4NF6A

Crystal structure of glun1/glun2a ligand-binding domain in complex with glycine and ppda
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
287
structure length
278
Chain Sequence
TRLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPVKKVICTGPNHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate receptor ionotropic, NMDA 1
publication title Structural Insights into Competitive Antagonism in NMDA Receptors.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein, receptor
total genus 82
structure length 278
sequence length 287
ec nomenclature
pdb deposition date 2013-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4nf6A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4nf6A02
2D3IA 2OJTA 4MH5A 1SDXA 1I69A 4RK2A 1B52A 1DTGA 1XS5A 4EQ7A 5CMKA 2F34A 4RY1A 3AXFA 4OVJA 2YLNA 5ITOA 2A5TA 1MQDA 1EZPA 2DYXA 2DS9A 3CG3A 2RC9A 4KQPA 5HPQA 3RTWB 2HQ0A 1MQHA 3EHTA 3TEPA 3K6UA 2G93A 1PBPA 5TP9A 5KDTB 5I59B 5ELVA 2OK2A 2UVIA 4H65A 1MY0A 1B4HA 4F3BA 2REJA 4UA8A 1FQEA 3N5LA 1OVBA 2RC8A 1ZBMA 4QFNA 3CR9A 1OQHA 4F3PA 4GD5A 3VLVA 3RUMA 4EXKA 1IZ1A 1LBCA 3VV5A 5H8SA 4U2RA 3H6TA 4FATA 2VD2A 2AL5A 2I48A 3SEUA 2F7CA 3GXAA 1FQAA 1A55A 2DXRA 1QVSA 1USYE 1JW4A 3VVFA 4GXSB 2DVZA 3O6IA 2X7QA 1LB8A 4QFLA 4YU0A 1JVYA 4IY5A 4PFTA 5H8FA 3O9PA 3CRBA 3KEIA 2HAVA 1PB8A 1JETA 1TXFA 4DXCA 1NNFA 2Q2CA 3W9WA 4R6YA 1OLCA 1MY3A 4C1UA 5L8DA 2V93A 2R71A 4KI0E 1Y1ZA 1Q1KA 4ISUA 1Y4TA 4GQOA 4F2OA 5AA4A 3MAMA 1WDNA 1F9BA 3IK6B 1LAFE 1RKMA 4ZZEA 3K6XA 1BLFA 4OYVA 3IJOB 1I6BA 4JXIA 4FEBA 3MP8A 1AH5A 2V25A 4IO6A 2GRVA 1SD3A 2I6EA 5BWJA 3PMXA 4KD5A 2RCAA 1H44A 1B40A 3M3KA 1PBQA 2XXIA 5AA3A 2ABHA 2XX8A 1Y9UA 2VOZA 2GFEA 1YTVA 2NOOA 3V5AA 4G8MA 1LCTA 3KJ7A 3OXNA 3IORA 3VLUA 4C0RA 1PEBA 1QUJA 4YKPA 4LZ5A 2A5TB 4FEDA 4LONB 1MH3A 4R74A 4U1ZA 4JSOA 4KPTA 1A8FA 3TTMA 3CSBA 5DVFA 1N7WA 3PPRA 4AQ4A 2XX7A 1MXXA 4I9DA 5AE4A 5TP9B 1MS7A 1URSA 3CG1A 1IQ7A 2O1MA 2F97A 2DWIA 1MPBA 2Q8JA 4OERA 4NE4A 4YB7A 3JV9A 1RYOA 3SETA 4XKNA 1B3LA 3RGYA 3MBPA 3THIA 4JBZA 3H6VA 1P1WA 4GFRA 1HSEA 4QFPA 2OZZA 5CBRA 2KLFA 3B7DA 4O3CA 1OMPA 4TLLB 1L5TA 1A99A 3PUVE 4DE8A 2O51A 4YB6A 3PGFA 3RT6B 4F39A 2XXTA 4F3SA 2I0CA 3LSFB 3O6GA 4OFOA 3UGWA 2XXPA 3FJ7A 4EXLA 5FHMA 3UN6A 3O2AA 4GRKA 2H25A 3IO6A 4LUBA 4HTGA 4DIGA 2F7AA 4RA1A 4F1UA 3HHFA 2ONRA 3VLWA 5DYHA 2Y7PA 2O69A 4IO2A 2PX1A 3VXCA 5I57A 5EHMA 1VFEA 4GVOA 2ZYOA 5H8FB 3DLNA 4OHNA 1BP5A 1A40A 5FTIA 1N04A 1LCFA 1LFGA 1QUIA 3VE1B 1URDA 4NWCA 2VP1A 3HCQA 1I6AA 2O68A 2F7BA 1MH4A 3PMWA 3S4UA 2ZNUA 3KSXA 2OWTA 4QHQA 2M8CA 3EQ1A 4NF5B 1B3GA 5L9OA 4R75A 3N6UA 2H5YA 2RINA 4MLVA 3TQWA 1LFIA 3TZAA 1MY1A 3MVXA 4IO3A 5AA4B 3PV0E 3U1OA 4L17A 1FCKA 3W9VA 3OD7A 5K2XA 3A3CA 3OEKA 4LA9A 1J1NA 1US4A 4N6PA 3GLBA 3TAJA 4R9FA 2Q9TA 2I58A 1UTHA 3I5OA 1LB9A 3S2VA 3U92A 1TFAA 4F19A 1UQWA 4R9GA 3VXBA 1A7LA 2Y84A 3TQLA 2Y7WA 5JTYA 4XXUA 5DEXA 5AA1A 5CMBA 1B7UA 2F6GA 4KFQA 1FQBA 1CE2A 3BBRA 4MLQA 3WAEA 3V89B 4G68A 4H67A 1R1NA 2Q2AA 3V8XB 1DSNA 3T22A 1D4NA 4DXUA 1MPDA 4ZE8A 1VSOA 2B3FA 3KSJA 1Y3NA 2IA4A 4PE5B 4HCWA 4EUOA 4RPOA 2I3VA 2I49A 4AB6A 1N7XA 3LUYA 2XHDA 4KYSA 1JQFA 4YKIA 3TYHA 3EHSA 4TOZA 4RXLA 5M2VA 3RT8A 2OWSA 3U94A 3C34A 3QAXA 1TWYA 3FGSA 3H6UA 3VVEA 1O64A 1QJMA 2DVCA 3C31A 3LSLA 1SQYA 2DE3A 1S9TA 4R2BA 1N3WA 4LP2B 4DLDA 1IEJA 4QSDA 4ZZAA 3KN3A 3HPIA 1VE4A 3QXMA 4GL8A 3P7IA 3TTRA 5KZTA 1IUDA 5DVJA 4R6HA 3EN3A 5CMCA 1D9YA 4POXA 3K1PA 2NWJA 1EZOA 4Q0CA 3PPQA 5DVIA 5EHSA 3FXRA 1SI0A 2HAUA 3MW0A 3ZKKA 4ELQA 3UP9A 1LAHE 3QIMA 4R73A 3MVYA 1YPNA 3CFZA 4NEDA 1H45A 5H8NA 2UVJA 1IXHA 2UYEA 1EH3A 1B05A 2YPNA 1PC3A 1P1NA 3HHGA 3ZS6A 4MBPA 4KYDA 5I57B 1MXZA 3G3GA 3KJTA 4OXVA 3FASA 1I6QA 3DM0A 2FYIA 4NTLA 4I8CA 2CZLA 4OEVA 4JWOA 3TUSA 4UACA 3IJXB 4OQOA 5CI5A 2NUVA 2UVGA 3QSLA 3R6UA 3B6WA 3FVKA 4C1TA 4F2QA 2UXAA 1VR5A 4G68C 4P0GA 2F8DA 1R6ZA 2DE4A 2V3QA 3SEYA 3PUXE 4IY6A 2F78A 5CRYA 2QMWA 4OEUA 3M3FA 1MDQA 3TODA 1UTBA 4NF4A 5I84A 2OLBA 3Q29A 1MDP1 1IIWA 2ONSA 2GH9A 4PFWA 4HS7A 1N3XA 2QMXA 2HXWA 3IX1A 4QSEA 4ELPA 3SEVA 3F11A 1UTHB 4ZECA 4YZZA 1GGGA 1IXGA 5ICTA 2DWAA 1SW2A 3UA8A 3T9UA 3CVGA 1JEVA 1B3FA 4X48A 1S7YA 1OLAA 4ZEKA 1B58A 5I56A 3FATA 2FA7A 2H4IA 3RY3A 4JDFA 4JB7A 5DEXB 1YCJA 1DPEA 2ZYNA 4LZ7A 1IXCA 2ZYKA 5A5XA 3IB2A 4Q8RA 3KOSA 4U4XA 5FHNA 4G68B 2W7YA 1MM6A 4X1DA 1TFDA 4PQJA 3DP6A 3TKDA 5EYFA 4JWYA 2RKMA 4QFKA 3H3GA 3TELA 4U23A 3G3JA 2P2AA 1IITA 1JEUA 4DDDA 4M1VA 1M5DA 3OSQA 3FJMA 1NH8A 4IO7A 4OFJA 4F18A 1LAGE 4XIGQ 3E13X 3IL1B 2NXOA 1B5IA 4HW8A 3E9XA 2H98A 3KOTA 3SERA 1NNPA 2CMOA 4R6KA 4MF3A 1FQDA 4AB5A 3B6QA 1SYHA 3H7MA 3K1MA 2PMSA 4X1BA 4Z0IA 3A09A 4H1XA 4DCXA 2F5XA 1POTA 2X7PA 3G7WA 4BDOA 3PU5A 2HCAA 4RJZA 3SDFA 1XT8A 1MY4A 3M3LA 4YMAA 4M4GA 4H5GA 1B32A 4G8HA 3USDA 3KZGA 3T93B 3LC8A 1PDAA 1B1XA 1AL3A 2QPQA 4YKJA 4RPNA 4XKQA 1FTMA 4QF9A 2Q88A 2DOJA 3IO4A 3KGCA 4EF2A 3E4RA 2F35A 4ZE9A 3IB0A 3K2DA 3MQ9A 3FJGA 3QUFA 4YMBA 1MQIA 2P1SA 1P1UA 2VHAA 1BIYA 5TU0A 1GV8A 3IAZA 4TQUQ 3K0VA 4KHZE 3S9NC 3LSXA 1JVXA 3G3FA 2XD2A 4EQBA 4GIZA 2HZKA 3TCHA 1AMFA 5IKBA 4NWDA 1FQCA 4F1YA 3MVZA 4I62A 3CFLA 1SW5A 2I3WA 3D4CA 1FTOA 1Y3QA 5TPAA 4QRZA 4ECFA 5AA2A 1UTBB 3MPLA 4NF4B 3V83A 3O28A 3MP6A 4BDMA 2THIA 5L9MA 4ZDMA 3OO7A 5I2KA 1QULA 4HCYA 2O7IA 4P0IA 3EF7A 1Y4CA 3ONMA 3H4ZA 1US5A 1QW0A 3G3KA 5I56B 3OSRA 4XTCQ 5H8QA 4ELOA 4NF8A 2HEUA 5A5XB 3L6HA 2OCUA 3MZBA 3ZSFA 5BUUA 1TT1A 3S9MC 3T66A 5LOMA 2HZLA 1Z7NE 2O1LA 2RCBA 3RNNA 4OETA 1HSLA 3O6HA 1D9VA 3A3UA 4OESA 5F1QA 5CMMA 4U22A 3T9XB 3KBRA 2X26A 3U8QA 3BFTA 5ITPA 2XXWA 2XXUA 3G3HA 2DWJA 3MJNA 1MXUA 4IGRA 3R26A 3EHUA 1WVJA 4DZ1A 2B65A 3TMGA 5KCJA 3EPEA 1USYH 3K01A 4N07A 1B46A 5HM4B 1NNKA 3RQTA 3TDJA 2E1SA 2XD3A 5CBSA 4G2ZA 1LLSA 2PT2A 3VFJA 5I2NA 3ZKLA 4WKMA 3HN0A 1FTJA 3O97A 3H06B 1ZU0A 4O3BA 5H8HA 3OELA 2HFBA 4N13A 3T9VA 4BDQA 4G8NA 3O29A 3LSWA 4YAHX 4JWXA 3W15C 1ZKBA 4FE8A 2G29A 3C36A 2AYSA 3N6TA 3N94A 3QUJA 1B6HA 2F36A 3CIJA 1B5JA 4NF6A 5J1DA 3MC2A 2UYFA 3GBAA 1N0TA 1MG1A 1FW0A 1M5FA 2DP8A 1B5HA 3RLFE 3TFLA 1MY2A 2QJEA 1XVXA 1H76A 2XXHA 5B7DA 4GLIA 2O6AA 2QSXA 3OEMA 1H43A 3S9LC 4LATA 2ZXTA 5TPAB 1M5EA 5AA2B 1ZLQA 3CSGA 3C9HA 3MWBA 3N26A 3K4UA 1ANFA 3K00A 1MM7A 3FZVA 3UIFA 2ZNSA 3ILTB 4BDLA 5I2KB 3C33A 2I4CA 3B6TA 4X9TA 5FHOA 1ELJA 4DXBA 3I6VA 1H3DA 4IO4A 2XXYA 4QFOA 1LBBA 2IEEA 1Y20A 4KCDA 1NKXA 5DT6A 3TCGA 3FV2A 3FXUA 4F29A 4FORA 5H8QB 1SW1A 4NF8B 1JW5A 5CC2A 2Q89A 4OTEA 1LFHA 4PP0A 4H0WA 3FVOA 2R9JA 4K3FA 1OQGA 2ONKE 4EDPA 3TTLA 3PMVA 1IXIA 3TPAA 1II5A 2RF1A 3OO6A 3KFMA 1R9LA 4F1VA 4Z7EA 1MQJA 1MRPA 3OENA 2GHAA 4FECA 2BJJX 3MP1A 1B3EA 4IO5A 1NL5A 4I1DA 1SYIA 1YAEA 1QKBA 3G3IA 1MXWA 3OO8A 3TTNA 1SI1A 2AIXA 4BLAA 1FQFA 1M5BA 1MQGA 4ELRA 4U1OA 1O63A 3U93A 2Z8DA 3UK4A 2ZYMA 4FIMA 4WEPA 1MPCA 1EZ9A 1B9JA 1RYXA 5KCJB 4OMBA 2PT1A 3C32A 3MVWA 2REGA 3CI8A 2Z8EA 5JTYB 3VDFA 4MFIA 3ECRA 4R72A 2GHBA 1B7ZA 5I2NB 4OFLA 4H5FA 3E3KA 3PPPA 2P0SA 3GZGA 4POWA 4ZEDA 5F7VA 3C35A 1OVTA 1UIUA 1EU8A 3IOUA 3O66A 3L6GA 3KN7A 5H8HB 4BDNA 2DXYA 4OWDA 2ANJA 5I58A 3IR1A 4U4SA 4E0XA 3TTKA 4NF5A 1JW1A 4ONYA 4F3GA 3BFUA 1P99A 3IOTA 1Q35A 3VVDA 2WKYA 1VFDA 1FTKA 4NF6B 1DPPA 3U72A 1WODA 4GWOA 3MUQA 2PBWA 3K1NA 3OO9A 1NH7A 3FD3A 3R7XA 3GBBA 4PFUA 2D21A 4H6DA 3Q25A 2F6PA 4ESWA 3IB1A 2DWHA 5K2YA 2FNCA 3SEWA 4ZEFA 4IGTA 3PPNA 5IAIA 3S9EA 4BDRA 4TLMB 3Q28A 4RNSA 4XKRA 1NMUA 3HSTA 2A5SA 1ZJLA 2B3BA 3ILUB 1Y1MA 1BKAA 5H8NB 3QYTA 5L9SA 1AIVA 2QS2A 4ZS9A 2E0SA 1D3KA 4JSDA 3DP8A 4ESXA 1OIBA 2PYYA 3TCFA 3FUZA 2VGQA 2OBGA 4OZ9A 5JEIA 3FIRA 3OOAA 3FVNA 1AOVA 2NVUB 5ICQA 4YKKA 3M8UA 4G4PA 4H8IA 1CB6A 3ODBA 1XHYA 4OENA 3HV1A 1S50A 3PUWE 1BTJA 2DQVA 4YICA 3JYRA 2O7UA 5HBCA 4QSCA 2DSFA 3H6WA 1QUKA 1LAXA 1DMBA 3RN8A 3SESA 4FJPA 3Q27A 4GXAA 1XOCA 4XKPA 5B70A 1PB7A 4WXJA 2QS3A 3MPKA 4RYAA 4P11A 1B7HA 4LZ8A 3PUZE 4LQ2A 5JK4A 3WAFA 2XX9A 1NFTA 3Q26A 2V3UA 2V84A 1FTLA 2QRYA 4F22A 3MZ9A 3JZJA 1LSTA 2Z22A 2Y7RA 4PFYA 1ZMGA 3HO7A 3BKIB 4H8JA 1DTZA 1T0KA 3H03A 1B1HA 5KDTA 5I59A 1B3HA 2RC7A 1NNTA 3RPWA 1B2HA 3LBSA 1B4ZA 2H99A 4GOTA 1N76A 4KYEA 1Y3PA 4KCCA 4EF1A 4ZEIA 2XXVA 1URGA 2Z23A 4Q5TA 2DE2A 3FXQA 4O3AA 4F31B 5AA2D 1MXYA 1KWHA 5I58B 2UVHA 2Y7KA 3K6WA 1B0LA 2I4BA 2LAOA 4IB2A 3UORA 1Z7ME 2O84X 2ESNA 1ZIUA 4THIA 5ISUA 3DP4A 2XXRA 1B0HA 1POY1 3T96B 4FAJA 2QS4A 2XXQA 4Q30B 3MZ1A 4RK9A 2V3TA 2H9BA 4KR5A 1HSJA 4ND9A 4LVQA 3QK6A 3SEXA 4G77A 4U21A 4WEDA 3FVGA 2PVUA 1LGBC 1SW4A 3K02A 3RTFB 3KN8A 3LR1A 4GF8A 1PB9A 3KG2A 5DTBA 1GTKA 2QL3A 1QKAA 5FTHA 1O7TA 1SVXB 3PD9A 1MXVA 1DOTA 1A8EA 2VD3A 4EQ9A 2ALUA 3PPOA 4PETA 3C4MA 2QS1A 3OMBA 2YJPA 2Y7IA 3K6VA 2Z8FA 4NMYA 3SKPA 4ZEBA 1A54A 5CM6A 1ATGA 4GL0A 3T9HB 2AL4A 1P1QA 2ZMBA 4YB5A 2R6GE 3FV1A 3IOWA 1JNFA 1SBPA 2I0BA 2D5WA 4E0WA 3CFXA 4R2FA 4DCYA 3D4GA 4LQ5A 3DELB 3PUYE 1N84A 1R9QA 1M5CA 2ZNTA 1XC1A 1GVCA 3IOVA 1GR2A 1ZTYA 2XXXA 1UIVA 1XVYA 3PD8A 3I3VA 1B51A 1P1OA
chains in the Genus database with same CATH superfamily
2D3IA 2OJTA 4MH5A 1SDXA 1I69A 2WBBA 4RK2A 4UABA 1B52A 1DTGA 1XS5A 4EQ7A 5CMKA 2F34A 4RY1A 3AXFA 4OVJA 4IR8A 5DW8A 2YLNA 5ITOA 2A5TA 1MQDA 2JJKA 1EZPA 2DYXA 4HXVA 2DS9A 3CG3A 2RC9A 4KQPA 3LUZA 5HPQA 3RTWB 4AS5A 2HQ0A 1MQHA 3EHTA 3TEPA 3K6UA 4NGUA 5EQAA 1FBEA 2G93A 1PBPA 5TP9A 2XWVA 1EYIA 5KDTB 5I59B 5ELVA 2OK2A 2UVIA 4H65A 1MY0A 1B4HA 4F3BA 2REJA 4UA8A 1VDWA 4O7MA 1FQEA 3N5LA 1OVBA 2RC8A 1ZBMA 4QFNA 3CR9A 1OQHA 2XXKA 4F3PA 1FPBA 4GD5A 4JVDA 3VLVA 3RUMA 4EXKA 1IZ1A 1LBCA 5ESYA 3VV5A 5H8SA 4U2RA 3H6TA 4FATA 1YXIA 2VD2A 2AL5A 2Q8MA 2I48A 3SEUA 2F7CA 3GXAA 4PBQA 1FQAA 1A55A 2DXRA 3B50A 1FPIA 2Q74A 1QVSA 1USYE 1JW4A 3VVFA 4GXSB 2DVZA 4PAKA 3O6IA 2X7QA 1LB8A 4QFLA 4YU0A 1JVYA 4IY5A 4PFTA 5H8FA 3O9PA 3CRBA 3KEIA 2FBPA 4OA4A 2HAVA 1PB8A 1JETA 1TXFA 4DXCA 2WYPA 1IMCA 4P56A 1FBPA 1NNFA 2Q2CA 3W9WA 5ET6A 4R6YA 4G61A 5EYGA 1OLCA 1MY3A 4C1UA 5L8DA 2V93A 2R71A 4KI0E 1Y1ZA 3BIHA 1Q1KA 4ISUA 1Y4TA 4GQOA 4F2OA 4NF0A 5AA4A 3MAMA 1WDNA 1F9BA 3IK6B 1LAFE 1RKMA 4PGNA 4ZZEA 3K6XA 1BLFA 4OYVA 3IJOB 1I6BA 4JXIA 4FEBA 3MP8A 1AH5A 2V25A 4IO6A 2GRVA 1SD3A 2I6EA 5BWJA 3PMXA 4KD5A 2ZZWA 2RCAA 1H44A 1B40A 3M3KA 1PBQA 2XXIA 5AA3A 2ABHA 2XX8A 1Y9UA 2VOZA 2GFEA 1FPGA 4LN5A 1YTVA 2NOOA 3V5AA 2QVVA 4GBWA 4G8MA 1LBZA 1LCTA 3KJ7A 3OXNA 3IORA 3VLUA 4C0RA 1PEBA 1QUJA 4YKPA 4H45A 4LZ5A 2A5TB 4FEDA 4LONB 1MH3A 4R74A 4U1ZA 4JSOA 4KPTA 4XF5A 2GQ1A 2CZKA 1A8FA 3TTMA 1EYKA 1IMFA 3CSBA 5DVFA 1N7WA 3PPRA 4AQ4A 2XX7A 1K9YA 1MXXA 4I9DA 4OVPA 5IM2A 5AE4A 5TP9B 1MS7A 1URSA 3CG1A 4MCOA 1IQ7A 4OVQA 2O1MA 2F97A 2DWIA 1MPBA 2QVUA 2Q8JA 4OERA 4NE4A 4YB7A 2HXRA 3JV9A 1RYOA 2FIXA 3SETA 4XKNA 1B3LA 3RGYA 3MBPA 3THIA 4JBZA 3H6VA 1P1WA 4GFRA 1HSEA 4PDDA 1Q9DA 4QFPA 2OZZA 5CBRA 2KLFA 3B7DA 5I3SA 4O3CA 1OMPA 4TLLB 1L5TA 2VPOA 1A99A 3PUVE 4DE8A 2O51A 4YB6A 3PGFA 3RT6B 4F39A 4NQ8A 1RDZA 2XXTA 4F3SA 2I0CA 4QBAA 3LSFB 3O6GA 4OFOA 3UGWA 3KC0A 2XXPA 4P9KA 3FJ7A 4EXLA 1FRPA 5FHMA 4P47A 3UN6A 5EQ8A 3O2AA 3U65A 4GRKA 2H25A 3IO6A 4LUBA 4HTGA 4MX6A 4DIGA 2F7AA 4RA1A 4F1UA 3HHFA 2ONRA 3VLWA 5DYHA 2HPGA 2O69A 2Y7PA 4JVCA 4IO2A 2PX1A 3VXCA 5I57A 5EHMA 2CZHA 1VFEA 4GVOA 2ZYOA 5H8FB 3DLNA 1FBCA 4OHNA 1BP5A 1FPKA 1A40A 5FTIA 1N04A 1FPDA 1LCFA 1LFGA 1QUIA 3VE1B 4PAIA 1URDA 4NWCA 2VP1A 3HCQA 1I6AA 2O68A 2F7BA 1IMDA 1MH4A 3PMWA 3S4UA 2ZNUA 1FPLA 3KSXA 1FBDA 1NUYA 2OWTA 4QHQA 2M8CA 3EQ1A 4NF5B 2OWZA 1B3GA 5L9OA 4R75A 3N6UA 2H5YA 2RINA 4MLVA 3TQWA 1LFIA 3T1BA 3TZAA 1MY1A 3MVXA 4IO3A 5AA4B 3PV0E 3U1OA 4L17A 1FCKA 3W9VA 3OD7A 5K2XA 3A3CA 3OEKA 4LA9A 1J1NA 1US4A 4N6PA 3GLBA 4PAFA 3TAJA 4MNCA 4R9FA 2Q9TA 1NV6A 1IMAA 1JP4A 2I58A 1UTHA 3I5OA 1LB9A 4PFBA 3S2VA 3U92A 1TFAA 4F19A 1FBFA 1UQWA 4R9GA 4HE0A 3VXBA 1A7LA 2Y84A 3TQLA 2Y7WA 5JTYA 4MIJA 4XXUA 5DEXA 4P1LA 5AA1A 5CMBA 1B7UA 4NAPA 2F6GA 4KFQA 1FQBA 1CE2A 3BBRA 4MLQA 3WAEA 3V89B 4G68A 4H67A 1NV5A 1NV4A 1R1NA 2Q2AA 3V8XB 4P1EA 4OANA 1DSNA 3T0JA 3EKIA 1RDYA 3T22A 1D4NA 4DXUA 2F3DA 1MPDA 4ZE8A 1VSOA 5IZ1A 3B8BA 2B3FA 3KSJA 1Y3NA 2IA4A 4PE5B 4HCWA 4EUOA 4RPOA 2WX9A 3QMFA 2I3VA 2I49A 4AB6A 1N7XA 3LUYA 2XHDA 4KYSA 1JQFA 4YKIA 4AS4A 3TYHA 3EHSA 4TOZA 4RXLA 5M2VA 3RT8A 2OWSA 3U94A 3C34A 3HFUA 3QAXA 1TWYA 3FGSA 2XWIA 4PDHA 3H6UA 3VVEA 1O64A 1QJMA 3BIGA 2DVCA 3C31A 3LSLA 1SQYA 2DE3A 1S9TA 4R2BA 5LDZA 1N3WA 4LP2B 4DI4B 4DLDA 1IEJA 4QSDA 4ZZAA 3KN3A 3HPIA 4MMPA 1VE4A 3QXMA 4GL8A 3P7IA 3E78A 3TTRA 5KZTA 1IUDA 5DVJA 4NN3A 4R6HA 3E79A 3EN3A 5CMCA 1D9YA 4POXA 3K1PA 2NWJA 1EZOA 4Q0CA 2BJIA 3PPQA 5DVIA 5EHSA 3MSTA 3FXRA 1SI0A 2HAUA 3MW0A 3ZKKA 4ELQA 3UP9A 1LAHE 3QIMA 4R73A 3MVYA 5J16A 1YPNA 3CFZA 4NEDA 1H45A 5H8NA 2UVJA 1IXHA 1FPEA 2UYEA 1EH3A 1B05A 1IMEA 2YPNA 1PC3A 2QVRA 1P1NA 3HHGA 3ZS6A 4MBPA 4KYDA 5I57B 1MXZA 5IGAA 3G3GA 3KJTA 1INPA 4OXVA 3FASA 1I6QA 3DM0A 2FYIA 4NTLA 4I8CA 2CZLA 4OEVA 4JWOA 3TUSA 4UACA 5ET7A 3IJXB 4OQOA 5CI5A 2NUVA 2UVGA 3QSLA 2VPNA 4PFIA 3R6UA 3B6WA 3FVKA 4GWSA 4C1TA 4F2QA 2UXAA 1VR5A 4G68C 4GWYA 4P0GA 2F8DA 2ZZXA 1R6ZA 2DE4A 2V3QA 3SEYA 3PUXE 4IY6A 2F78A 5CRYA 2QMWA 4OEUA 3M3FA 1MDQA 3TODA 1NUZA 4H46A 1UTBA 4NF4A 5I84A 4PBHA 2OLBA 3Q29A 4I3YA 1MDP1 1IIWA 2ONSA 2GH9A 4PFWA 4HS7A 1N3XA 2QMXA 5IZ3A 2HXWA 3IX1A 4QSEA 3SEVA 4ELPA 3F11A 1UTHB 4ZECA 4YZZA 1GGGA 1IXGA 5ICTA 2DWAA 1SW2A 3UA8A 3T9UA 3CVGA 1JEVA 1B3FA 4X48A 1S7YA 1OLAA 4ZEKA 1B58A 5I56A 4N15A 1BK4A 3FATA 2FA7A 2H4IA 3RY3A 4JDFA 4JB7A 5DEXB 1YCJA 1DPEA 2ZYNA 4LZ7A 1IXCA 2ZYKA 3IB2A 5A5XA 4Q8RA 2XWOA 3KOSA 4U4XA 5FHNA 4I40A 4G68B 2W7YA 1MM6A 4X1DA 1TFDA 4PQJA 3DP6A 3TKDA 5EYFA 4JWYA 2RKMA 4QFKA 5ET8A 3H3GA 3TELA 4U23A 3G3JA 2P2AA 1IITA 1JEUA 4DDDA 4M1VA 1M5DA 3OSQA 2WBDA 3FJMA 1NH8A 4IO7A 4OFJA 4F18A 1LAGE 4XIGQ 3E13X 3IL1B 3IFAA 2NXOA 1B5IA 4HW8A 1NV7A 3E9XA 2H98A 3KOTA 3SERA 1NNPA 4MNIA 2CMOA 4R6KA 4MHFA 4MF3A 1FQDA 4AB5A 3B6QA 1SYHA 3H7MA 3K1MA 2PMSA 4X1BA 4Z0IA 2R8TA 2F3BA 3A09A 4H1XA 4OVTA 4DCXA 2F5XA 1POTA 2X7PA 3G7WA 4BDOA 3PU5A 2HCAA 4RJZA 3SDFA 1XT8A 1NI9A 1MY4A 3M3LA 4YMAA 1G0IA 4M4GA 1CNQA 4MNPA 2L5VA 5F24A 4H5GA 1B32A 4G8HA 3USDA 3KZGA 3T93B 3LC8A 1PDAA 1B1XA 1AL3A 2QPQA 4YKJA 4RPNA 4XKQA 1FTMA 4QF9A 2Q88A 2DOJA 3IO4A 3KGCA 4EF2A 3E4RA 2F35A 4ZE9A 4NHBA 1LBVA 3IB0A 4O8MA 3K2DA 3MQ9A 3FJGA 3QUFA 4YMBA 1MQIA 2P1SA 1P1UA 2VHAA 4PCDA 1BIYA 5TU0A 1GV8A 3IAZA 4TQUQ 3K0VA 2V4CA 4KHZE 3S9NC 3LSXA 1JVXA 1LEVA 3G3FA 2XD2A 4EQBA 4GIZA 2HZKA 3TCHA 1AMFA 5LTCA 5IKBA 4NWDA 1FQCA 4F1YA 3MVZA 2DDKA 4I62A 3CFLA 3RPLA 4OVRA 1SW5A 2I3WA 3D4CA 2HHMA 1FTOA 1Y3QA 5TPAA 4QRZA 4N91A 4ECFA 5AA2A 1UTBB 3MPLA 4NF4B 3V83A 3O28A 3MP6A 4BDMA 2THIA 5L9MA 4ZDMA 3OO7A 5I2KA 5IZ3B 1QULA 4HCYA 3RYDA 2O7IA 4P0IA 1FPJA 3EF7A 1Y4CA 3ONMA 3H4ZA 4QXDA 1US5A 4KXPA 1QW0A 2OX3A 3G3KA 5I56B 3MYUA 3OSRA 4XTCQ 5H8QA 3NOHA 4ELOA 4NF8A 2HEUA 5A5XB 3L6HA 2OCUA 3MZBA 3ZSFA 4NX1A 1KA1A 5BUUA 1NUWA 1TT1A 3S9MC 3T66A 4PC9A 5LOMA 2XWKA 1YZ0A 2HZLA 2B4MA 1Z7NE 2O1LA 2RCBA 3RNNA 4OETA 1HSLA 3O6HA 4I3EA 5IZZA 1D9VA 3A3UA 4OESA 5F1QA 5CMMA 4HE2A 4U22A 3T9XB 3KBRA 2X26A 4P3LA 3U8QA 3BFTA 5ITPA 2XXWA 2XXUA 3G3HA 2DWJA 3MJNA 1MXUA 1LBYA 4IGRA 3R26A 3EHUA 1WVJA 4DZ1A 2B65A 3TMGA 1RDXA 2WYKA 5KCJA 3EPEA 1LBXA 1USYH 3K01A 1EYJA 5ET5A 4N07A 1B46A 5HM4B 1NNKA 3RQTA 3TDJA 4JVIA 2E1SA 2XD3A 5CBSA 4G2ZA 1LLSA 2PT2A 3FBPA 3VFJA 5I5PA 5I2NA 3ZKLA 4WKMA 3HN0A 1FTJA 1AWBA 3O97A 3H06B 2CZIA 2Y5LA 1ZU0A 4O3BA 5H8HA 3OELA 2HFBA 4N13A 3T9VA 4BDQA 4G8NA 3O29A 3LSWA 4JWXA 4YAHX 3W15C 1ZKBA 4FE8A 2G29A 3C36A 2AYSA 3N6TA 3N94A 3QUJA 1B6HA 2F36A 3CIJA 5I7IA 1B5JA 1NV3A 4NF6A 5J1DA 3MC2A 2UYFA 3D1RA 3GBAA 4N8GA 1N0TA 1MG1A 4X8RA 1FW0A 1M5FA 2DP8A 1B5HA 3RLFE 3TFLA 1MY2A 2QJEA 1XVXA 1H76A 2XXHA 3IFCA 5B7DA 4GLIA 2O6AA 2QSXA 3OEMA 1YYZA 1H43A 3S9LC 3RPLB 2CEXA 4LATA 2ZXTA 5TPAB 1M5EA 5AA2B 1ZLQA 3CSGA 3C9HA 3MWBA 3N26A 1DCUA 3K4UA 1ANFA 3K00A 2FIEA 1MM7A 3FZVA 3UIFA 2ZNSA 3ILTB 4BDLA 5I2KB 3C33A 2I4CA 3B6TA 4XEQA 4X9TA 5FHOA 1ELJA 4DXBA 3I6VA 1H3DA 4IO4A 2XXYA 4QFOA 1LBBA 2IEEA 1Y20A 4KCDA 1NKXA 5DT6A 3GYYA 3TCGA 1NV1A 3FV2A 3FXUA 4F29A 4FORA 3A29A 5H8QB 1SW1A 1FBGA 4NF8B 1JW5A 5CC2A 2Q89A 4OTEA 1LFHA 4PP0A 4H0WA 3FVOA 2WEFA 2R9JA 4K3FA 1OQGA 2ONKE 4EDPA 3TTLA 3PMVA 1IXIA 2PCRA 3TPAA 1II5A 2RF1A 4GBVA 3OO6A 3KFMA 2MKZA 1R9LA 4F1VA 4Z7EA 1MQJA 1MRPA 3OENA 2GHAA 4FECA 2BJJX 3MP1A 1B3EA 5EYHA 4IO5A 4FBPA 1NL5A 4I1DA 1SYIA 1YAEA 1QKBA 3G3IA 1MXWA 1SPIA 3OO8A 3TTNA 1SI1A 2AIXA 4GX6A 4BLAA 1FQFA 1M5BA 4GWZA 4NG7A 1MQGA 1IMBA 4ELRA 4U1OA 1O63A 3U93A 2Z8DA 3UK4A 4GX4A 2ZYMA 4FIMA 4WEPA 4GX3A 1MPCA 1EZ9A 1B9JA 1RYXA 5KCJB 4PGPA 4OMBA 1KZ8A 4GWUA 4O7IA 4PE3A 2PT1A 3C32A 3MVWA 1FJ9A 2REGA 3CI8A 2Z8EA 5JTYB 1FJ6A 3VDFA 4MFIA 3ECRA 4R72A 2GHBA 1B7ZA 5I2NB 4OFLA 2PFZA 4H5FA 3E3KA 3PPPA 2P0SA 3GZGA 4POWA 4ZEDA 5F7VA 1K9ZA 3C35A 1OVTA 1UIUA 1EU8A 2KR0A 3IOUA 3O66A 3L6GA 2P3VA 3KN7A 4GWWA 3KC1A 4MEVA 5H8HB 4BDNA 2DXYA 4OWDA 2ANJA 2QFLA 5I58A 2P3NA 3IR1A 4U4SA 4E0XA 3TTKA 4NF5A 1JW1A 4ONYA 4F3GA 1NV2A 3BFUA 5EQ7A 1P99A 3IOTA 1Q35A 3VVDA 2WKYA 1VFDA 4DI3D 1FTKA 4NF6B 1DPPA 3U72A 1WODA 4GWOA 3MUQA 2PBWA 3K1NA 3OO9A 2Y5KA 1NH7A 3FD3A 3KBZA 1FSAA 3R7XA 3GBBA 4PFUA 1FTAA 2D21A 4H6DA 3Q25A 2F6PA 4ESWA 5A5LA 3IB1A 3CHGA 2DWHA 5K2YA 2FNCA 3SEWA 4ZEFA 4IGTA 2XA5A 3PPNA 5IAIA 3S9EA 4PTKA 4BDRA 4TLMB 1FPFA 3Q28A 4PFRA 4RNSA 4XKRA 1NMUA 2VT5A 3HSTA 2A5SA 1ZJLA 2B3BA 3ILUB 2PFYA 1Y1MA 1BKAA 5H8NB 3QYTA 5L9SA 1AIVA 2FVZA 2QS2A 4ZS9A 2E0SA 1D3KA 4JSDA 3DP8A 4ESXA 1OIBA 2PYYA 3TCFA 3FUZA 4N81A 2VGQA 1LBWA 2OBGA 4OZ9A 1DK4A 5JEIA 3FIRA 3OOAA 3FVNA 1AOVA 2NVUB 5ICQA 4YKKA 3M8UA 4G4PA 4H8IA 1CB6A 3ODBA 1G0HA 1XHYA 4OENA 3HV1A 1S50A 3PUWE 1BTJA 1QGXA 2DQVA 4MAGA 4YICA 3JYRA 2O7UA 5HBCA 4QSCA 2DSFA 3H6WA 1QUKA 1LAXA 4N17A 1DMBA 3RN8A 3SESA 4FJPA 3Q27A 4GXAA 1XOCA 4XKPA 5B70A 1PB7A 4PF6A 2FHYA 4WXJA 2QS3A 3MPKA 4RYAA 4P11A 2B4LA 1XI6A 1B7HA 4LZ8A 3PUZE 4LQ2A 5JK4A 3WAFA 2XX9A 1NFTA 3Q26A 1KA0A 2V3UA 2V84A 1FTLA 2QRYA 4F22A 3MZ9A 3JZJA 1LSTA 2Z22A 2Y7RA 4HE1A 4PFYA 1ZMGA 4OVSA 3HO7A 3BKIB 4H8JA 1DTZA 1T0KA 3H03A 1B1HA 5KDTA 5I59A 3ISPA 1B3HA 2RC7A 1NNTA 3RPWA 1B2HA 1DBZA 3LBSA 1B4ZA 4N8YA 2H99A 4GOTA 1N76A 3LV0A 4KYEA 1Y3PA 4KCCA 4N6DA 4EF1A 4ZEIA 2XXVA 1URGA 5EQ9A 2Z23A 4Q5TA 2DE2A 3FXQA 4O3AA 5FBPA 4F31B 5AA2D 1MXYA 1KWHA 5I58B 4O94A 2UVHA 4XFEA 2Y7KA 3K6WA 1B0LA 2I4BA 2LAOA 4IB2A 3UORA 1Z7ME 2O84X 2ESNA 1ZIUA 4THIA 4MJOA 5ISUA 3DP4A 1NV0A 2XXRA 1NUXA 1B0HA 1POY1 4P8BA 3T96B 4FAJA 2QS4A 2XXQA 4Q30B 3MZ1A 4RK9A 2V3TA 2H9BA 4KR5A 1HSJA 4ND9A 4LVQA 3QK6A 2CEYA 3SEXA 4G77A 4U21A 4WEDA 3FVGA 2PVUA 1LGBC 1SW4A 3FXBA 3K02A 3RTFB 3KN8A 3LR1A 4GF8A 3ROJA 1PB9A 3KG2A 5DTBA 1GTKA 2QL3A 1QKAA 5FTHA 1O7TA 1SVXB 3PD9A 1MXVA 1DOTA 1A8EA 4PF8A 2VD3A 2KQZA 4EQ9A 2ALUA 3PPOA 4PETA 3C4MA 2QS1A 3OMBA 2YJPA 2Y7IA 3K6VA 2Z8FA 2ZZVA 4NMYA 3SKPA 4ZEBA 1A54A 5CM6A 1ATGA 4GL0A 3T9HB 2AL4A 1P1QA 2ZMBA 4YB5A 1FBHA 2R6GE 3FV1A 3IOWA 1JNFA 1SBPA 4N4UA 2I0BA 2D5WA 4E0WA 4R2FA 3CFXA 4DCYA 3D4GA 4N6KA 4LQ5A 3DELB 3PUYE 1N84A 1R9QA 4X04A 3SZPA 1M5CA 2ZNTA 1XC1A 1GVCA 3IOVA 5T3JA 1GR2A 1ZTYA 1D9QA 2XXXA 1UIVA 4GWXA 1XVYA 3PD8A 3I3VA 1B51A 3PTYA 1P1OA
chains in the Genus database with same CATH topology
2D3IA 2OJTA 4MH5A 1SDXA 1I69A 4RK2A 1B52A 1DTGA 1XS5A 4EQ7A 5CMKA 2F34A 4RY1A 3AXFA 4OVJA 2YLNA 5ITOA 2A5TA 1MQDA 1EZPA 2DYXA 2DS9A 3CG3A 2RC9A 4KQPA 5HPQA 3RTWB 2HQ0A 1MQHA 3EHTA 3TEPA 3K6UA 2G93A 1PBPA 5TP9A 5KDTB 5I59B 5ELVA 2OK2A 2UVIA 4H65A 1MY0A 1B4HA 4F3BA 2REJA 4UA8A 1FQEA 3N5LA 1OVBA 2RC8A 1ZBMA 4QFNA 3CR9A 1OQHA 4F3PA 4GD5A 3VLVA 3RUMA 4EXKA 1IZ1A 1LBCA 3VV5A 5H8SA 4U2RA 3H6TA 4FATA 2VD2A 2AL5A 2I48A 3SEUA 2F7CA 3GXAA 1FQAA 1A55A 2DXRA 1QVSA 1USYE 1JW4A 3VVFA 4GXSB 2DVZA 3O6IA 2X7QA 1LB8A 4QFLA 4YU0A 1JVYA 4IY5A 4PFTA 5H8FA 3O9PA 3CRBA 3KEIA 2HAVA 1PB8A 1JETA 1TXFA 4DXCA 1NNFA 2Q2CA 3W9WA 4R6YA 1OLCA 1MY3A 4C1UA 5L8DA 2V93A 2R71A 4KI0E 1Y1ZA 1Q1KA 4ISUA 1Y4TA 4GQOA 4F2OA 5AA4A 3MAMA 1WDNA 1F9BA 3IK6B 1LAFE 1RKMA 4ZZEA 3K6XA 1BLFA 4OYVA 3IJOB 1I6BA 4JXIA 4FEBA 3MP8A 1AH5A 2V25A 4IO6A 2GRVA 1SD3A 2I6EA 5BWJA 3PMXA 4KD5A 2RCAA 1H44A 1B40A 3M3KA 1PBQA 2XXIA 5AA3A 2ABHA 2XX8A 1Y9UA 2VOZA 2GFEA 1YTVA 2NOOA 3V5AA 4G8MA 1LCTA 3KJ7A 3OXNA 3IORA 3VLUA 4C0RA 1PEBA 1QUJA 4YKPA 4LZ5A 2A5TB 4FEDA 4LONB 1MH3A 4R74A 4U1ZA 4JSOA 4KPTA 1A8FA 3TTMA 3CSBA 5DVFA 1N7WA 3PPRA 4AQ4A 2XX7A 1MXXA 4I9DA 5AE4A 5TP9B 1MS7A 1URSA 3CG1A 1IQ7A 2O1MA 2F97A 2DWIA 1MPBA 2Q8JA 4OERA 4NE4A 4YB7A 3JV9A 1RYOA 3SETA 4XKNA 1B3LA 3RGYA 3MBPA 3THIA 4JBZA 3H6VA 1P1WA 4GFRA 1HSEA 4QFPA 2OZZA 5CBRA 2KLFA 3B7DA 4O3CA 1OMPA 4TLLB 1L5TA 1A99A 3PUVE 4DE8A 2O51A 4YB6A 3PGFA 3RT6B 4F39A 2XXTA 4F3SA 2I0CA 3LSFB 3O6GA 4OFOA 3UGWA 2XXPA 3FJ7A 4EXLA 5FHMA 3UN6A 3O2AA 4GRKA 2H25A 3IO6A 4LUBA 4HTGA 4DIGA 2F7AA 4RA1A 4F1UA 3HHFA 2ONRA 3VLWA 5DYHA 2Y7PA 2O69A 4IO2A 2PX1A 3VXCA 5I57A 5EHMA 1VFEA 4GVOA 2ZYOA 5H8FB 3DLNA 4OHNA 1BP5A 1A40A 5FTIA 1N04A 1LCFA 1LFGA 1QUIA 3VE1B 1URDA 4NWCA 2VP1A 3HCQA 1I6AA 2O68A 2F7BA 1MH4A 3PMWA 3S4UA 2ZNUA 3KSXA 2OWTA 4QHQA 2M8CA 3EQ1A 4NF5B 1B3GA 5L9OA 4R75A 3N6UA 2H5YA 2RINA 4MLVA 3TQWA 1LFIA 3TZAA 1MY1A 3MVXA 4IO3A 5AA4B 3PV0E 3U1OA 4L17A 1FCKA 3W9VA 3OD7A 5K2XA 3A3CA 3OEKA 4LA9A 1J1NA 1US4A 4N6PA 3GLBA 3TAJA 4R9FA 2Q9TA 2I58A 1UTHA 3I5OA 1LB9A 3S2VA 3U92A 1TFAA 4F19A 1UQWA 4R9GA 3VXBA 1A7LA 2Y84A 3TQLA 2Y7WA 5JTYA 4XXUA 5DEXA 5AA1A 5CMBA 1B7UA 2F6GA 4KFQA 1FQBA 1CE2A 3BBRA 4MLQA 3WAEA 3V89B 4G68A 4H67A 1R1NA 2Q2AA 3V8XB 1DSNA 3T22A 1D4NA 4DXUA 1MPDA 4ZE8A 1VSOA 2B3FA 3KSJA 1Y3NA 2IA4A 4PE5B 4HCWA 4EUOA 4RPOA 2I3VA 2I49A 4AB6A 1N7XA 3LUYA 2XHDA 4KYSA 1JQFA 4YKIA 3TYHA 3EHSA 4TOZA 4RXLA 5M2VA 3RT8A 2OWSA 3U94A 3C34A 3QAXA 1TWYA 3FGSA 3H6UA 3VVEA 1O64A 1QJMA 2DVCA 3C31A 3LSLA 1SQYA 2DE3A 1S9TA 4R2BA 1N3WA 4LP2B 4DLDA 1IEJA 4QSDA 4ZZAA 3KN3A 3HPIA 1VE4A 3QXMA 4GL8A 3P7IA 3TTRA 5KZTA 1IUDA 5DVJA 4R6HA 3EN3A 5CMCA 1D9YA 4POXA 3K1PA 2NWJA 1EZOA 4Q0CA 3PPQA 5DVIA 5EHSA 3FXRA 1SI0A 2HAUA 3MW0A 3ZKKA 4ELQA 3UP9A 1LAHE 3QIMA 4R73A 3MVYA 1YPNA 3CFZA 4NEDA 1H45A 5H8NA 2UVJA 1IXHA 2UYEA 1EH3A 1B05A 2YPNA 1PC3A 1P1NA 3HHGA 3ZS6A 4MBPA 4KYDA 5I57B 1MXZA 3G3GA 3KJTA 4OXVA 3FASA 1I6QA 3DM0A 2FYIA 4NTLA 4I8CA 2CZLA 4OEVA 4JWOA 3TUSA 4UACA 3IJXB 4OQOA 5CI5A 2NUVA 2UVGA 3QSLA 3R6UA 3B6WA 3FVKA 4C1TA 4F2QA 2UXAA 1VR5A 4G68C 4P0GA 2F8DA 1R6ZA 2DE4A 2V3QA 3SEYA 3PUXE 4IY6A 2F78A 5CRYA 2QMWA 4OEUA 3M3FA 1MDQA 3TODA 1UTBA 4NF4A 5I84A 2OLBA 3Q29A 1MDP1 1IIWA 2ONSA 2GH9A 4PFWA 4HS7A 1N3XA 2QMXA 2HXWA 3IX1A 4QSEA 4ELPA 3SEVA 3F11A 1UTHB 4ZECA 4YZZA 1GGGA 1IXGA 5ICTA 2DWAA 1SW2A 3UA8A 3T9UA 3CVGA 1JEVA 1B3FA 4X48A 1S7YA 1OLAA 4ZEKA 1B58A 5I56A 3FATA 2FA7A 2H4IA 3RY3A 4JDFA 4JB7A 5DEXB 1YCJA 1DPEA 2ZYNA 4LZ7A 1IXCA 2ZYKA 5A5XA 3IB2A 4Q8RA 3KOSA 4U4XA 5FHNA 4G68B 2W7YA 1MM6A 4X1DA 1TFDA 4PQJA 3DP6A 3TKDA 5EYFA 4JWYA 2RKMA 4QFKA 3H3GA 3TELA 4U23A 3G3JA 2P2AA 1IITA 1JEUA 4DDDA 4M1VA 1M5DA 3OSQA 3FJMA 1NH8A 4IO7A 4OFJA 4F18A 1LAGE 4XIGQ 3E13X 3IL1B 2NXOA 1B5IA 4HW8A 3E9XA 2H98A 3KOTA 3SERA 1NNPA 2CMOA 4R6KA 4MF3A 1FQDA 4AB5A 3B6QA 1SYHA 3H7MA 3K1MA 2PMSA 4X1BA 4Z0IA 3A09A 4H1XA 4DCXA 2F5XA 1POTA 2X7PA 3G7WA 4BDOA 3PU5A 2HCAA 4RJZA 3SDFA 1XT8A 1MY4A 3M3LA 4YMAA 4M4GA 4H5GA 1B32A 4G8HA 3USDA 3KZGA 3T93B 3LC8A 1PDAA 1B1XA 1AL3A 2QPQA 4YKJA 4RPNA 4XKQA 1FTMA 4QF9A 2Q88A 2DOJA 3IO4A 3KGCA 4EF2A 3E4RA 2F35A 4ZE9A 3IB0A 3K2DA 3MQ9A 3FJGA 3QUFA 4YMBA 1MQIA 2P1SA 1P1UA 2VHAA 1BIYA 5TU0A 1GV8A 3IAZA 4TQUQ 3K0VA 4KHZE 3S9NC 3LSXA 1JVXA 3G3FA 2XD2A 4EQBA 4GIZA 2HZKA 3TCHA 1AMFA 5IKBA 4NWDA 1FQCA 4F1YA 3MVZA 4I62A 3CFLA 1SW5A 2I3WA 3D4CA 1FTOA 1Y3QA 5TPAA 4QRZA 4ECFA 5AA2A 1UTBB 3MPLA 4NF4B 3V83A 3O28A 3MP6A 4BDMA 2THIA 5L9MA 4ZDMA 3OO7A 5I2KA 1QULA 4HCYA 2O7IA 4P0IA 3EF7A 1Y4CA 3ONMA 3H4ZA 1US5A 1QW0A 3G3KA 5I56B 3OSRA 4XTCQ 5H8QA 4ELOA 4NF8A 2HEUA 5A5XB 3L6HA 2OCUA 3MZBA 3ZSFA 5BUUA 1TT1A 3S9MC 3T66A 5LOMA 2HZLA 1Z7NE 2O1LA 2RCBA 3RNNA 4OETA 1HSLA 3O6HA 1D9VA 3A3UA 4OESA 5F1QA 5CMMA 4U22A 3T9XB 3KBRA 2X26A 3U8QA 3BFTA 5ITPA 2XXWA 2XXUA 3G3HA 2DWJA 3MJNA 1MXUA 4IGRA 3R26A 3EHUA 1WVJA 4DZ1A 2B65A 3TMGA 5KCJA 3EPEA 1USYH 3K01A 4N07A 1B46A 5HM4B 1NNKA 3RQTA 3TDJA 2E1SA 2XD3A 5CBSA 4G2ZA 1LLSA 2PT2A 3VFJA 5I2NA 3ZKLA 4WKMA 3HN0A 1FTJA 3O97A 3H06B 1ZU0A 4O3BA 5H8HA 3OELA 2HFBA 4N13A 3T9VA 4BDQA 4G8NA 3O29A 3LSWA 4YAHX 4JWXA 3W15C 1ZKBA 4FE8A 2G29A 3C36A 2AYSA 3N6TA 3N94A 3QUJA 1B6HA 2F36A 3CIJA 1B5JA 4NF6A 5J1DA 3MC2A 2UYFA 3GBAA 1N0TA 1MG1A 1FW0A 1M5FA 2DP8A 1B5HA 3RLFE 3TFLA 1MY2A 2QJEA 1XVXA 1H76A 2XXHA 5B7DA 4GLIA 2O6AA 2QSXA 3OEMA 1H43A 3S9LC 4LATA 2ZXTA 5TPAB 1M5EA 5AA2B 1ZLQA 3CSGA 3C9HA 3MWBA 3N26A 3K4UA 1ANFA 3K00A 1MM7A 3FZVA 3UIFA 2ZNSA 3ILTB 4BDLA 5I2KB 3C33A 2I4CA 3B6TA 4X9TA 5FHOA 1ELJA 4DXBA 3I6VA 1H3DA 4IO4A 2XXYA 4QFOA 1LBBA 2IEEA 1Y20A 4KCDA 1NKXA 5DT6A 3TCGA 3FV2A 3FXUA 4F29A 4FORA 5H8QB 1SW1A 4NF8B 1JW5A 5CC2A 2Q89A 4OTEA 1LFHA 4PP0A 4H0WA 3FVOA 2R9JA 4K3FA 1OQGA 2ONKE 4EDPA 3TTLA 3PMVA 1IXIA 3TPAA 1II5A 2RF1A 3OO6A 3KFMA 1R9LA 4F1VA 4Z7EA 1MQJA 1MRPA 3OENA 2GHAA 4FECA 2BJJX 3MP1A 1B3EA 4IO5A 1NL5A 4I1DA 1SYIA 1YAEA 1QKBA 3G3IA 1MXWA 3OO8A 3TTNA 1SI1A 2AIXA 4BLAA 1FQFA 1M5BA 1MQGA 4ELRA 4U1OA 1O63A 3U93A 2Z8DA 3UK4A 2ZYMA 4FIMA 4WEPA 1MPCA 1EZ9A 1B9JA 1RYXA 5KCJB 4OMBA 2PT1A 3C32A 3MVWA 2REGA 3CI8A 2Z8EA 5JTYB 3VDFA 4MFIA 3ECRA 4R72A 2GHBA 1B7ZA 5I2NB 4OFLA 4H5FA 3E3KA 3PPPA 2P0SA 3GZGA 4POWA 4ZEDA 5F7VA 3C35A 1OVTA 1UIUA 1EU8A 3IOUA 3O66A 3L6GA 3KN7A 5H8HB 4BDNA 2DXYA 4OWDA 2ANJA 5I58A 3IR1A 4U4SA 4E0XA 3TTKA 4NF5A 1JW1A 4ONYA 4F3GA 3BFUA 1P99A 3IOTA 1Q35A 3VVDA 2WKYA 1VFDA 1FTKA 4NF6B 1DPPA 3U72A 1WODA 4GWOA 3MUQA 2PBWA 3K1NA 3OO9A 1NH7A 3FD3A 3R7XA 3GBBA 4PFUA 2D21A 4H6DA 3Q25A 2F6PA 4ESWA 3IB1A 2DWHA 5K2YA 2FNCA 3SEWA 4ZEFA 4IGTA 3PPNA 5IAIA 3S9EA 4BDRA 4TLMB 3Q28A 4RNSA 4XKRA 1NMUA 3HSTA 2A5SA 1ZJLA 2B3BA 3ILUB 1Y1MA 1BKAA 5H8NB 3QYTA 5L9SA 1AIVA 2QS2A 4ZS9A 2E0SA 1D3KA 4JSDA 3DP8A 4ESXA 1OIBA 2PYYA 3TCFA 3FUZA 2VGQA 2OBGA 4OZ9A 5JEIA 3FIRA 3OOAA 3FVNA 1AOVA 2NVUB 5ICQA 4YKKA 3M8UA 4G4PA 4H8IA 1CB6A 3ODBA 1XHYA 4OENA 3HV1A 1S50A 3PUWE 1BTJA 2DQVA 4YICA 3JYRA 2O7UA 5HBCA 4QSCA 2DSFA 3H6WA 1QUKA 1LAXA 1DMBA 3RN8A 3SESA 4FJPA 3Q27A 4GXAA 1XOCA 4XKPA 5B70A 1PB7A 4WXJA 2QS3A 3MPKA 4RYAA 4P11A 1B7HA 4LZ8A 3PUZE 4LQ2A 5JK4A 3WAFA 2XX9A 1NFTA 3Q26A 2V3UA 2V84A 1FTLA 2QRYA 4F22A 3MZ9A 3JZJA 1LSTA 2Z22A 2Y7RA 4PFYA 1ZMGA 3HO7A 3BKIB 4H8JA 1DTZA 1T0KA 3H03A 1B1HA 5KDTA 5I59A 1B3HA 2RC7A 1NNTA 3RPWA 1B2HA 3LBSA 1B4ZA 2H99A 4GOTA 1N76A 4KYEA 1Y3PA 4KCCA 4EF1A 4ZEIA 2XXVA 1URGA 2Z23A 4Q5TA 2DE2A 3FXQA 4O3AA 4F31B 5AA2D 1MXYA 1KWHA 5I58B 2UVHA 2Y7KA 3K6WA 1B0LA 2I4BA 2LAOA 4IB2A 3UORA 1Z7ME 2O84X 2ESNA 1ZIUA 4THIA 5ISUA 3DP4A 2XXRA 1B0HA 1POY1 3T96B 4FAJA 2QS4A 2XXQA 4Q30B 3MZ1A 4RK9A 2V3TA 2H9BA 4KR5A 1HSJA 4ND9A 4LVQA 3QK6A 3SEXA 4G77A 4U21A 4WEDA 3FVGA 2PVUA 1LGBC 1SW4A 3K02A 3RTFB 3KN8A 3LR1A 4GF8A 1PB9A 3KG2A 5DTBA 1GTKA 2QL3A 1QKAA 5FTHA 1O7TA 1SVXB 3PD9A 1MXVA 1DOTA 1A8EA 2VD3A 4EQ9A 2ALUA 3PPOA 4PETA 3C4MA 2QS1A 3OMBA 2YJPA 2Y7IA 3K6VA 2Z8FA 4NMYA 3SKPA 4ZEBA 1A54A 5CM6A 1ATGA 4GL0A 3T9HB 2AL4A 1P1QA 2ZMBA 4YB5A 2R6GE 3FV1A 3IOWA 1JNFA 1SBPA 2I0BA 2D5WA 4E0WA 3CFXA 4R2FA 4DCYA 3D4GA 4LQ5A 3DELB 3PUYE 1N84A 1R9QA 1M5CA 2ZNTA 1XC1A 1GVCA 3IOVA 1GR2A 1ZTYA 2XXXA 1UIVA 1XVYA 3PD8A 3I3VA 1B51A 1P1OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D3I A;  2OJT A;  4MH5 A;  1SDX A;  1I69 A;  4RK2 A;  1B52 A;  1DTG A;  1XS5 A;  4EQ7 A;  5CMK A;  2F34 A;  4RY1 A;  3AXF A;  4OVJ A;  2YLN A;  5ITO A;  2A5T A;  1MQD A;  1EZP A;  2DYX A;  2DS9 A;  3CG3 A;  2RC9 A;  4KQP A;  5HPQ A;  3RTW B;  2HQ0 A;  1MQH A;  3EHT A;  3TEP A;  3K6U A;  2G93 A;  1PBP A;  5TP9 A;  5KDT B;  5I59 B;  5ELV A;  2OK2 A;  2UVI A;  4H65 A;  1MY0 A;  1B4H A;  4F3B A;  2REJ A;  4UA8 A;  1FQE A;  3N5L A;  1OVB A;  2RC8 A;  1ZBM A;  4QFN A;  3CR9 A;  1OQH A;  4F3P A;  4GD5 A;  3VLV A;  3RUM A;  4EXK A;  1IZ1 A;  1LBC A;  3VV5 A;  5H8S A;  4U2R A;  3H6T A;  4FAT A;  2VD2 A;  2AL5 A;  2I48 A;  3SEU A;  2F7C A;  3GXA A;  1FQA A;  1A55 A;  2DXR A;  1QVS A;  1USY E;  1JW4 A;  3VVF A;  4GXS B;  2DVZ A;  3O6I A;  2X7Q A;  1LB8 A;  4QFL A;  4YU0 A;  1JVY A;  4IY5 A;  4PFT A;  5H8F A;  3O9P A;  3CRB A;  3KEI A;  2HAV A;  1PB8 A;  1JET A;  1TXF A;  4DXC A;  1NNF A;  2Q2C A;  3W9W A;  4R6Y A;  1OLC A;  1MY3 A;  4C1U A;  5L8D A;  2V93 A;  2R71 A;  4KI0 E;  1Y1Z A;  1Q1K A;  4ISU A;  1Y4T A;  4GQO A;  4F2O A;  5AA4 A;  3MAM A;  1WDN A;  1F9B A;  3IK6 B;  1LAF E;  1RKM A;  4ZZE A;  3K6X A;  1BLF A;  4OYV A;  3IJO B;  1I6B A;  4JXI A;  4FEB A;  3MP8 A;  1AH5 A;  2V25 A;  4IO6 A;  2GRV A;  1SD3 A;  2I6E A;  5BWJ A;  3PMX A;  4KD5 A;  2RCA A;  1H44 A;  1B40 A;  3M3K A;  1PBQ A;  2XXI A;  5AA3 A;  2ABH A;  2XX8 A;  1Y9U A;  2VOZ A;  2GFE A;  1YTV A;  2NOO A;  3V5A A;  4G8M A;  1LCT A;  3KJ7 A;  3OXN A;  3IOR A;  3VLU A;  4C0R A;  1PEB A;  1QUJ A;  4YKP A;  4LZ5 A;  2A5T B;  4FED A;  4LON B;  1MH3 A;  4R74 A;  4U1Z A;  4JSO A;  4KPT A;  1A8F A;  3TTM A;  3CSB A;  5DVF A;  1N7W A;  3PPR A;  4AQ4 A;  2XX7 A;  1MXX A;  4I9D A;  5AE4 A;  5TP9 B;  1MS7 A;  1URS A;  3CG1 A;  1IQ7 A;  2O1M A;  2F97 A;  2DWI A;  1MPB A;  2Q8J A;  4OER A;  4NE4 A;  4YB7 A;  3JV9 A;  1RYO A;  3SET A;  4XKN A;  1B3L A;  3RGY A;  3MBP A;  3THI A;  4JBZ A;  3H6V A;  1P1W A;  4GFR A;  1HSE A;  4QFP A;  2OZZ A;  5CBR A;  2KLF A;  3B7D A;  4O3C A;  1OMP A;  4TLL B;  1L5T A;  1A99 A;  3PUV E;  4DE8 A;  2O51 A;  4YB6 A;  3PGF A;  3RT6 B;  4F39 A;  2XXT A;  4F3S A;  2I0C A;  3LSF B;  3O6G A;  4OFO A;  3UGW A;  2XXP A;  3FJ7 A;  4EXL A;  5FHM A;  3UN6 A;  3O2A A;  4GRK A;  2H25 A;  3IO6 A;  4LUB A;  4HTG A;  4DIG A;  2F7A A;  4RA1 A;  4F1U A;  3HHF A;  2ONR A;  3VLW A;  5DYH A;  2Y7P A;  2O69 A;  4IO2 A;  2PX1 A;  3VXC A;  5I57 A;  5EHM A;  1VFE A;  4GVO A;  2ZYO A;  5H8F B;  3DLN A;  4OHN A;  1BP5 A;  1A40 A;  5FTI A;  1N04 A;  1LCF A;  1LFG A;  1QUI A;  3VE1 B;  1URD A;  4NWC A;  2VP1 A;  3HCQ A;  1I6A A;  2O68 A;  2F7B A;  1MH4 A;  3PMW A;  3S4U A;  2ZNU A;  3KSX A;  2OWT A;  4QHQ A;  2M8C A;  3EQ1 A;  4NF5 B;  1B3G A;  5L9O A;  4R75 A;  3N6U A;  2H5Y A;  2RIN A;  4MLV A;  3TQW A;  1LFI A;  3TZA A;  1MY1 A;  3MVX A;  4IO3 A;  5AA4 B;  3PV0 E;  3U1O A;  4L17 A;  1FCK A;  3W9V A;  3OD7 A;  5K2X A;  3A3C A;  3OEK A;  4LA9 A;  1J1N A;  1US4 A;  4N6P A;  3GLB A;  3TAJ A;  4R9F A;  2Q9T A;  2I58 A;  1UTH A;  3I5O A;  1LB9 A;  3S2V A;  3U92 A;  1TFA A;  4F19 A;  1UQW A;  4R9G A;  3VXB A;  1A7L A;  2Y84 A;  3TQL A;  2Y7W A;  5JTY A;  4XXU A;  5DEX A;  5AA1 A;  5CMB A;  1B7U A;  2F6G A;  4KFQ A;  1FQB A;  1CE2 A;  3BBR A;  4MLQ A;  3WAE A;  3V89 B;  4G68 A;  4H67 A;  1R1N A;  2Q2A A;  3V8X B;  1DSN A;  3T22 A;  1D4N A;  4DXU A;  1MPD A;  4ZE8 A;  1VSO A;  2B3F A;  3KSJ A;  1Y3N A;  2IA4 A;  4PE5 B;  4HCW A;  4EUO A;  4RPO A;  2I3V A;  2I49 A;  4AB6 A;  1N7X A;  3LUY A;  2XHD A;  4KYS A;  1JQF A;  4YKI A;  3TYH A;  3EHS A;  4TOZ A;  4RXL A;  5M2V A;  3RT8 A;  2OWS A;  3U94 A;  3C34 A;  3QAX A;  1TWY A;  3FGS A;  3H6U A;  3VVE A;  1O64 A;  1QJM A;  2DVC A;  3C31 A;  3LSL A;  1SQY A;  2DE3 A;  1S9T A;  4R2B A;  1N3W A;  4LP2 B;  4DLD A;  1IEJ A;  4QSD A;  4ZZA A;  3KN3 A;  3HPI A;  1VE4 A;  3QXM A;  4GL8 A;  3P7I A;  3TTR A;  5KZT A;  1IUD A;  5DVJ A;  4R6H A;  3EN3 A;  5CMC A;  1D9Y A;  4POX A;  3K1P A;  2NWJ A;  1EZO A;  4Q0C A;  3PPQ A;  5DVI A;  5EHS A;  3FXR A;  1SI0 A;  2HAU A;  3MW0 A;  3ZKK A;  4ELQ A;  3UP9 A;  1LAH E;  3QIM A;  4R73 A;  3MVY A;  1YPN A;  3CFZ A;  4NED A;  1H45 A;  5H8N A;  2UVJ A;  1IXH A;  2UYE A;  1EH3 A;  1B05 A;  2YPN A;  1PC3 A;  1P1N A;  3HHG A;  3ZS6 A;  4MBP A;  4KYD A;  5I57 B;  1MXZ A;  3G3G A;  3KJT A;  4OXV A;  3FAS A;  1I6Q A;  3DM0 A;  2FYI A;  4NTL A;  4I8C A;  2CZL A;  4OEV A;  4JWO A;  3TUS A;  4UAC A;  3IJX B;  4OQO A;  5CI5 A;  2NUV A;  2UVG A;  3QSL A;  3R6U A;  3B6W A;  3FVK A;  4C1T A;  4F2Q A;  2UXA A;  1VR5 A;  4G68 C;  4P0G A;  2F8D A;  1R6Z A;  2DE4 A;  2V3Q A;  3SEY A;  3PUX E;  4IY6 A;  2F78 A;  5CRY A;  2QMW A;  4OEU A;  3M3F A;  1MDQ A;  3TOD A;  1UTB A;  4NF4 A;  5I84 A;  2OLB A;  3Q29 A;  1MDP 1;  1IIW A;  2ONS A;  2GH9 A;  4PFW A;  4HS7 A;  1N3X A;  2QMX A;  2HXW A;  3IX1 A;  4QSE A;  4ELP A;  3SEV A;  3F11 A;  1UTH B;  4ZEC A;  4YZZ A;  1GGG A;  1IXG A;  5ICT A;  2DWA A;  1SW2 A;  3UA8 A;  3T9U A;  3CVG A;  1JEV A;  1B3F A;  4X48 A;  1S7Y A;  1OLA A;  4ZEK A;  1B58 A;  5I56 A;  3FAT A;  2FA7 A;  2H4I A;  3RY3 A;  4JDF A;  4JB7 A;  5DEX B;  1YCJ A;  1DPE A;  2ZYN A;  4LZ7 A;  1IXC A;  2ZYK A;  5A5X A;  3IB2 A;  4Q8R A;  3KOS A;  4U4X A;  5FHN A;  4G68 B;  2W7Y A;  1MM6 A;  4X1D A;  1TFD A;  4PQJ A;  3DP6 A;  3TKD A;  5EYF A;  4JWY A;  2RKM A;  4QFK A;  3H3G A;  3TEL A;  4U23 A;  3G3J A;  2P2A A;  1IIT A;  1JEU A;  4DDD A;  4M1V A;  1M5D A;  3OSQ A;  3FJM A;  1NH8 A;  4IO7 A;  4OFJ A;  4F18 A;  1LAG E;  4XIG Q;  3E13 X;  3IL1 B;  2NXO A;  1B5I A;  4HW8 A;  3E9X A;  2H98 A;  3KOT A;  3SER A;  1NNP A;  2CMO A;  4R6K A;  4MF3 A;  1FQD A;  4AB5 A;  3B6Q A;  1SYH A;  3H7M A;  3K1M A;  2PMS A;  4X1B A;  4Z0I A;  3A09 A;  4H1X A;  4DCX A;  2F5X A;  1POT A;  2X7P A;  3G7W A;  4BDO A;  3PU5 A;  2HCA A;  4RJZ A;  3SDF A;  1XT8 A;  1MY4 A;  3M3L A;  4YMA A;  4M4G A;  4H5G A;  1B32 A;  4G8H A;  3USD A;  3KZG A;  3T93 B;  3LC8 A;  1PDA A;  1B1X A;  1AL3 A;  2QPQ A;  4YKJ A;  4RPN A;  4XKQ A;  1FTM A;  4QF9 A;  2Q88 A;  2DOJ A;  3IO4 A;  3KGC A;  4EF2 A;  3E4R A;  2F35 A;  4ZE9 A;  3IB0 A;  3K2D A;  3MQ9 A;  3FJG A;  3QUF A;  4YMB A;  1MQI A;  2P1S A;  1P1U A;  2VHA A;  1BIY A;  5TU0 A;  1GV8 A;  3IAZ A;  4TQU Q;  3K0V A;  4KHZ E;  3S9N C;  3LSX A;  1JVX A;  3G3F A;  2XD2 A;  4EQB A;  4GIZ A;  2HZK A;  3TCH A;  1AMF A;  5IKB A;  4NWD A;  1FQC A;  4F1Y A;  3MVZ A;  4I62 A;  3CFL A;  1SW5 A;  2I3W A;  3D4C A;  1FTO A;  1Y3Q A;  5TPA A;  4QRZ A;  4ECF A;  5AA2 A;  1UTB B;  3MPL A;  4NF4 B;  3V83 A;  3O28 A;  3MP6 A;  4BDM A;  2THI A;  5L9M A;  4ZDM A;  3OO7 A;  5I2K A;  1QUL A;  4HCY A;  2O7I A;  4P0I A;  3EF7 A;  1Y4C A;  3ONM A;  3H4Z A;  1US5 A;  1QW0 A;  3G3K A;  5I56 B;  3OSR A;  4XTC Q;  5H8Q A;  4ELO A;  4NF8 A;  2HEU A;  5A5X B;  3L6H A;  2OCU A;  3MZB A;  3ZSF A;  5BUU A;  1TT1 A;  3S9M C;  3T66 A;  5LOM A;  2HZL A;  1Z7N E;  2O1L A;  2RCB A;  3RNN A;  4OET A;  1HSL A;  3O6H A;  1D9V A;  3A3U A;  4OES A;  5F1Q A;  5CMM A;  4U22 A;  3T9X B;  3KBR A;  2X26 A;  3U8Q A;  3BFT A;  5ITP A;  2XXW A;  2XXU A;  3G3H A;  2DWJ A;  3MJN A;  1MXU A;  4IGR A;  3R26 A;  3EHU A;  1WVJ A;  4DZ1 A;  2B65 A;  3TMG A;  5KCJ A;  3EPE A;  1USY H;  3K01 A;  4N07 A;  1B46 A;  5HM4 B;  1NNK A;  3RQT A;  3TDJ A;  2E1S A;  2XD3 A;  5CBS A;  4G2Z A;  1LLS A;  2PT2 A;  3VFJ A;  5I2N A;  3ZKL A;  4WKM A;  3HN0 A;  1FTJ A;  3O97 A;  3H06 B;  1ZU0 A;  4O3B A;  5H8H A;  3OEL A;  2HFB A;  4N13 A;  3T9V A;  4BDQ A;  4G8N A;  3O29 A;  3LSW A;  4YAH X;  4JWX A;  3W15 C;  1ZKB A;  4FE8 A;  2G29 A;  3C36 A;  2AYS A;  3N6T A;  3N94 A;  3QUJ A;  1B6H A;  2F36 A;  3CIJ A;  1B5J A;  4NF6 A;  5J1D A;  3MC2 A;  2UYF A;  3GBA A;  1N0T A;  1MG1 A;  1FW0 A;  1M5F A;  2DP8 A;  1B5H A;  3RLF E;  3TFL A;  1MY2 A;  2QJE A;  1XVX A;  1H76 A;  2XXH A;  5B7D A;  4GLI A;  2O6A A;  2QSX A;  3OEM A;  1H43 A;  3S9L C;  4LAT A;  2ZXT A;  5TPA B;  1M5E A;  5AA2 B;  1ZLQ A;  3CSG A;  3C9H A;  3MWB A;  3N26 A;  3K4U A;  1ANF A;  3K00 A;  1MM7 A;  3FZV A;  3UIF A;  2ZNS A;  3ILT B;  4BDL A;  5I2K B;  3C33 A;  2I4C A;  3B6T A;  4X9T A;  5FHO A;  1ELJ A;  4DXB A;  3I6V A;  1H3D A;  4IO4 A;  2XXY A;  4QFO A;  1LBB A;  2IEE A;  1Y20 A;  4KCD A;  1NKX A;  5DT6 A;  3TCG A;  3FV2 A;  3FXU A;  4F29 A;  4FOR A;  5H8Q B;  1SW1 A;  4NF8 B;  1JW5 A;  5CC2 A;  2Q89 A;  4OTE A;  1LFH A;  4PP0 A;  4H0W A;  3FVO A;  2R9J A;  4K3F A;  1OQG A;  2ONK E;  4EDP A;  3TTL A;  3PMV A;  1IXI A;  3TPA A;  1II5 A;  2RF1 A;  3OO6 A;  3KFM A;  1R9L A;  4F1V A;  4Z7E A;  1MQJ A;  1MRP A;  3OEN A;  2GHA A;  4FEC A;  2BJJ X;  3MP1 A;  1B3E A;  4IO5 A;  1NL5 A;  4I1D A;  1SYI A;  1YAE A;  1QKB A;  3G3I A;  1MXW A;  3OO8 A;  3TTN A;  1SI1 A;  2AIX A;  4BLA A;  1FQF A;  1M5B A;  1MQG A;  4ELR A;  4U1O A;  1O63 A;  3U93 A;  2Z8D A;  3UK4 A;  2ZYM A;  4FIM A;  4WEP A;  1MPC A;  1EZ9 A;  1B9J A;  1RYX A;  5KCJ B;  4OMB A;  2PT1 A;  3C32 A;  3MVW A;  2REG A;  3CI8 A;  2Z8E A;  5JTY B;  3VDF A;  4MFI A;  3ECR A;  4R72 A;  2GHB A;  1B7Z A;  5I2N B;  4OFL A;  4H5F A;  3E3K A;  3PPP A;  2P0S A;  3GZG A;  4POW A;  4ZED A;  5F7V A;  3C35 A;  1OVT A;  1UIU A;  1EU8 A;  3IOU A;  3O66 A;  3L6G A;  3KN7 A;  5H8H B;  4BDN A;  2DXY A;  4OWD A;  2ANJ A;  5I58 A;  3IR1 A;  4U4S A;  4E0X A;  3TTK A;  4NF5 A;  1JW1 A;  4ONY A;  4F3G A;  3BFU A;  1P99 A;  3IOT A;  1Q35 A;  3VVD A;  2WKY A;  1VFD A;  1FTK A;  4NF6 B;  1DPP A;  3U72 A;  1WOD A;  4GWO A;  3MUQ A;  2PBW A;  3K1N A;  3OO9 A;  1NH7 A;  3FD3 A;  3R7X A;  3GBB A;  4PFU A;  2D21 A;  4H6D A;  3Q25 A;  2F6P A;  4ESW A;  3IB1 A;  2DWH A;  5K2Y A;  2FNC A;  3SEW A;  4ZEF A;  4IGT A;  3PPN A;  5IAI A;  3S9E A;  4BDR A;  4TLM B;  3Q28 A;  4RNS A;  4XKR A;  1NMU A;  3HST A;  2A5S A;  1ZJL A;  2B3B A;  3ILU B;  1Y1M A;  1BKA A;  5H8N B;  3QYT A;  5L9S A;  1AIV A;  2QS2 A;  4ZS9 A;  2E0S A;  1D3K A;  4JSD A;  3DP8 A;  4ESX A;  1OIB A;  2PYY A;  3TCF A;  3FUZ A;  2VGQ A;  2OBG A;  4OZ9 A;  5JEI A;  3FIR A;  3OOA A;  3FVN A;  1AOV A;  2NVU B;  5ICQ A;  4YKK A;  3M8U A;  4G4P A;  4H8I A;  1CB6 A;  3ODB A;  1XHY A;  4OEN A;  3HV1 A;  1S50 A;  3PUW E;  1BTJ A;  2DQV A;  4YIC A;  3JYR A;  2O7U A;  5HBC A;  4QSC A;  2DSF A;  3H6W A;  1QUK A;  1LAX A;  1DMB A;  3RN8 A;  3SES A;  4FJP A;  3Q27 A;  4GXA A;  1XOC A;  4XKP A;  5B70 A;  1PB7 A;  4WXJ A;  2QS3 A;  3MPK A;  4RYA A;  4P11 A;  1B7H A;  4LZ8 A;  3PUZ E;  4LQ2 A;  5JK4 A;  3WAF A;  2XX9 A;  1NFT A;  3Q26 A;  2V3U A;  2V84 A;  1FTL A;  2QRY A;  4F22 A;  3MZ9 A;  3JZJ A;  1LST A;  2Z22 A;  2Y7R A;  4PFY A;  1ZMG A;  3HO7 A;  3BKI B;  4H8J A;  1DTZ A;  1T0K A;  3H03 A;  1B1H A;  5KDT A;  5I59 A;  1B3H A;  2RC7 A;  1NNT A;  3RPW A;  1B2H A;  3LBS A;  1B4Z A;  2H99 A;  4GOT A;  1N76 A;  4KYE A;  1Y3P A;  4KCC A;  4EF1 A;  4ZEI A;  2XXV A;  1URG A;  2Z23 A;  4Q5T A;  2DE2 A;  3FXQ A;  4O3A A;  4F31 B;  5AA2 D;  1MXY A;  1KWH A;  5I58 B;  2UVH A;  2Y7K A;  3K6W A;  1B0L A;  2I4B A;  2LAO A;  4IB2 A;  3UOR A;  1Z7M E;  2O84 X;  2ESN A;  1ZIU A;  4THI A;  5ISU A;  3DP4 A;  2XXR A;  1B0H A;  1POY 1;  3T96 B;  4FAJ A;  2QS4 A;  2XXQ A;  4Q30 B;  3MZ1 A;  4RK9 A;  2V3T A;  2H9B A;  4KR5 A;  1HSJ A;  4ND9 A;  4LVQ A;  3QK6 A;  3SEX A;  4G77 A;  4U21 A;  4WED A;  3FVG A;  2PVU A;  1LGB C;  1SW4 A;  3K02 A;  3RTF B;  3KN8 A;  3LR1 A;  4GF8 A;  1PB9 A;  3KG2 A;  5DTB A;  1GTK A;  2QL3 A;  1QKA A;  5FTH A;  1O7T A;  1SVX B;  3PD9 A;  1MXV A;  1DOT A;  1A8E A;  2VD3 A;  4EQ9 A;  2ALU A;  3PPO A;  4PET A;  3C4M A;  2QS1 A;  3OMB A;  2YJP A;  2Y7I A;  3K6V A;  2Z8F A;  4NMY A;  3SKP A;  4ZEB A;  1A54 A;  5CM6 A;  1ATG A;  4GL0 A;  3T9H B;  2AL4 A;  1P1Q A;  2ZMB A;  4YB5 A;  2R6G E;  3FV1 A;  3IOW A;  1JNF A;  1SBP A;  2I0B A;  2D5W A;  4E0W A;  3CFX A;  4R2F A;  4DCY A;  3D4G A;  4LQ5 A;  3DEL B;  3PUY E;  1N84 A;  1R9Q A;  1M5C A;  2ZNT A;  1XC1 A;  1GVC A;  3IOV A;  1GR2 A;  1ZTY A;  2XXX A;  1UIV A;  1XVY A;  3PD8 A;  3I3V A;  1B51 A;  1P1O A; 
#chains in the Genus database with same CATH topology
 2D3I A;  2OJT A;  4MH5 A;  1SDX A;  1I69 A;  2WBB A;  4RK2 A;  4UAB A;  1B52 A;  1DTG A;  1XS5 A;  4EQ7 A;  5CMK A;  2F34 A;  4RY1 A;  3AXF A;  4OVJ A;  4IR8 A;  5DW8 A;  2YLN A;  5ITO A;  2A5T A;  1MQD A;  2JJK A;  1EZP A;  2DYX A;  4HXV A;  2DS9 A;  3CG3 A;  2RC9 A;  4KQP A;  3LUZ A;  5HPQ A;  3RTW B;  4AS5 A;  2HQ0 A;  1MQH A;  3EHT A;  3TEP A;  3K6U A;  4NGU A;  5EQA A;  1FBE A;  2G93 A;  1PBP A;  5TP9 A;  2XWV A;  1EYI A;  5KDT B;  5I59 B;  5ELV A;  2OK2 A;  2UVI A;  4H65 A;  1MY0 A;  1B4H A;  4F3B A;  2REJ A;  4UA8 A;  1VDW A;  4O7M A;  1FQE A;  3N5L A;  1OVB A;  2RC8 A;  1ZBM A;  4QFN A;  3CR9 A;  1OQH A;  2XXK A;  4F3P A;  1FPB A;  4GD5 A;  4JVD A;  3VLV A;  3RUM A;  4EXK A;  1IZ1 A;  1LBC A;  5ESY A;  3VV5 A;  5H8S A;  4U2R A;  3H6T A;  4FAT A;  1YXI A;  2VD2 A;  2AL5 A;  2Q8M A;  2I48 A;  3SEU A;  2F7C A;  3GXA A;  4PBQ A;  1FQA A;  1A55 A;  2DXR A;  3B50 A;  1FPI A;  2Q74 A;  1QVS A;  1USY E;  1JW4 A;  3VVF A;  4GXS B;  2DVZ A;  4PAK A;  3O6I A;  2X7Q A;  1LB8 A;  4QFL A;  4YU0 A;  1JVY A;  4IY5 A;  4PFT A;  5H8F A;  3O9P A;  3CRB A;  3KEI A;  2FBP A;  4OA4 A;  2HAV A;  1PB8 A;  1JET A;  1TXF A;  4DXC A;  2WYP A;  1IMC A;  4P56 A;  1FBP A;  1NNF A;  2Q2C A;  3W9W A;  5ET6 A;  4R6Y A;  4G61 A;  5EYG A;  1OLC A;  1MY3 A;  4C1U A;  5L8D A;  2V93 A;  2R71 A;  4KI0 E;  1Y1Z A;  3BIH A;  1Q1K A;  4ISU A;  1Y4T A;  4GQO A;  4F2O A;  4NF0 A;  5AA4 A;  3MAM A;  1WDN A;  1F9B A;  3IK6 B;  1LAF E;  1RKM A;  4PGN A;  4ZZE A;  3K6X A;  1BLF A;  4OYV A;  3IJO B;  1I6B A;  4JXI A;  4FEB A;  3MP8 A;  1AH5 A;  2V25 A;  4IO6 A;  2GRV A;  1SD3 A;  2I6E A;  5BWJ A;  3PMX A;  4KD5 A;  2ZZW A;  2RCA A;  1H44 A;  1B40 A;  3M3K A;  1PBQ A;  2XXI A;  5AA3 A;  2ABH A;  2XX8 A;  1Y9U A;  2VOZ A;  2GFE A;  1FPG A;  4LN5 A;  1YTV A;  2NOO A;  3V5A A;  2QVV A;  4GBW A;  4G8M A;  1LBZ A;  1LCT A;  3KJ7 A;  3OXN A;  3IOR A;  3VLU A;  4C0R A;  1PEB A;  1QUJ A;  4YKP A;  4H45 A;  4LZ5 A;  2A5T B;  4FED A;  4LON B;  1MH3 A;  4R74 A;  4U1Z A;  4JSO A;  4KPT A;  4XF5 A;  2GQ1 A;  2CZK A;  1A8F A;  3TTM A;  1EYK A;  1IMF A;  3CSB A;  5DVF A;  1N7W A;  3PPR A;  4AQ4 A;  2XX7 A;  1K9Y A;  1MXX A;  4I9D A;  4OVP A;  5IM2 A;  5AE4 A;  5TP9 B;  1MS7 A;  1URS A;  3CG1 A;  4MCO A;  1IQ7 A;  4OVQ A;  2O1M A;  2F97 A;  2DWI A;  1MPB A;  2QVU A;  2Q8J A;  4OER A;  4NE4 A;  4YB7 A;  2HXR A;  3JV9 A;  1RYO A;  2FIX A;  3SET A;  4XKN A;  1B3L A;  3RGY A;  3MBP A;  3THI A;  4JBZ A;  3H6V A;  1P1W A;  4GFR A;  1HSE A;  4PDD A;  1Q9D A;  4QFP A;  2OZZ A;  5CBR A;  2KLF A;  3B7D A;  5I3S A;  4O3C A;  1OMP A;  4TLL B;  1L5T A;  2VPO A;  1A99 A;  3PUV E;  4DE8 A;  2O51 A;  4YB6 A;  3PGF A;  3RT6 B;  4F39 A;  4NQ8 A;  1RDZ A;  2XXT A;  4F3S A;  2I0C A;  4QBA A;  3LSF B;  3O6G A;  4OFO A;  3UGW A;  3KC0 A;  2XXP A;  4P9K A;  3FJ7 A;  4EXL A;  1FRP A;  5FHM A;  4P47 A;  3UN6 A;  5EQ8 A;  3O2A A;  3U65 A;  4GRK A;  2H25 A;  3IO6 A;  4LUB A;  4HTG A;  4MX6 A;  4DIG A;  2F7A A;  4RA1 A;  4F1U A;  3HHF A;  2ONR A;  3VLW A;  5DYH A;  2HPG A;  2O69 A;  2Y7P A;  4JVC A;  4IO2 A;  2PX1 A;  3VXC A;  5I57 A;  5EHM A;  2CZH A;  1VFE A;  4GVO A;  2ZYO A;  5H8F B;  3DLN A;  1FBC A;  4OHN A;  1BP5 A;  1FPK A;  1A40 A;  5FTI A;  1N04 A;  1FPD A;  1LCF A;  1LFG A;  1QUI A;  3VE1 B;  4PAI A;  1URD A;  4NWC A;  2VP1 A;  3HCQ A;  1I6A A;  2O68 A;  2F7B A;  1IMD A;  1MH4 A;  3PMW A;  3S4U A;  2ZNU A;  1FPL A;  3KSX A;  1FBD A;  1NUY A;  2OWT A;  4QHQ A;  2M8C A;  3EQ1 A;  4NF5 B;  2OWZ A;  1B3G A;  5L9O A;  4R75 A;  3N6U A;  2H5Y A;  2RIN A;  4MLV A;  3TQW A;  1LFI A;  3T1B A;  3TZA A;  1MY1 A;  3MVX A;  4IO3 A;  5AA4 B;  3PV0 E;  3U1O A;  4L17 A;  1FCK A;  3W9V A;  3OD7 A;  5K2X A;  3A3C A;  3OEK A;  4LA9 A;  1J1N A;  1US4 A;  4N6P A;  3GLB A;  4PAF A;  3TAJ A;  4MNC A;  4R9F A;  2Q9T A;  1NV6 A;  1IMA A;  1JP4 A;  2I58 A;  1UTH A;  3I5O A;  1LB9 A;  4PFB A;  3S2V A;  3U92 A;  1TFA A;  4F19 A;  1FBF A;  1UQW A;  4R9G A;  4HE0 A;  3VXB A;  1A7L A;  2Y84 A;  3TQL A;  2Y7W A;  5JTY A;  4MIJ A;  4XXU A;  5DEX A;  4P1L A;  5AA1 A;  5CMB A;  1B7U A;  4NAP A;  2F6G A;  4KFQ A;  1FQB A;  1CE2 A;  3BBR A;  4MLQ A;  3WAE A;  3V89 B;  4G68 A;  4H67 A;  1NV5 A;  1NV4 A;  1R1N A;  2Q2A A;  3V8X B;  4P1E A;  4OAN A;  1DSN A;  3T0J A;  3EKI A;  1RDY A;  3T22 A;  1D4N A;  4DXU A;  2F3D A;  1MPD A;  4ZE8 A;  1VSO A;  5IZ1 A;  3B8B A;  2B3F A;  3KSJ A;  1Y3N A;  2IA4 A;  4PE5 B;  4HCW A;  4EUO A;  4RPO A;  2WX9 A;  3QMF A;  2I3V A;  2I49 A;  4AB6 A;  1N7X A;  3LUY A;  2XHD A;  4KYS A;  1JQF A;  4YKI A;  4AS4 A;  3TYH A;  3EHS A;  4TOZ A;  4RXL A;  5M2V A;  3RT8 A;  2OWS A;  3U94 A;  3C34 A;  3HFU A;  3QAX A;  1TWY A;  3FGS A;  2XWI A;  4PDH A;  3H6U A;  3VVE A;  1O64 A;  1QJM A;  3BIG A;  2DVC A;  3C31 A;  3LSL A;  1SQY A;  2DE3 A;  1S9T A;  4R2B A;  5LDZ A;  1N3W A;  4LP2 B;  4DI4 B;  4DLD A;  1IEJ A;  4QSD A;  4ZZA A;  3KN3 A;  3HPI A;  4MMP A;  1VE4 A;  3QXM A;  4GL8 A;  3P7I A;  3E78 A;  3TTR A;  5KZT A;  1IUD A;  5DVJ A;  4NN3 A;  4R6H A;  3E79 A;  3EN3 A;  5CMC A;  1D9Y A;  4POX A;  3K1P A;  2NWJ A;  1EZO A;  4Q0C A;  2BJI A;  3PPQ A;  5DVI A;  5EHS A;  3MST A;  3FXR A;  1SI0 A;  2HAU A;  3MW0 A;  3ZKK A;  4ELQ A;  3UP9 A;  1LAH E;  3QIM A;  4R73 A;  3MVY A;  5J16 A;  1YPN A;  3CFZ A;  4NED A;  1H45 A;  5H8N A;  2UVJ A;  1IXH A;  1FPE A;  2UYE A;  1EH3 A;  1B05 A;  1IME A;  2YPN A;  1PC3 A;  2QVR A;  1P1N A;  3HHG A;  3ZS6 A;  4MBP A;  4KYD A;  5I57 B;  1MXZ A;  5IGA A;  3G3G A;  3KJT A;  1INP A;  4OXV A;  3FAS A;  1I6Q A;  3DM0 A;  2FYI A;  4NTL A;  4I8C A;  2CZL A;  4OEV A;  4JWO A;  3TUS A;  4UAC A;  5ET7 A;  3IJX B;  4OQO A;  5CI5 A;  2NUV A;  2UVG A;  3QSL A;  2VPN A;  4PFI A;  3R6U A;  3B6W A;  3FVK A;  4GWS A;  4C1T A;  4F2Q A;  2UXA A;  1VR5 A;  4G68 C;  4GWY A;  4P0G A;  2F8D A;  2ZZX A;  1R6Z A;  2DE4 A;  2V3Q A;  3SEY A;  3PUX E;  4IY6 A;  2F78 A;  5CRY A;  2QMW A;  4OEU A;  3M3F A;  1MDQ A;  3TOD A;  1NUZ A;  4H46 A;  1UTB A;  4NF4 A;  5I84 A;  4PBH A;  2OLB A;  3Q29 A;  4I3Y A;  1MDP 1;  1IIW A;  2ONS A;  2GH9 A;  4PFW A;  4HS7 A;  1N3X A;  2QMX A;  5IZ3 A;  2HXW A;  3IX1 A;  4QSE A;  3SEV A;  4ELP A;  3F11 A;  1UTH B;  4ZEC A;  4YZZ A;  1GGG A;  1IXG A;  5ICT A;  2DWA A;  1SW2 A;  3UA8 A;  3T9U A;  3CVG A;  1JEV A;  1B3F A;  4X48 A;  1S7Y A;  1OLA A;  4ZEK A;  1B58 A;  5I56 A;  4N15 A;  1BK4 A;  3FAT A;  2FA7 A;  2H4I A;  3RY3 A;  4JDF A;  4JB7 A;  5DEX B;  1YCJ A;  1DPE A;  2ZYN A;  4LZ7 A;  1IXC A;  2ZYK A;  3IB2 A;  5A5X A;  4Q8R A;  2XWO A;  3KOS A;  4U4X A;  5FHN A;  4I40 A;  4G68 B;  2W7Y A;  1MM6 A;  4X1D A;  1TFD A;  4PQJ A;  3DP6 A;  3TKD A;  5EYF A;  4JWY A;  2RKM A;  4QFK A;  5ET8 A;  3H3G A;  3TEL A;  4U23 A;  3G3J A;  2P2A A;  1IIT A;  1JEU A;  4DDD A;  4M1V A;  1M5D A;  3OSQ A;  2WBD A;  3FJM A;  1NH8 A;  4IO7 A;  4OFJ A;  4F18 A;  1LAG E;  4XIG Q;  3E13 X;  3IL1 B;  3IFA A;  2NXO A;  1B5I A;  4HW8 A;  1NV7 A;  3E9X A;  2H98 A;  3KOT A;  3SER A;  1NNP A;  4MNI A;  2CMO A;  4R6K A;  4MHF A;  4MF3 A;  1FQD A;  4AB5 A;  3B6Q A;  1SYH A;  3H7M A;  3K1M A;  2PMS A;  4X1B A;  4Z0I A;  2R8T A;  2F3B A;  3A09 A;  4H1X A;  4OVT A;  4DCX A;  2F5X A;  1POT A;  2X7P A;  3G7W A;  4BDO A;  3PU5 A;  2HCA A;  4RJZ A;  3SDF A;  1XT8 A;  1NI9 A;  1MY4 A;  3M3L A;  4YMA A;  1G0I A;  4M4G A;  1CNQ A;  4MNP A;  2L5V A;  5F24 A;  4H5G A;  1B32 A;  4G8H A;  3USD A;  3KZG A;  3T93 B;  3LC8 A;  1PDA A;  1B1X A;  1AL3 A;  2QPQ A;  4YKJ A;  4RPN A;  4XKQ A;  1FTM A;  4QF9 A;  2Q88 A;  2DOJ A;  3IO4 A;  3KGC A;  4EF2 A;  3E4R A;  2F35 A;  4ZE9 A;  4NHB A;  1LBV A;  3IB0 A;  4O8M A;  3K2D A;  3MQ9 A;  3FJG A;  3QUF A;  4YMB A;  1MQI A;  2P1S A;  1P1U A;  2VHA A;  4PCD A;  1BIY A;  5TU0 A;  1GV8 A;  3IAZ A;  4TQU Q;  3K0V A;  2V4C A;  4KHZ E;  3S9N C;  3LSX A;  1JVX A;  1LEV A;  3G3F A;  2XD2 A;  4EQB A;  4GIZ A;  2HZK A;  3TCH A;  1AMF A;  5LTC A;  5IKB A;  4NWD A;  1FQC A;  4F1Y A;  3MVZ A;  2DDK A;  4I62 A;  3CFL A;  3RPL A;  4OVR A;  1SW5 A;  2I3W A;  3D4C A;  2HHM A;  1FTO A;  1Y3Q A;  5TPA A;  4QRZ A;  4N91 A;  4ECF A;  5AA2 A;  1UTB B;  3MPL A;  4NF4 B;  3V83 A;  3O28 A;  3MP6 A;  4BDM A;  2THI A;  5L9M A;  4ZDM A;  3OO7 A;  5I2K A;  5IZ3 B;  1QUL A;  4HCY A;  3RYD A;  2O7I A;  4P0I A;  1FPJ A;  3EF7 A;  1Y4C A;  3ONM A;  3H4Z A;  4QXD A;  1US5 A;  4KXP A;  1QW0 A;  2OX3 A;  3G3K A;  5I56 B;  3MYU A;  3OSR A;  4XTC Q;  5H8Q A;  3NOH A;  4ELO A;  4NF8 A;  2HEU A;  5A5X B;  3L6H A;  2OCU A;  3MZB A;  3ZSF A;  4NX1 A;  1KA1 A;  5BUU A;  1NUW A;  1TT1 A;  3S9M C;  3T66 A;  4PC9 A;  5LOM A;  2XWK A;  1YZ0 A;  2HZL A;  2B4M A;  1Z7N E;  2O1L A;  2RCB A;  3RNN A;  4OET A;  1HSL A;  3O6H A;  4I3E A;  5IZZ A;  1D9V A;  3A3U A;  4OES A;  5F1Q A;  5CMM A;  4HE2 A;  4U22 A;  3T9X B;  3KBR A;  2X26 A;  4P3L A;  3U8Q A;  3BFT A;  5ITP A;  2XXW A;  2XXU A;  3G3H A;  2DWJ A;  3MJN A;  1MXU A;  1LBY A;  4IGR A;  3R26 A;  3EHU A;  1WVJ A;  4DZ1 A;  2B65 A;  3TMG A;  1RDX A;  2WYK A;  5KCJ A;  3EPE A;  1LBX A;  1USY H;  3K01 A;  1EYJ A;  5ET5 A;  4N07 A;  1B46 A;  5HM4 B;  1NNK A;  3RQT A;  3TDJ A;  4JVI A;  2E1S A;  2XD3 A;  5CBS A;  4G2Z A;  1LLS A;  2PT2 A;  3FBP A;  3VFJ A;  5I5P A;  5I2N A;  3ZKL A;  4WKM A;  3HN0 A;  1FTJ A;  1AWB A;  3O97 A;  3H06 B;  2CZI A;  2Y5L A;  1ZU0 A;  4O3B A;  5H8H A;  3OEL A;  2HFB A;  4N13 A;  3T9V A;  4BDQ A;  4G8N A;  3O29 A;  3LSW A;  4JWX A;  4YAH X;  3W15 C;  1ZKB A;  4FE8 A;  2G29 A;  3C36 A;  2AYS A;  3N6T A;  3N94 A;  3QUJ A;  1B6H A;  2F36 A;  3CIJ A;  5I7I A;  1B5J A;  1NV3 A;  4NF6 A;  5J1D A;  3MC2 A;  2UYF A;  3D1R A;  3GBA A;  4N8G A;  1N0T A;  1MG1 A;  4X8R A;  1FW0 A;  1M5F A;  2DP8 A;  1B5H A;  3RLF E;  3TFL A;  1MY2 A;  2QJE A;  1XVX A;  1H76 A;  2XXH A;  3IFC A;  5B7D A;  4GLI A;  2O6A A;  2QSX A;  3OEM A;  1YYZ A;  1H43 A;  3S9L C;  3RPL B;  2CEX A;  4LAT A;  2ZXT A;  5TPA B;  1M5E A;  5AA2 B;  1ZLQ A;  3CSG A;  3C9H A;  3MWB A;  3N26 A;  1DCU A;  3K4U A;  1ANF A;  3K00 A;  2FIE A;  1MM7 A;  3FZV A;  3UIF A;  2ZNS A;  3ILT B;  4BDL A;  5I2K B;  3C33 A;  2I4C A;  3B6T A;  4XEQ A;  4X9T A;  5FHO A;  1ELJ A;  4DXB A;  3I6V A;  1H3D A;  4IO4 A;  2XXY A;  4QFO A;  1LBB A;  2IEE A;  1Y20 A;  4KCD A;  1NKX A;  5DT6 A;  3GYY A;  3TCG A;  1NV1 A;  3FV2 A;  3FXU A;  4F29 A;  4FOR A;  3A29 A;  5H8Q B;  1SW1 A;  1FBG A;  4NF8 B;  1JW5 A;  5CC2 A;  2Q89 A;  4OTE A;  1LFH A;  4PP0 A;  4H0W A;  3FVO A;  2WEF A;  2R9J A;  4K3F A;  1OQG A;  2ONK E;  4EDP A;  3TTL A;  3PMV A;  1IXI A;  2PCR A;  3TPA A;  1II5 A;  2RF1 A;  4GBV A;  3OO6 A;  3KFM A;  2MKZ A;  1R9L A;  4F1V A;  4Z7E A;  1MQJ A;  1MRP A;  3OEN A;  2GHA A;  4FEC A;  2BJJ X;  3MP1 A;  1B3E A;  5EYH A;  4IO5 A;  4FBP A;  1NL5 A;  4I1D A;  1SYI A;  1YAE A;  1QKB A;  3G3I A;  1MXW A;  1SPI A;  3OO8 A;  3TTN A;  1SI1 A;  2AIX A;  4GX6 A;  4BLA A;  1FQF A;  1M5B A;  4GWZ A;  4NG7 A;  1MQG A;  1IMB A;  4ELR A;  4U1O A;  1O63 A;  3U93 A;  2Z8D A;  3UK4 A;  4GX4 A;  2ZYM A;  4FIM A;  4WEP A;  4GX3 A;  1MPC A;  1EZ9 A;  1B9J A;  1RYX A;  5KCJ B;  4PGP A;  4OMB A;  1KZ8 A;  4GWU A;  4O7I A;  4PE3 A;  2PT1 A;  3C32 A;  3MVW A;  1FJ9 A;  2REG A;  3CI8 A;  2Z8E A;  5JTY B;  1FJ6 A;  3VDF A;  4MFI A;  3ECR A;  4R72 A;  2GHB A;  1B7Z A;  5I2N B;  4OFL A;  2PFZ A;  4H5F A;  3E3K A;  3PPP A;  2P0S A;  3GZG A;  4POW A;  4ZED A;  5F7V A;  1K9Z A;  3C35 A;  1OVT A;  1UIU A;  1EU8 A;  2KR0 A;  3IOU A;  3O66 A;  3L6G A;  2P3V A;  3KN7 A;  4GWW A;  3KC1 A;  4MEV A;  5H8H B;  4BDN A;  2DXY A;  4OWD A;  2ANJ A;  2QFL A;  5I58 A;  2P3N A;  3IR1 A;  4U4S A;  4E0X A;  3TTK A;  4NF5 A;  1JW1 A;  4ONY A;  4F3G A;  1NV2 A;  3BFU A;  5EQ7 A;  1P99 A;  3IOT A;  1Q35 A;  3VVD A;  2WKY A;  1VFD A;  4DI3 D;  1FTK A;  4NF6 B;  1DPP A;  3U72 A;  1WOD A;  4GWO A;  3MUQ A;  2PBW A;  3K1N A;  3OO9 A;  2Y5K A;  1NH7 A;  3FD3 A;  3KBZ A;  1FSA A;  3R7X A;  3GBB A;  4PFU A;  1FTA A;  2D21 A;  4H6D A;  3Q25 A;  2F6P A;  4ESW A;  5A5L A;  3IB1 A;  3CHG A;  2DWH A;  5K2Y A;  2FNC A;  3SEW A;  4ZEF A;  4IGT A;  2XA5 A;  3PPN A;  5IAI A;  3S9E A;  4PTK A;  4BDR A;  4TLM B;  1FPF A;  3Q28 A;  4PFR A;  4RNS A;  4XKR A;  1NMU A;  2VT5 A;  3HST A;  2A5S A;  1ZJL A;  2B3B A;  3ILU B;  2PFY A;  1Y1M A;  1BKA A;  5H8N B;  3QYT A;  5L9S A;  1AIV A;  2FVZ A;  2QS2 A;  4ZS9 A;  2E0S A;  1D3K A;  4JSD A;  3DP8 A;  4ESX A;  1OIB A;  2PYY A;  3TCF A;  3FUZ A;  4N81 A;  2VGQ A;  1LBW A;  2OBG A;  4OZ9 A;  1DK4 A;  5JEI A;  3FIR A;  3OOA A;  3FVN A;  1AOV A;  2NVU B;  5ICQ A;  4YKK A;  3M8U A;  4G4P A;  4H8I A;  1CB6 A;  3ODB A;  1G0H A;  1XHY A;  4OEN A;  3HV1 A;  1S50 A;  3PUW E;  1BTJ A;  1QGX A;  2DQV A;  4MAG A;  4YIC A;  3JYR A;  2O7U A;  5HBC A;  4QSC A;  2DSF A;  3H6W A;  1QUK A;  1LAX A;  4N17 A;  1DMB A;  3RN8 A;  3SES A;  4FJP A;  3Q27 A;  4GXA A;  1XOC A;  4XKP A;  5B70 A;  1PB7 A;  4PF6 A;  2FHY A;  4WXJ A;  2QS3 A;  3MPK A;  4RYA A;  4P11 A;  2B4L A;  1XI6 A;  1B7H A;  4LZ8 A;  3PUZ E;  4LQ2 A;  5JK4 A;  3WAF A;  2XX9 A;  1NFT A;  3Q26 A;  1KA0 A;  2V3U A;  2V84 A;  1FTL A;  2QRY A;  4F22 A;  3MZ9 A;  3JZJ A;  1LST A;  2Z22 A;  2Y7R A;  4HE1 A;  4PFY A;  1ZMG A;  4OVS A;  3HO7 A;  3BKI B;  4H8J A;  1DTZ A;  1T0K A;  3H03 A;  1B1H A;  5KDT A;  5I59 A;  3ISP A;  1B3H A;  2RC7 A;  1NNT A;  3RPW A;  1B2H A;  1DBZ A;  3LBS A;  1B4Z A;  4N8Y A;  2H99 A;  4GOT A;  1N76 A;  3LV0 A;  4KYE A;  1Y3P A;  4KCC A;  4N6D A;  4EF1 A;  4ZEI A;  2XXV A;  1URG A;  5EQ9 A;  2Z23 A;  4Q5T A;  2DE2 A;  3FXQ A;  4O3A A;  5FBP A;  4F31 B;  5AA2 D;  1MXY A;  1KWH A;  5I58 B;  4O94 A;  2UVH A;  4XFE A;  2Y7K A;  3K6W A;  1B0L A;  2I4B A;  2LAO A;  4IB2 A;  3UOR A;  1Z7M E;  2O84 X;  2ESN A;  1ZIU A;  4THI A;  4MJO A;  5ISU A;  3DP4 A;  1NV0 A;  2XXR A;  1NUX A;  1B0H A;  1POY 1;  4P8B A;  3T96 B;  4FAJ A;  2QS4 A;  2XXQ A;  4Q30 B;  3MZ1 A;  4RK9 A;  2V3T A;  2H9B A;  4KR5 A;  1HSJ A;  4ND9 A;  4LVQ A;  3QK6 A;  2CEY A;  3SEX A;  4G77 A;  4U21 A;  4WED A;  3FVG A;  2PVU A;  1LGB C;  1SW4 A;  3FXB A;  3K02 A;  3RTF B;  3KN8 A;  3LR1 A;  4GF8 A;  3ROJ A;  1PB9 A;  3KG2 A;  5DTB A;  1GTK A;  2QL3 A;  1QKA A;  5FTH A;  1O7T A;  1SVX B;  3PD9 A;  1MXV A;  1DOT A;  1A8E A;  4PF8 A;  2VD3 A;  2KQZ A;  4EQ9 A;  2ALU A;  3PPO A;  4PET A;  3C4M A;  2QS1 A;  3OMB A;  2YJP A;  2Y7I A;  3K6V A;  2Z8F A;  2ZZV A;  4NMY A;  3SKP A;  4ZEB A;  1A54 A;  5CM6 A;  1ATG A;  4GL0 A;  3T9H B;  2AL4 A;  1P1Q A;  2ZMB A;  4YB5 A;  1FBH A;  2R6G E;  3FV1 A;  3IOW A;  1JNF A;  1SBP A;  4N4U A;  2I0B A;  2D5W A;  4E0W A;  4R2F A;  3CFX A;  4DCY A;  3D4G A;  4N6K A;  4LQ5 A;  3DEL B;  3PUY E;  1N84 A;  1R9Q A;  4X04 A;  3SZP A;  1M5C A;  2ZNT A;  1XC1 A;  1GVC A;  3IOV A;  5T3J A;  1GR2 A;  1ZTY A;  1D9Q A;  2XXX A;  1UIV A;  4GWX A;  1XVY A;  3PD8 A;  3I3V A;  1B51 A;  3PTY A;  1P1O A; 
#chains in the Genus database with same CATH homology
 2D3I A;  2OJT A;  4MH5 A;  1SDX A;  1I69 A;  4RK2 A;  1B52 A;  1DTG A;  1XS5 A;  4EQ7 A;  5CMK A;  2F34 A;  4RY1 A;  3AXF A;  4OVJ A;  2YLN A;  5ITO A;  2A5T A;  1MQD A;  1EZP A;  2DYX A;  2DS9 A;  3CG3 A;  2RC9 A;  4KQP A;  5HPQ A;  3RTW B;  2HQ0 A;  1MQH A;  3EHT A;  3TEP A;  3K6U A;  2G93 A;  1PBP A;  5TP9 A;  5KDT B;  5I59 B;  5ELV A;  2OK2 A;  2UVI A;  4H65 A;  1MY0 A;  1B4H A;  4F3B A;  2REJ A;  4UA8 A;  1FQE A;  3N5L A;  1OVB A;  2RC8 A;  1ZBM A;  4QFN A;  3CR9 A;  1OQH A;  4F3P A;  4GD5 A;  3VLV A;  3RUM A;  4EXK A;  1IZ1 A;  1LBC A;  3VV5 A;  5H8S A;  4U2R A;  3H6T A;  4FAT A;  2VD2 A;  2AL5 A;  2I48 A;  3SEU A;  2F7C A;  3GXA A;  1FQA A;  1A55 A;  2DXR A;  1QVS A;  1USY E;  1JW4 A;  3VVF A;  4GXS B;  2DVZ A;  3O6I A;  2X7Q A;  1LB8 A;  4QFL A;  4YU0 A;  1JVY A;  4IY5 A;  4PFT A;  5H8F A;  3O9P A;  3CRB A;  3KEI A;  2HAV A;  1PB8 A;  1JET A;  1TXF A;  4DXC A;  1NNF A;  2Q2C A;  3W9W A;  4R6Y A;  1OLC A;  1MY3 A;  4C1U A;  5L8D A;  2V93 A;  2R71 A;  4KI0 E;  1Y1Z A;  1Q1K A;  4ISU A;  1Y4T A;  4GQO A;  4F2O A;  5AA4 A;  3MAM A;  1WDN A;  1F9B A;  3IK6 B;  1LAF E;  1RKM A;  4ZZE A;  3K6X A;  1BLF A;  4OYV A;  3IJO B;  1I6B A;  4JXI A;  4FEB A;  3MP8 A;  1AH5 A;  2V25 A;  4IO6 A;  2GRV A;  1SD3 A;  2I6E A;  5BWJ A;  3PMX A;  4KD5 A;  2RCA A;  1H44 A;  1B40 A;  3M3K A;  1PBQ A;  2XXI A;  5AA3 A;  2ABH A;  2XX8 A;  1Y9U A;  2VOZ A;  2GFE A;  1YTV A;  2NOO A;  3V5A A;  4G8M A;  1LCT A;  3KJ7 A;  3OXN A;  3IOR A;  3VLU A;  4C0R A;  1PEB A;  1QUJ A;  4YKP A;  4LZ5 A;  2A5T B;  4FED A;  4LON B;  1MH3 A;  4R74 A;  4U1Z A;  4JSO A;  4KPT A;  1A8F A;  3TTM A;  3CSB A;  5DVF A;  1N7W A;  3PPR A;  4AQ4 A;  2XX7 A;  1MXX A;  4I9D A;  5AE4 A;  5TP9 B;  1MS7 A;  1URS A;  3CG1 A;  1IQ7 A;  2O1M A;  2F97 A;  2DWI A;  1MPB A;  2Q8J A;  4OER A;  4NE4 A;  4YB7 A;  3JV9 A;  1RYO A;  3SET A;  4XKN A;  1B3L A;  3RGY A;  3MBP A;  3THI A;  4JBZ A;  3H6V A;  1P1W A;  4GFR A;  1HSE A;  4QFP A;  2OZZ A;  5CBR A;  2KLF A;  3B7D A;  4O3C A;  1OMP A;  4TLL B;  1L5T A;  1A99 A;  3PUV E;  4DE8 A;  2O51 A;  4YB6 A;  3PGF A;  3RT6 B;  4F39 A;  2XXT A;  4F3S A;  2I0C A;  3LSF B;  3O6G A;  4OFO A;  3UGW A;  2XXP A;  3FJ7 A;  4EXL A;  5FHM A;  3UN6 A;  3O2A A;  4GRK A;  2H25 A;  3IO6 A;  4LUB A;  4HTG A;  4DIG A;  2F7A A;  4RA1 A;  4F1U A;  3HHF A;  2ONR A;  3VLW A;  5DYH A;  2Y7P A;  2O69 A;  4IO2 A;  2PX1 A;  3VXC A;  5I57 A;  5EHM A;  1VFE A;  4GVO A;  2ZYO A;  5H8F B;  3DLN A;  4OHN A;  1BP5 A;  1A40 A;  5FTI A;  1N04 A;  1LCF A;  1LFG A;  1QUI A;  3VE1 B;  1URD A;  4NWC A;  2VP1 A;  3HCQ A;  1I6A A;  2O68 A;  2F7B A;  1MH4 A;  3PMW A;  3S4U A;  2ZNU A;  3KSX A;  2OWT A;  4QHQ A;  2M8C A;  3EQ1 A;  4NF5 B;  1B3G A;  5L9O A;  4R75 A;  3N6U A;  2H5Y A;  2RIN A;  4MLV A;  3TQW A;  1LFI A;  3TZA A;  1MY1 A;  3MVX A;  4IO3 A;  5AA4 B;  3PV0 E;  3U1O A;  4L17 A;  1FCK A;  3W9V A;  3OD7 A;  5K2X A;  3A3C A;  3OEK A;  4LA9 A;  1J1N A;  1US4 A;  4N6P A;  3GLB A;  3TAJ A;  4R9F A;  2Q9T A;  2I58 A;  1UTH A;  3I5O A;  1LB9 A;  3S2V A;  3U92 A;  1TFA A;  4F19 A;  1UQW A;  4R9G A;  3VXB A;  1A7L A;  2Y84 A;  3TQL A;  2Y7W A;  5JTY A;  4XXU A;  5DEX A;  5AA1 A;  5CMB A;  1B7U A;  2F6G A;  4KFQ A;  1FQB A;  1CE2 A;  3BBR A;  4MLQ A;  3WAE A;  3V89 B;  4G68 A;  4H67 A;  1R1N A;  2Q2A A;  3V8X B;  1DSN A;  3T22 A;  1D4N A;  4DXU A;  1MPD A;  4ZE8 A;  1VSO A;  2B3F A;  3KSJ A;  1Y3N A;  2IA4 A;  4PE5 B;  4HCW A;  4EUO A;  4RPO A;  2I3V A;  2I49 A;  4AB6 A;  1N7X A;  3LUY A;  2XHD A;  4KYS A;  1JQF A;  4YKI A;  3TYH A;  3EHS A;  4TOZ A;  4RXL A;  5M2V A;  3RT8 A;  2OWS A;  3U94 A;  3C34 A;  3QAX A;  1TWY A;  3FGS A;  3H6U A;  3VVE A;  1O64 A;  1QJM A;  2DVC A;  3C31 A;  3LSL A;  1SQY A;  2DE3 A;  1S9T A;  4R2B A;  1N3W A;  4LP2 B;  4DLD A;  1IEJ A;  4QSD A;  4ZZA A;  3KN3 A;  3HPI A;  1VE4 A;  3QXM A;  4GL8 A;  3P7I A;  3TTR A;  5KZT A;  1IUD A;  5DVJ A;  4R6H A;  3EN3 A;  5CMC A;  1D9Y A;  4POX A;  3K1P A;  2NWJ A;  1EZO A;  4Q0C A;  3PPQ A;  5DVI A;  5EHS A;  3FXR A;  1SI0 A;  2HAU A;  3MW0 A;  3ZKK A;  4ELQ A;  3UP9 A;  1LAH E;  3QIM A;  4R73 A;  3MVY A;  1YPN A;  3CFZ A;  4NED A;  1H45 A;  5H8N A;  2UVJ A;  1IXH A;  2UYE A;  1EH3 A;  1B05 A;  2YPN A;  1PC3 A;  1P1N A;  3HHG A;  3ZS6 A;  4MBP A;  4KYD A;  5I57 B;  1MXZ A;  3G3G A;  3KJT A;  4OXV A;  3FAS A;  1I6Q A;  3DM0 A;  2FYI A;  4NTL A;  4I8C A;  2CZL A;  4OEV A;  4JWO A;  3TUS A;  4UAC A;  3IJX B;  4OQO A;  5CI5 A;  2NUV A;  2UVG A;  3QSL A;  3R6U A;  3B6W A;  3FVK A;  4C1T A;  4F2Q A;  2UXA A;  1VR5 A;  4G68 C;  4P0G A;  2F8D A;  1R6Z A;  2DE4 A;  2V3Q A;  3SEY A;  3PUX E;  4IY6 A;  2F78 A;  5CRY A;  2QMW A;  4OEU A;  3M3F A;  1MDQ A;  3TOD A;  1UTB A;  4NF4 A;  5I84 A;  2OLB A;  3Q29 A;  1MDP 1;  1IIW A;  2ONS A;  2GH9 A;  4PFW A;  4HS7 A;  1N3X A;  2QMX A;  2HXW A;  3IX1 A;  4QSE A;  4ELP A;  3SEV A;  3F11 A;  1UTH B;  4ZEC A;  4YZZ A;  1GGG A;  1IXG A;  5ICT A;  2DWA A;  1SW2 A;  3UA8 A;  3T9U A;  3CVG A;  1JEV A;  1B3F A;  4X48 A;  1S7Y A;  1OLA A;  4ZEK A;  1B58 A;  5I56 A;  3FAT A;  2FA7 A;  2H4I A;  3RY3 A;  4JDF A;  4JB7 A;  5DEX B;  1YCJ A;  1DPE A;  2ZYN A;  4LZ7 A;  1IXC A;  2ZYK A;  5A5X A;  3IB2 A;  4Q8R A;  3KOS A;  4U4X A;  5FHN A;  4G68 B;  2W7Y A;  1MM6 A;  4X1D A;  1TFD A;  4PQJ A;  3DP6 A;  3TKD A;  5EYF A;  4JWY A;  2RKM A;  4QFK A;  3H3G A;  3TEL A;  4U23 A;  3G3J A;  2P2A A;  1IIT A;  1JEU A;  4DDD A;  4M1V A;  1M5D A;  3OSQ A;  3FJM A;  1NH8 A;  4IO7 A;  4OFJ A;  4F18 A;  1LAG E;  4XIG Q;  3E13 X;  3IL1 B;  2NXO A;  1B5I A;  4HW8 A;  3E9X A;  2H98 A;  3KOT A;  3SER A;  1NNP A;  2CMO A;  4R6K A;  4MF3 A;  1FQD A;  4AB5 A;  3B6Q A;  1SYH A;  3H7M A;  3K1M A;  2PMS A;  4X1B A;  4Z0I A;  3A09 A;  4H1X A;  4DCX A;  2F5X A;  1POT A;  2X7P A;  3G7W A;  4BDO A;  3PU5 A;  2HCA A;  4RJZ A;  3SDF A;  1XT8 A;  1MY4 A;  3M3L A;  4YMA A;  4M4G A;  4H5G A;  1B32 A;  4G8H A;  3USD A;  3KZG A;  3T93 B;  3LC8 A;  1PDA A;  1B1X A;  1AL3 A;  2QPQ A;  4YKJ A;  4RPN A;  4XKQ A;  1FTM A;  4QF9 A;  2Q88 A;  2DOJ A;  3IO4 A;  3KGC A;  4EF2 A;  3E4R A;  2F35 A;  4ZE9 A;  3IB0 A;  3K2D A;  3MQ9 A;  3FJG A;  3QUF A;  4YMB A;  1MQI A;  2P1S A;  1P1U A;  2VHA A;  1BIY A;  5TU0 A;  1GV8 A;  3IAZ A;  4TQU Q;  3K0V A;  4KHZ E;  3S9N C;  3LSX A;  1JVX A;  3G3F A;  2XD2 A;  4EQB A;  4GIZ A;  2HZK A;  3TCH A;  1AMF A;  5IKB A;  4NWD A;  1FQC A;  4F1Y A;  3MVZ A;  4I62 A;  3CFL A;  1SW5 A;  2I3W A;  3D4C A;  1FTO A;  1Y3Q A;  5TPA A;  4QRZ A;  4ECF A;  5AA2 A;  1UTB B;  3MPL A;  4NF4 B;  3V83 A;  3O28 A;  3MP6 A;  4BDM A;  2THI A;  5L9M A;  4ZDM A;  3OO7 A;  5I2K A;  1QUL A;  4HCY A;  2O7I A;  4P0I A;  3EF7 A;  1Y4C A;  3ONM A;  3H4Z A;  1US5 A;  1QW0 A;  3G3K A;  5I56 B;  3OSR A;  4XTC Q;  5H8Q A;  4ELO A;  4NF8 A;  2HEU A;  5A5X B;  3L6H A;  2OCU A;  3MZB A;  3ZSF A;  5BUU A;  1TT1 A;  3S9M C;  3T66 A;  5LOM A;  2HZL A;  1Z7N E;  2O1L A;  2RCB A;  3RNN A;  4OET A;  1HSL A;  3O6H A;  1D9V A;  3A3U A;  4OES A;  5F1Q A;  5CMM A;  4U22 A;  3T9X B;  3KBR A;  2X26 A;  3U8Q A;  3BFT A;  5ITP A;  2XXW A;  2XXU A;  3G3H A;  2DWJ A;  3MJN A;  1MXU A;  4IGR A;  3R26 A;  3EHU A;  1WVJ A;  4DZ1 A;  2B65 A;  3TMG A;  5KCJ A;  3EPE A;  1USY H;  3K01 A;  4N07 A;  1B46 A;  5HM4 B;  1NNK A;  3RQT A;  3TDJ A;  2E1S A;  2XD3 A;  5CBS A;  4G2Z A;  1LLS A;  2PT2 A;  3VFJ A;  5I2N A;  3ZKL A;  4WKM A;  3HN0 A;  1FTJ A;  3O97 A;  3H06 B;  1ZU0 A;  4O3B A;  5H8H A;  3OEL A;  2HFB A;  4N13 A;  3T9V A;  4BDQ A;  4G8N A;  3O29 A;  3LSW A;  4YAH X;  4JWX A;  3W15 C;  1ZKB A;  4FE8 A;  2G29 A;  3C36 A;  2AYS A;  3N6T A;  3N94 A;  3QUJ A;  1B6H A;  2F36 A;  3CIJ A;  1B5J A;  4NF6 A;  5J1D A;  3MC2 A;  2UYF A;  3GBA A;  1N0T A;  1MG1 A;  1FW0 A;  1M5F A;  2DP8 A;  1B5H A;  3RLF E;  3TFL A;  1MY2 A;  2QJE A;  1XVX A;  1H76 A;  2XXH A;  5B7D A;  4GLI A;  2O6A A;  2QSX A;  3OEM A;  1H43 A;  3S9L C;  4LAT A;  2ZXT A;  5TPA B;  1M5E A;  5AA2 B;  1ZLQ A;  3CSG A;  3C9H A;  3MWB A;  3N26 A;  3K4U A;  1ANF A;  3K00 A;  1MM7 A;  3FZV A;  3UIF A;  2ZNS A;  3ILT B;  4BDL A;  5I2K B;  3C33 A;  2I4C A;  3B6T A;  4X9T A;  5FHO A;  1ELJ A;  4DXB A;  3I6V A;  1H3D A;  4IO4 A;  2XXY A;  4QFO A;  1LBB A;  2IEE A;  1Y20 A;  4KCD A;  1NKX A;  5DT6 A;  3TCG A;  3FV2 A;  3FXU A;  4F29 A;  4FOR A;  5H8Q B;  1SW1 A;  4NF8 B;  1JW5 A;  5CC2 A;  2Q89 A;  4OTE A;  1LFH A;  4PP0 A;  4H0W A;  3FVO A;  2R9J A;  4K3F A;  1OQG A;  2ONK E;  4EDP A;  3TTL A;  3PMV A;  1IXI A;  3TPA A;  1II5 A;  2RF1 A;  3OO6 A;  3KFM A;  1R9L A;  4F1V A;  4Z7E A;  1MQJ A;  1MRP A;  3OEN A;  2GHA A;  4FEC A;  2BJJ X;  3MP1 A;  1B3E A;  4IO5 A;  1NL5 A;  4I1D A;  1SYI A;  1YAE A;  1QKB A;  3G3I A;  1MXW A;  3OO8 A;  3TTN A;  1SI1 A;  2AIX A;  4BLA A;  1FQF A;  1M5B A;  1MQG A;  4ELR A;  4U1O A;  1O63 A;  3U93 A;  2Z8D A;  3UK4 A;  2ZYM A;  4FIM A;  4WEP A;  1MPC A;  1EZ9 A;  1B9J A;  1RYX A;  5KCJ B;  4OMB A;  2PT1 A;  3C32 A;  3MVW A;  2REG A;  3CI8 A;  2Z8E A;  5JTY B;  3VDF A;  4MFI A;  3ECR A;  4R72 A;  2GHB A;  1B7Z A;  5I2N B;  4OFL A;  4H5F A;  3E3K A;  3PPP A;  2P0S A;  3GZG A;  4POW A;  4ZED A;  5F7V A;  3C35 A;  1OVT A;  1UIU A;  1EU8 A;  3IOU A;  3O66 A;  3L6G A;  3KN7 A;  5H8H B;  4BDN A;  2DXY A;  4OWD A;  2ANJ A;  5I58 A;  3IR1 A;  4U4S A;  4E0X A;  3TTK A;  4NF5 A;  1JW1 A;  4ONY A;  4F3G A;  3BFU A;  1P99 A;  3IOT A;  1Q35 A;  3VVD A;  2WKY A;  1VFD A;  1FTK A;  4NF6 B;  1DPP A;  3U72 A;  1WOD A;  4GWO A;  3MUQ A;  2PBW A;  3K1N A;  3OO9 A;  1NH7 A;  3FD3 A;  3R7X A;  3GBB A;  4PFU A;  2D21 A;  4H6D A;  3Q25 A;  2F6P A;  4ESW A;  3IB1 A;  2DWH A;  5K2Y A;  2FNC A;  3SEW A;  4ZEF A;  4IGT A;  3PPN A;  5IAI A;  3S9E A;  4BDR A;  4TLM B;  3Q28 A;  4RNS A;  4XKR A;  1NMU A;  3HST A;  2A5S A;  1ZJL A;  2B3B A;  3ILU B;  1Y1M A;  1BKA A;  5H8N B;  3QYT A;  5L9S A;  1AIV A;  2QS2 A;  4ZS9 A;  2E0S A;  1D3K A;  4JSD A;  3DP8 A;  4ESX A;  1OIB A;  2PYY A;  3TCF A;  3FUZ A;  2VGQ A;  2OBG A;  4OZ9 A;  5JEI A;  3FIR A;  3OOA A;  3FVN A;  1AOV A;  2NVU B;  5ICQ A;  4YKK A;  3M8U A;  4G4P A;  4H8I A;  1CB6 A;  3ODB A;  1XHY A;  4OEN A;  3HV1 A;  1S50 A;  3PUW E;  1BTJ A;  2DQV A;  4YIC A;  3JYR A;  2O7U A;  5HBC A;  4QSC A;  2DSF A;  3H6W A;  1QUK A;  1LAX A;  1DMB A;  3RN8 A;  3SES A;  4FJP A;  3Q27 A;  4GXA A;  1XOC A;  4XKP A;  5B70 A;  1PB7 A;  4WXJ A;  2QS3 A;  3MPK A;  4RYA A;  4P11 A;  1B7H A;  4LZ8 A;  3PUZ E;  4LQ2 A;  5JK4 A;  3WAF A;  2XX9 A;  1NFT A;  3Q26 A;  2V3U A;  2V84 A;  1FTL A;  2QRY A;  4F22 A;  3MZ9 A;  3JZJ A;  1LST A;  2Z22 A;  2Y7R A;  4PFY A;  1ZMG A;  3HO7 A;  3BKI B;  4H8J A;  1DTZ A;  1T0K A;  3H03 A;  1B1H A;  5KDT A;  5I59 A;  1B3H A;  2RC7 A;  1NNT A;  3RPW A;  1B2H A;  3LBS A;  1B4Z A;  2H99 A;  4GOT A;  1N76 A;  4KYE A;  1Y3P A;  4KCC A;  4EF1 A;  4ZEI A;  2XXV A;  1URG A;  2Z23 A;  4Q5T A;  2DE2 A;  3FXQ A;  4O3A A;  4F31 B;  5AA2 D;  1MXY A;  1KWH A;  5I58 B;  2UVH A;  2Y7K A;  3K6W A;  1B0L A;  2I4B A;  2LAO A;  4IB2 A;  3UOR A;  1Z7M E;  2O84 X;  2ESN A;  1ZIU A;  4THI A;  5ISU A;  3DP4 A;  2XXR A;  1B0H A;  1POY 1;  3T96 B;  4FAJ A;  2QS4 A;  2XXQ A;  4Q30 B;  3MZ1 A;  4RK9 A;  2V3T A;  2H9B A;  4KR5 A;  1HSJ A;  4ND9 A;  4LVQ A;  3QK6 A;  3SEX A;  4G77 A;  4U21 A;  4WED A;  3FVG A;  2PVU A;  1LGB C;  1SW4 A;  3K02 A;  3RTF B;  3KN8 A;  3LR1 A;  4GF8 A;  1PB9 A;  3KG2 A;  5DTB A;  1GTK A;  2QL3 A;  1QKA A;  5FTH A;  1O7T A;  1SVX B;  3PD9 A;  1MXV A;  1DOT A;  1A8E A;  2VD3 A;  4EQ9 A;  2ALU A;  3PPO A;  4PET A;  3C4M A;  2QS1 A;  3OMB A;  2YJP A;  2Y7I A;  3K6V A;  2Z8F A;  4NMY A;  3SKP A;  4ZEB A;  1A54 A;  5CM6 A;  1ATG A;  4GL0 A;  3T9H B;  2AL4 A;  1P1Q A;  2ZMB A;  4YB5 A;  2R6G E;  3FV1 A;  3IOW A;  1JNF A;  1SBP A;  2I0B A;  2D5W A;  4E0W A;  3CFX A;  4R2F A;  4DCY A;  3D4G A;  4LQ5 A;  3DEL B;  3PUY E;  1N84 A;  1R9Q A;  1M5C A;  2ZNT A;  1XC1 A;  1GVC A;  3IOV A;  1GR2 A;  1ZTY A;  2XXX A;  1UIV A;  1XVY A;  3PD8 A;  3I3V A;  1B51 A;  1P1O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...