A;  2VPO A;  1KA0 A;  4P1E A;  2O68 A;  1MXW A;  4TLM B;  4BDR A;  1LGB C;  1CB6 A;  4GOT A;  5AA2 B;  1YZ0 A;  1N7W A;  2I0C A;  4HXV A;  1MQI A;  4OVP A;  3BFU A;  3ONM A;  1S9T A;  2WEF A;  2B65 A;  3IAZ A;  4O3A A;  5L9M A;  2NXO A;  1NUY A;  3TQL A;  1LBB A;  4L17 A;  5DVI A;  3PUX E;  1HSE A;  1LBZ A;  2HHM A;  3MP8 A;  1B7H A;  2WBD A;  2G29 A;  3TCH A;  4F3G A;  3EKI A;  2Z22 A;  1HSL A;  3O6H A;  3RPW A;  2QS3 A;  1BTJ A;  4C1T A;  4C0R A;  2HAV A;  1PBQ A;  1NNF A;  2F34 A;  5ET7 A;  2OBG A;  3I3V A;  3S9N C;  1FRP A;  2H25 A;  5I7I A;  1D9Y A;  1SI1 A;  4N13 A;  1B1X A;  1RDY A;  4JWY A;  4H45 A;  1CNQ A;  3T9V A;  1OIB A;  2PFZ A;  4FEB A;  5H8Q B;  2L5V A;  3CVG A;  2ZZV A;  4LUB A;  3U94 A;  4PE5 B;  1M5E A;  4RY1 A;  4O3B A;  4NHB A;  2KLF A;  4PFR A;  3O29 A;  1FTK A;  4Q5T A;  4OVQ A;  3EHU A;  4LVQ A;  4QFK A;  4F2Q A;  1PB9 A;  3G3G A;  1N7X A;  3ILT B;  4NN3 A;  2QRY A;  4EDP A;  1FBE A;  1WDN A;  4I3Y A;  2F6G A;  1A54 A;  3HCQ A;  3VVE A;  5FHO A;  3TUS A;  4F39 A;  5IGA A;  4NF6 B;  3G3I A;  2QS1 A;  3CRB A;  3H3G A;  4U23 A;  4R75 A;  4QFO A;  2PT1 A;  2F36 A;  2FVZ A;  3PMV A;  4JSD A;  4GXA A;  2XXW A;  1GGG A;  2O69 A;  4ZEF A;  3PPR A;  5EHM A;  3FBP A;  2HQ0 A;  1N04 A;  4QF9 A;  1YTV A;  2XXK A;  1O7T A;  5ET5 A;  1SI0 A;  4P8B A;  4RPO A;  4TLL B;  3CIJ A;  2Q88 A;  3M3F A;  4OES A;  1SYI A;  4MFI A;  4LP2 B;  4R2B A;  1FPJ A;  1MY1 A;  2V3Q A;  3K00 A;  2F78 A;  4WXJ A;  3UP9 A;  1NV7 A;  3FV1 A;  4Z0I A;  1YYZ A;  3IOW A;  3K0V A;  3C31 A;  2AYS A;  1F9B A;  1Q9D A;  3H06 B;  4N6D A;  4PQJ A;  1VFD A;  4WKM A;  4AB6 A;  1FTO A;  1FQD A;  2RC8 A;  4PGN A;  4BDL A;  4GWZ A;  5H8H A;  2Y5L A;  4U1O A;  1A8F A;  1OQH A;  1QVS A;  3QXM A;  1CE2 A;  4MNC A;  1ZLQ A;  1IXH A;  3LC8 A;  1POY 1;  1FW0 A;  5ET6 A;  3K4U A;  3UGW A;  5IZ1 A;  1B9J A;  5DYH A;  4BDO A;  2HFB A;  1XS5 A;  3KOT A;  1NI9 A;  3HPI A;  2A5T B;  2DWI A;  3M3K A;  4XKR A;  2QS4 A;  2DOJ A;  4N6K A;  3N6U A;  5DVJ A;  3B8B A;  3C9H A;  4RNS A;  1NV4 A;  4R2F A;  2PT2 A;  3MWB A;  4MJO A;  1MY2 A;  3TEL A;  5I57 A;  4I9D A;  1IMB A;  5FTI A;  4DI3 D;  1FBG A;  4MNP A;  4ZE9 A;  2F3B A;  3TCG A;  4YKJ A;  2I58 A;  3CG3 A;  1INP A;  4NF0 A;  1B3E A;  4XKQ A;  4MEV A;  1P1O A;  2RC9 A;  4HE0 A;  4MX6 A;  3TTK A;  4GL0 A;  2DQV A;  4EXL A;  3FVO A;  3KGC A;  1D9Q A;  2DVC A;  3MPL A;  4PDD A;  3Q26 A;  1N76 A;  5TU0 A;  2V84 A;  3SEW A;  1PC3 A;  3MP6 A;  4OVJ A;  1NUZ A;  1R6Z A;  5I59 B;  2HXR A;  2CZI A;  4KYE A;  3TDJ A;  3SEX A;  2KR0 A;  1DMB A;  4GL8 A;  1LEV A;  3RT6 B;  3E4R A;  2AIX A;  4OVR A;  1PDA A;  3RQT A;  4X9T A;  1Y1M A;  3MQ9 A;  3KBR A;  1LB8 A;  1EYI A;  5CC2 A;  1M5B A;  3THI A;  3RLF E;  3TOD A;  5FBP A;  3CFZ A;  2LAO A;  3M8U A;  2ONS A;  4EF2 A;  1MS7 A;  4Q0C A;  2GQ1 A;  5CBR A;  4G2Z A;  2PYY A;  5ET8 A;  2Q8J A;  1QUJ A;  1MXU A;  5HM4 B;  5TP9 A;  1B3F A;  5ICQ A;  1FPD A;  1VE4 A;  2I4B A;  4QXD A;  4R6K A;  2VGQ A;  2FYI A;  5JTY A;  4IO3 A;  3RYD A;  2I3V A;  2THI A;  2XXR A;  3O6G A;  4NMY A;  4G68 C;  4N91 A;  3ODB A;  1MY0 A;  3DP4 A;  3PD9 A;  4LZ8 A;  4FE8 A;  1LAF E;  3RT8 A;  3PU5 A;  1A8E A;  4FJP A;  5AE4 A;  2V25 A;  4F3S A;  1TWY A;  1USY E;  3FXU A;  4YMA A;  3LSX A;  3UN6 A;  4I40 A;  5I56 B;  5IZZ A;  1XI6 A;  3T9H B;  4XXU A;  4QSE A; 
#chains in the Genus database with same CATH homology
 3OOA A;  1I69 A;  3ZKL A;  1EZP A;  4DCX A;  1PB8 A;  3EQ1 A;  3C33 A;  1SVX B;  3RN8 A;  3FJG A;  3O66 A;  1SW1 A;  2UVJ A;  3K1P A;  4OMB A;  5IAI A;  1H44 A;  4MBP A;  4F1Y A;  3CG1 A;  1Q35 A;  2VD3 A;  3MVZ A;  2VD2 A;  5CRY A;  1FTJ A;  3IO4 A;  1B3H A;  1LST A;  2UVH A;  2HZL A;  3TAJ A;  4FIM A;  2ZYM A;  1LCT A;  3N5L A;  4GFR A;  3JV9 A;  2XX8 A;  3OD7 A;  3CFL A;  4KCC A;  1URG A;  2OCU A;  4LQ5 A;  4IY5 A;  5KDT B;  1VR5 A;  5AA2 A;  1UQW A;  2QPQ A;  1D3K A;  2UVG A;  3IB1 A;  3E3K A;  1PEB A;  4Q8R A;  1ZJL A;  1EZ9 A;  1DPP A;  1T0K A;  3IOU A;  5H8F B;  2PX1 A;  3RGY A;  4X48 A;  5K2Y A;  4F29 A;  2Q89 A;  1II5 A;  1RKM A;  3GLB A;  4OXV A;  1BIY A;  1UIU A;  1P1W A;  3DM0 A;  3H6U A;  3MBP A;  3VLW A;  3C4M A;  5EHS A;  1GV8 A;  3ZSF A;  2UYE A;  2Q2C A;  2XXX A;  1BLF A;  2Y84 A;  3C34 A;  3L6H A;  3PD8 A;  4H8J A;  3RTF B;  4ZE8 A;  3FUZ A;  4OHN A;  1IIT A;  1GTK A;  3W9V A;  3VLU A;  4ZEI A;  3TTR A;  2BJJ X;  2ABH A;  2XXT A;  4G8N A;  4EUO A;  2D3I A;  3JZJ A;  5DVF A;  1NL5 A;  3TCF A;  3H6V A;  4JWX A;  3FJ7 A;  2ZYO A;  3FV2 A;  1FQE A;  3D4C A;  1VFE A;  4FED A;  4TQU Q;  1I6A A;  3PUY E;  2OWT A;  2I4C A;  3FAS A;  3DP6 A;  3KSJ A;  4GXS B;  4IGR A;  4P0G A;  4U4S A;  2RF1 A;  3OEK A;  4MF3 A;  5A5X A;  1B4H A;  1UIV A;  3G3K A;  1ANF A;  2O68 A;  1MXW A;  4TLM B;  2V3T A;  4BDR A;  1IXC A;  1LGB C;  1CB6 A;  2ALU A;  2IA4 A;  3HST A;  4GOT A;  3C32 A;  1VSO A;  4H5G A;  3SEV A;  3IR1 A;  4UAC A;  3A3U A;  1N7W A;  4F1V A;  1EH3 A;  2I0C A;  1MQI A;  4LA9 A;  5H8N B;  2XX7 A;  4IO5 A;  4RK2 A;  3S4U A;  3VDF A;  2OWS A;  2Y7I A;  4YB5 A;  4F19 A;  3BFU A;  1ZTY A;  3K6W A;  3KG2 A;  3ONM A;  5CMB A;  5ELV A;  5I84 A;  1JET A;  1B2H A;  1H76 A;  1B5H A;  2F5X A;  4OTE A;  3S2V A;  3TTM A;  1B32 A;  1S9T A;  3H4Z A;  4KYD A;  1IXI A;  1NNT A;  2B65 A;  3CSB A;  3IAZ A;  3OSR A;  4O3A A;  2NXO A;  5CMM A;  5L9M A;  3MZ1 A;  2Z8E A;  3KN3 A;  3R6U A;  1R9L A;  4H1X A;  2O1M A;  4NF8 A;  5TP9 B;  5H8N A;  4GQO A;  3SER A;  1KWH A;  2F7A A;  4KI0 E;  4F3P A;  4Q30 B;  3BBR A;  3K1N A;  1NH8 A;  3QIM A;  2B3F A;  3CR9 A;  2QSX A;  4POX A;  3TQL A;  1LBB A;  4OYV A;  2Z8F A;  4YZZ A;  3ECR A;  2XHD A;  3T22 A;  4L17 A;  4ZED A;  3ZS6 A;  2NWJ A;  2X7P A;  1GVC A;  1YPN A;  4DZ1 A;  4F3B A;  5DVI A;  3PUX E;  1HSE A;  3FXR A;  3FVG A;  3VV5 A;  1B05 A;  3G7W A;  2F8D A;  2H5Y A;  2ZNT A;  4O3C A;  5DT6 A;  3S9L C;  1B58 A;  3GBB A;  4R72 A;  3MP8 A;  1B7H A;  3Q29 A;  2G29 A;  3G3J A;  2VOZ A;  4LQ2 A;  4U4X A;  3TCH A;  4F3G A;  1MM7 A;  2Z22 A;  1HSL A;  3O6H A;  4OET A;  1B6H A;  3RPW A;  2QS3 A;  4HS7 A;  1BTJ A;  4MLQ A;  4C1T A;  3QYT A;  4C0R A;  2HAV A;  1FQA A;  1SQY A;  3U8Q A;  1PBQ A;  5CBS A;  1NNF A;  2F34 A;  1IUD A;  4YB6 A;  5I56 A;  4UA8 A;  1IIW A;  2AL5 A;  4YIC A;  2REJ A;  2I3W A;  1TFA A;  2FNC A;  2OBG A;  3UIF A;  3MVY A;  4YB7 A;  2REG A;  4IO2 A;  3T93 B;  3I3V A;  2H4I A;  3C36 A;  3TZA A;  1MPC A;  3S9N C;  1IQ7 A;  3IJX B;  4YU0 A;  2F7B A;  3FXQ A;  3LR1 A;  5I58 B;  3KZG A;  3PV0 E;  2H25 A;  5I2K A;  1WOD A;  1BKA A;  1D9Y A;  5KDT A;  4JXI A;  4ZEC A;  3MVW A;  1SI1 A;  3OO7 A;  1B1X A;  2RKM A;  3PUZ E;  4N13 A;  1MDQ A;  5ITO A;  3LSW A;  2DS9 A;  1JW4 A;  4GF8 A;  2X26 A;  4ZS9 A;  4JDF A;  2H98 A;  2V93 A;  3K02 A;  4R73 A;  2DXY A;  3VVF A;  1FTL A;  2YJP A;  4JWY A;  4NF5 B;  4U21 A;  3TMG A;  4ELR A;  4GVO A;  1LFG A;  4FAJ A;  3T9V A;  2O1L A;  4G68 A;  4GWO A;  4P0I A;  2RC7 A;  1OIB A;  4OFO A;  1UTB B;  4NWC A;  5M2V A;  1USY H;  4LON B;  4Z7E A;  4QHQ A;  4OQO A;  4RXL A;  3IJO B;  5KCJ A;  1ZKB A;  2D5W A;  3WAE A;  1N3X A;  1N84 A;  1J1N A;  1XVY A;  3B6W A;  2DWH A;  4FEB A;  2P1S A;  3PUV E;  5H8Q B;  5CM6 A;  1O63 A;  3CVG A;  5EYF A;  4LUB A;  4ZZE A;  3IX1 A;  5AA1 A;  4OEV A;  4PE5 B;  3SET A;  3TYH A;  1M5E A;  1XOC A;  3U94 A;  2RCA A;  4RY1 A;  5H8F A;  4OWD A;  1ZIU A;  4WEP A;  4O3B A;  2IEE A;  1MM6 A;  3UA8 A;  4ELO A;  3IO6 A;  1H43 A;  1LB9 A;  2KLF A;  1AH5 A;  3OXN A;  3O29 A;  5TPA B;  1FTK A;  2ZMB A;  4Q5T A;  1O64 A;  3ZKK A;  2ZYK A;  1N0T A;  3EHU A;  3K1M A;  3KFM A;  4LVQ A;  2HCA A;  3P7I A;  4YKI A;  1DTG A;  4QFK A;  4F2Q A;  3O2A A;  1WVJ A;  1UTH B;  2PBW A;  4KPT A;  4ZEK A;  1PB9 A;  3TFL A;  3VXC A;  4HW8 A;  4DE8 A;  1ZBM A;  3G3G A;  3HHG A;  1N7X A;  3ILT B;  2O6A A;  4NE4 A;  2O84 X;  3HO7 A;  3FZV A;  3Q25 A;  3TTN A;  3IL1 B;  2QRY A;  1RYX A;  4EDP A;  3QUF A;  2YPN A;  1URS A;  1WDN A;  3K6V A;  4I1D A;  2F6G A;  2ZNU A;  3LSL A;  1A54 A;  3VE1 B;  1ZU0 A;  3HCQ A;  3N94 A;  3OO6 A;  3VVE A;  1H45 A;  5I2N A;  3T9U A;  4ZEB A;  5FHM A;  4KCD A;  5FHO A;  1MXZ A;  1Q1K A;  1B3L A;  1QUL A;  1Y3P A;  3HHF A;  4R74 A;  4ELQ A;  4F39 A;  4NF6 B;  1IZ1 A;  4GIZ A;  3G3I A;  1S7Y A;  3TKD A;  2QS1 A;  4NF4 A;  2YLN A;  3CRB A;  3FVK A;  4OER A;  2VP1 A;  3H3G A;  2H99 A;  1JQF A;  4U23 A;  3U92 A;  4BDM A;  1QKB A;  3MUQ A;  3PGF A;  4R75 A;  1OLA A;  4QFO A;  2DXR A;  2PT1 A;  2F36 A;  3PMV A;  2DYX A;  4JSD A;  4GXA A;  1M5C A;  3VVD A;  2XXW A;  1GGG A;  1QJM A;  2DE2 A;  2O69 A;  3EF7 A;  3PPR A;  4WED A;  5EHM A;  4ZEF A;  3V83 A;  4POW A;  2F6P A;  4HCY A;  5DTB A;  5HBC A;  2XXV A;  4PP0 A;  2HQ0 A;  3V5A A;  2X7Q A;  2HAU A;  3PPP A;  5ISU A;  3USD A;  1N04 A;  3QAX A;  4PFT A;  1S50 A;  3SDF A;  2F35 A;  2Y7W A;  3TTL A;  4QF9 A;  4F18 A;  1YTV A;  3TPA A;  4NWD A;  5CMK A;  1DPE A;  1MG1 A;  1AOV A;  1LLS A;  2XD2 A;  1O7T A;  1URD A;  2O7U A;  3Q27 A;  3SEU A;  3F11 A;  2E1S A;  4X1B A;  1SD3 A;  5K2X A;  3SEY A;  1SI0 A;  3IOV A;  5AA4 B;  2HXW A;  4U2R A;  4RPO A;  4TLL B;  3CIJ A;  1MPB A;  3DP8 A;  1OVB A;  4RA1 A;  2DVZ A;  2Q88 A;  3E9X A;  3IB0 A;  5DEX B;  3M3F A;  3QUJ A;  1A7L A;  4N6P A;  2Z23 A;  2D21 A;  1JEV A;  1MDP 1;  1SYI A;  3I6V A;  3MZB A;  4GRK A;  4MFI A;  4OES A;  1XVX A;  4LP2 B;  3UK4 A;  5F1Q A;  3V89 B;  4R2B A;  2Y7R A;  1JW1 A;  1P1U A;  1MY1 A;  2V3Q A;  3K00 A;  3RUM A;  1B3G A;  2QS2 A;  2F78 A;  4WXJ A;  2I6E A;  3LUY A;  3PUW E;  2DE3 A;  2I48 A;  3K6X A;  5H8S A;  1L5T A;  2NVU B;  3UP9 A;  5DEX A;  3FV1 A;  3PMX A;  4Z0I A;  3IOW A;  1P1N A;  3K0V A;  2A5T A;  3EHS A;  3O97 A;  2PMS A;  4PFW A;  3H03 A;  1B40 A;  3C31 A;  4ELP A;  2GRV A;  5J1D A;  1QKA A;  4G77 A;  4OEU A;  4FEC A;  4YKK A;  2GH9 A;  4E0W A;  5I59 A;  3MW0 A;  2AYS A;  1P99 A;  4HCW A;  3T96 B;  1F9B A;  4K3F A;  4PFU A;  4QRZ A;  4BDN A;  3H06 B;  4ECF A;  2RIN A;  4PQJ A;  3B7D A;  1PB7 A;  3IB2 A;  1VFD A;  4WKM A;  1H3D A;  1XHY A;  1MQH A;  4AB6 A;  3FGS A;  2AL4 A;  4P11 A;  2O7I A;  4I62 A;  1FTO A;  2OLB A;  1I6B A;  1LFI A;  4OZ9 A;  4F31 B;  1B7Z A;  1FQD A;  1R1N A;  1B5J A;  1JNF A;  2RC8 A;  4ISU A;  3N26 A;  4THI A;  2ONR A;  1US5 A;  4BDL A;  3MJN A;  3TEP A;  1B0L A;  4QSC A;  5F7V A;  5H8H A;  4XKR A;  4U1O A;  1A8F A;  2NOO A;  1OQH A;  5BUU A;  1QVS A;  4NED A;  3QXM A;  2ZYN A;  1JVY A;  2PVU A;  3PPN A;  1CE2 A;  5TPA A;  3OEN A;  5CMC A;  1B1H A;  1Y9U A;  5I57 B;  1SBP A;  1ZLQ A;  1IXH A;  3D4G A;  3EPE A;  1POY 1;  1FW0 A;  3FVN A;  3LC8 A;  1B7U A;  4G4P A;  3K4U A;  4IB2 A;  4NF5 A;  3K6U A;  3OO8 A;  1B9J A;  5JTY B;  5DYH A;  3UGW A;  5L9S A;  3S9M C;  1TXF A;  1Y3N A;  2CMO A;  4I8C A;  1MY3 A;  4BDO A;  2HFB A;  1JW5 A;  1QUK A;  1AMF A;  1XS5 A;  2GHA A;  1I6Q A;  2OZZ A;  3HPI A;  3KOT A;  2A5T B;  2DWI A;  2XXQ A;  3FD3 A;  3M3K A;  3OO9 A;  1Y4C A;  4NF4 B;  3KSX A;  1SYH A;  1NFT A;  1N3W A;  2QS4 A;  2DOJ A;  1OQG A;  1Y20 A;  1RYO A;  3FJM A;  1B0H A;  3MC2 A;  3N6U A;  5DVJ A;  4EQ7 A;  4GLI A;  3C9H A;  4IO7 A;  4RNS A;  1FCK A;  1OVT A;  3U93 A;  2PT2 A;  3MWB A;  3MPK A;  3QK6 A;  1MY2 A;  4H0W A;  1MXV A;  4OEN A;  4R2F A;  3TEL A;  1MQJ A;  2DP8 A;  5AA2 B;  5B70 A;  3GXA A;  4I9D A;  3H6W A;  3B6T A;  1FQB A;  1D4N A;  4G8M A;  4R9F A;  3QSL A;  1D9V A;  1YCJ A;  5FTI A;  4AQ4 A;  4EQB A;  1ELJ A;  5H8H B;  3B6Q A;  1MQD A;  4YAH X;  4ZE9 A;  2DSF A;  3OSQ A;  5L9O A;  1B52 A;  2GHB A;  2V3U A;  3RTW B;  2QMW A;  3TCG A;  5L8D A;  4YKJ A;  4DIG A;  4DXB A;  2I58 A;  3CG3 A;  4OFJ A;  4XIG Q;  3PPQ A;  3L6G A;  4LAT A;  3VXB A;  1NKX A;  4YMB A;  5AA4 A;  1B3E A;  4XKQ A;  4H67 A;  4EXK A;  2XXU A;  5FTH A;  3ILU B;  1NNP A;  1P1O A;  2RC9 A;  1A55 A;  4OFL A;  3TTK A;  4GL0 A;  3CSG A;  4F2O A;  2DE4 A;  1OMP A;  2DQV A;  3MAM A;  1DSN A;  3SES A;  3E13 X;  3FVO A;  3BFT A;  3CI8 A;  3H7M A;  3KGC A;  4RPN A;  4ZZA A;  4EXL A;  2XXY A;  2F97 A;  2VHA A;  1QW0 A;  2I49 A;  1ATG A;  3K2D A;  4JB7 A;  2QL3 A;  3KN7 A;  3RNN A;  2XXP A;  5AA2 D;  2DVC A;  1JVX A;  2B3B A;  3T9X B;  3MPL A;  1SDX A;  4E0X A;  2M8C A;  1N76 A;  3Q26 A;  4F1U A;  4IO6 A;  1JEU A;  3TUS A;  4G68 B;  2XX9 A;  5TU0 A;  2V84 A;  3Q28 A;  3SEW A;  1TFD A;  3OEL A;  2ANJ A;  1B46 A;  1FQC A;  1PC3 A;  2CZL A;  2UVI A;  3MP6 A;  4OVJ A;  3WAF A;  2HZK A;  4AB5 A;  4DCY A;  5IKB A;  4BLA A;  1R6Z A;  1Y3Q A;  3DLN A;  1MXY A;  4H65 A;  4KYS A;  4MH5 A;  1MQG A;  4QSD A;  2HEU A;  5I59 B;  4RJZ A;  1A99 A;  1YAE A;  3MP1 A;  4NF6 A;  1PBP A;  2UXA A;  3MVX A;  3KOS A;  2I0B A;  2F7C A;  2P2A A;  3KJ7 A;  2W7Y A;  5KZT A;  2R6G E;  3FAT A;  4ESW A;  1NMU A;  1BP5 A;  1UTH A;  1DTZ A;  1Y4T A;  3A3C A;  5I2N B;  3O9P A;  4KYE A;  1EU8 A;  3TDJ A;  5JEI A;  3OMB A;  3SEX A;  3W9W A;  2ZNS A;  3G3H A;  1DMB A;  1Y1Z A;  3AXF A;  4TOZ A;  1FQF A;  4KHZ E;  4FOR A;  4XKP A;  4DXU A;  4GL8 A;  4YKP A;  1POT A;  2R9J A;  4HTG A;  1A40 A;  4NF8 B;  4KD5 A;  3RT6 B;  3PPO A;  5HPQ A;  3E4R A;  2NUV A;  2AIX A;  4NTL A;  4DDD A;  1LAX A;  1PDA A;  4KFQ A;  3R7X A;  3KN8 A;  4X9T A;  3RQT A;  1Y1M A;  1IXG A;  2Y7K A;  1LB8 A;  3KBR A;  2XD3 A;  3MQ9 A;  5ITP A;  4DXC A;  4LZ5 A;  3N6T A;  4R6Y A;  5CC2 A;  4RYA A;  4GD5 A;  1M5B A;  4EQ9 A;  3CFX A;  4ESX A;  2A5S A;  4FAT A;  1UTB A;  2P0S A;  4R9G A;  3THI A;  1HSJ A;  1QUI A;  3K01 A;  3RLF E;  3TOD A;  2UYF A;  4H8I A;  1AIV A;  3CFZ A;  2LAO A;  3TQW A;  1B4Z A;  3V8X B;  1MPD A;  3IOR A;  2ZXT A;  3M8U A;  4BDQ A;  2ONS A;  4N07 A;  1MS7 A;  2ESN A;  4Q0C A;  4EF2 A;  5CBR A;  2XXI A;  1NNK A;  4G2Z A;  4H6D A;  3UOR A;  5ICT A;  2PYY A;  1US4 A;  2R71 A;  4QSE A;  3HN0 A;  2Q8J A;  1P1Q A;  1ZMG A;  2QMX A;  1QUJ A;  2RCB A;  4DLD A;  2OK2 A;  1MXU A;  3BKI B;  3IK6 B;  4ZDM A;  5HM4 B;  4EF1 A;  3FIR A;  3DEL B;  4H5F A;  4F22 A;  3RY3 A;  2ONK E;  5CI5 A;  1IEJ A;  5TP9 A;  1M5F A;  4G8H A;  1R9Q A;  5FHN A;  4U1Z A;  1B3F A;  5ICQ A;  4X1D A;  4ND9 A;  3U72 A;  1OLC A;  1VE4 A;  2QJE A;  2G93 A;  4PFY A;  3O28 A;  3VLV A;  2I4B A;  2Q2A A;  3OEM A;  2DWA A;  1MRP A;  3O6I A;  4JSO A;  4R6K A;  2VGQ A;  3EHT A;  2FYI A;  5I2K B;  4XTC Q;  3G3F A;  4IO3 A;  5JTY A;  4QFN A;  3JYR A;  2I3V A;  2THI A;  5KCJ B;  2XXR A;  1MH4 A;  1GR2 A;  1XT8 A;  3O6G A;  4JWO A;  1Z7M E;  3S9E A;  4MLV A;  4RK9 A;  4PET A;  4NMY A;  1B51 A;  3M3L A;  4G68 C;  3H6T A;  3R26 A;  2WKY A;  4XKN A;  3U1O A;  5I57 A;  1XC1 A;  3KJT A;  4R6H A;  1AL3 A;  3GZG A;  5LOM A;  1SW4 A;  3EN3 A;  3ODB A;  4IO4 A;  2Y7P A;  4LZ7 A;  1MY0 A;  4QFL A;  1LCF A;  2O51 A;  3DP4 A;  3PD9 A;  1Z7N E;  3HV1 A;  2GFE A;  1MY4 A;  3A09 A;  3GBA A;  4LZ8 A;  1SW5 A;  4ONY A;  1LAH E;  3T66 A;  3VFJ A;  5A5X B;  4FE8 A;  1LAF E;  4KQP A;  4U22 A;  3PMW A;  1M5D A;  3MZ9 A;  4QFP A;  4C1U A;  3RT8 A;  1B5I A;  3PU5 A;  1MXX A;  1A8E A;  1NH7 A;  1LBC A;  1LAG E;  2Z8D A;  5I58 A;  4FJP A;  1SW2 A;  5H8Q A;  4IGT A;  5AE4 A;  2Q9T A;  5BWJ A;  1EZO A;  2E0S A;  2V25 A;  3KEI A;  4M1V A;  1DOT A;  1TT1 A;  4F3S A;  2XXH A;  3LSF B;  1TWY A;  1USY E;  1LFH A;  3FXU A;  3C35 A;  2H9B A;  5AA3 A;  4KR5 A;  4JBZ A;  2DWJ A;  3SKP A;  3I5O A;  4YMA A;  3LSX A;  3UN6 A;  5B7D A;  1FTM A;  2FA7 A;  3LBS A;  5I56 B;  3IOT A;  4XXU A;  4IY6 A;  1MH3 A;  2OJT A;  3T9H B;  4M4G A;  5JK4 A;  3W15 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...