4NF6A

Crystal structure of glun1/glun2a ligand-binding domain in complex with glycine and ppda
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
287
structure length
278
Chain Sequence
b'TRLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPVKKVICTGPNHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate receptor ionotropic, NMDA 1
publication title Structural Insights into Competitive Antagonism in NMDA Receptors.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein, receptor
total genus 82
structure length 278
sequence length 287
ec nomenclature
pdb deposition date 2013-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4nf6A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4nf6A02
4I8CA 4MBPA 5K2XA 4GRKA 3ZKKA 1AL3A 1JNFA 1JW1A 4R72A 2HEUA 3FJ7A 3S4UA 1QUIA 3DLNA 2F7AA 4QFPA 3PV0E 1IXCA 2XXPA 2VP1A 1XVXA 4PQJA 1JETA 3TODA 3FGSA 4FEDA 1PB7A 3PPPA 3OEKA 3T66A 3UGWA 3IX1A 3K6XA 3OO8A 5KDTB 3HN0A 4LVQA 3FATA 5DVJA 5I2KB 1B1HA 3JYRA 4F18A 4EDPA 4PFYA 3C34A 4RXLA 2ONSA 3IB0A 4R6YA 3VVFA 5KDTA 2D3IA 5LOMA 2GH9A 2DE3A 5EHSA 3CI8A 4KHZE 1B2HA 4POWA 1CE2A 1DTGA 2Y7RA 2AIXA 3N94A 3K1MA 1LAHE 1PDAA 1EZPA 3A09A 3FZVA 1Z7NE 1MQDA 1QUKA 4OESA 2Z8FA 5H8SA 1US5A 4OETA 3V83A 4ZEDA 1YCJA 2OLBA 5H8HB 5DT6A 3OO9A 4KCDA 4FE8A 4PFWA 3T22A 1IZ1A 4O3AA 1SI0A 4G77A 1B7ZA 3FASA 1Y3PA 4XKNA 1DMBA 5H8HA 1A8EA 3SEYA 2F7CA 1B46A 1B5JA 4ELPA 3E4RA 5F7VA 3UN6A 4I9DA 1BKAA 4IGRA 1FQCA 4G8MA 2I49A 2G29A 2RCAA 3C32A 4FEBA 3IK6B 3TFLA 1B3EA 2V3QA 4GIZA 3H6VA 2O68A 3OOAA 2I4BA 1H44A 4F39A 4E0XA 5CMKA 4JB7A 5CM6A 1IXGA 3Q26A 1D4NA 4XTCQ 3H6UA 3FXUA 3QUJA 2O6AA 2P1SA 3U92A 4QFNA 1B7HA 2DQVA 3VVDA 3ECRA 3FIRA 2XXHA 4MF3A 3I6VA 4AQ4A 2DSFA 2DE2A 3O9PA 3OENA 3ILUB 4EQ9A 1ZJLA 2V93A 3LSXA 4NE4A 2A5SA 1GR2A 4K3FA 1TFDA 4GXSB 1QVSA 3TQLA 4UA8A 3A3UA 1URDA 5ICQA 4OENA 2O1MA 2R9JA 3V8XB 2PYYA 1B5IA 2QRYA 1MQIA 1VSOA 3B6WA 3JZJA 4ZECA 3OEMA 1AIVA 3MVZA 4NWDA 5CRYA 2YJPA 1Y1MA 1NMUA 3ZSFA 2DXYA 2PMSA 5JEIA 5L9MA 1FQAA 4FAJA 3W9VA 4YB7A 3I5OA 1A7LA 1FW0A 1MQHA 3K2DA 4RYAA 1UIVA 3TTRA 4RK2A 1MXYA 5B70A 4NF8B 1SW5A 4OYVA 4YKIA 4Z0IA 4F3SA 1ZLQA 3CRBA 4N13A 4ZE9A 4ZEIA 2DWHA 1MXXA 2RF1A 4NF8A 5CMMA 1QULA 2V25A 1J1NA 3V5AA 4Q8RA 1P1WA 1M5FA 5IKBA 4GQOA 3HCQA 4Q0CA 3K4UA 3MQ9A 3I3VA 1O64A 3PUZE 4R73A 3HHGA 1L5TA 1M5CA 4H6DA 1Y4TA 3KN7A 4YB5A 3QYTA 4NF4B 2Y7IA 4DXBA 1SBPA 2PVUA 5BWJA 4XKPA 4GOTA 3FVNA 3EHUA 3IJOB 1M5DA 4ELRA 3KEIA 2B3FA 1PBQA 3JV9A 1H45A 3H6TA 2O84X 2RINA 1P1OA 4U4SA 1B9JA 4C1TA 1TXFA 5TP9B 5I57B 4IO2A 2QMXA 3ONMA 4G4PA 3B7DA 1LAGE 2H98A 3N26A 4MFIA 3MVWA 4DCXA 4NTLA 5TP9A 4Z7EA 5I57A 3L6GA 3OSQA 3TZAA 1LBBA 1YAEA 2D21A 1FTMA 4QF9A 4F3BA 2H99A 2XXVA 2Z8EA 5FTIA 1M5EA 2CZLA 3RPWA 3KBRA 3RN8A 3VXBA 2H4IA 3PUVE 1NFTA 3Q28A 3PUWE 1WDNA 5KCJB 4OEVA 1ELJA 1GVCA 3TEPA 3RTFB 4BDQA 4QHQA 1ZU0A 3SEVA 1EU8A 2DP8A 3IOTA 5I2NA 4U21A 3B6QA 4G2ZA 3MUQA 5KCJA 2XXRA 1SW2A 3S9LC 3MP6A 1OQGA 1ZTYA 2PBWA 4QFLA 1DOTA 3IB1A 3MP1A 3K6UA 1FQFA 1IXIA 5H8QB 3OMBA 1H76A 4R2BA 4U23A 2ZYOA 4F1YA 4X9TA 1GTKA 2XXTA 1R1NA 4F19A 2B3BA 1H3DA 1N7XA 1I69A 3O97A 2VOZA 1XVYA 4IO6A 4TLMB 1SDXA 3IO6A 1H43A 5H8QA 4H1XA 3T9UA 2F7BA 4KPTA 2OWTA 4X1BA 2HZKA 2VD3A 2OJTA 3IAZA 3K1NA 1FTOA 3K01A 2DWIA 2AL4A 3KOSA 2E1SA 5AA4B 3PPRA 4HTGA 2I6EA 2Q2AA 1ZKBA 3SKPA 4DXCA 5M2VA 1ZBMA 4OFJA 4U2RA 3U72A 3SDFA 4R6HA 5AA4A 1A99A 5AA3A 3UP9A 2I48A 5HBCA 4YKKA 4ZEBA 3TCHA 3RT8A 3PUYE 3M3LA 2DE4A 4IY5A 3HPIA 2ABHA 3ZKLA 1B0LA 3S9MC 1OLCA 3QK6A 1FQBA 3KFMA 3VE1B 4OERA 2ZYMA 4U4XA 4GLIA 3PMVA 4DE8A 3VV5A 2GRVA 1MG1A 4QSDA 1I6QA 3K6WA 3H6WA 5AA1A 3MAMA 1JW5A 1LB8A 3E3KA 2VGQA 1MM6A 1RKMA 4X48A 3VLWA 3M8UA 3CSGA 4DCYA 2HXWA 3TYHA 3U93A 4DZ1A 3C9HA 3PMXA 3WAEA 4OFLA 2YPNA 1P1QA 3HHFA 4THIA 1P1NA 4P0GA 4ZEFA 1IITA 1MXWA 3R26A 1XOCA 4POXA 4R6KA 4YB6A 2RC9A 4H65A 4LZ8A 1SW4A 3C35A 2Y7WA 4F2OA 1BIYA 4RY1A 3MC2A 3G3JA 1WODA 3B6TA 1MM7A 3EF7A 2DS9A 2IEEA 3EPEA 2F78A 3QSLA 4NWCA 1NH8A 4KFQA 2DWJA 1FQDA 3E9XA 3O28A 3QUFA 3C31A 4KR5A 1B3LA 1POTA 4OXVA 3C36A 1MY3A 2DOJA 5DVFA 3DP4A 1B4ZA 1RYXA 3TTMA 3KJTA 5HPQA 3T9HB 3Q25A 1JW4A 3KSJA 2GHAA 4RA1A 3QXMA 3FVOA 3H7MA 1A8FA 1MRPA 3IORA 4MLQA 3RQTA 4U22A 3TCFA 3O66A 3CFXA 3DM0A 4DXUA 4WKMA 1GV8A 2REJA 2DWAA 4Q5TA 1B3HA 2QPQA 4LZ7A 4O3CA 3H06B 2XX8A 2THIA 3E13X 4ISUA 1MXVA 3CG3A 5DYHA 4R9GA 4JSOA 1EZOA 1CB6A 3TQWA 3IR1A 2H25A 1T0KA 2HQ0A 3PPQA 1PB8A 3TTLA 1Q1KA 3U94A 3K00A 4JBZA 3PMWA 2DXRA 4JWYA 1LFHA 1AMFA 1IQ7A 2M8CA 4ELQA 1UIUA 4JXIA 4ESXA 5KZTA 1TT1A 3T9VA 2I3VA 4LATA 2QS2A 3Q29A 4RJZA 1Y3NA 2Y7KA 4LA9A 2D5WA 2NWJA 1FCKA 2RC7A 2REGA 3A3CA 2PX1A 4IO5A 3AXFA 4XIGQ 1B7UA 2AYSA 2Z23A 2ZXTA 5ISUA 4XKRA 4YU0A 4BDLA 3IL1B 3PGFA 4MLVA 3U1OA 3SEWA 3IO4A 3TAJA 3S9EA 3RTWB 2PT1A 3TKDA 3MVYA 4OQOA 4X1DA 4PFUA 3F11A 4IY6A 2OCUA 2V3UA 5FHOA 3FV1A 1R6ZA 1JVXA 1NL5A 1BLFA 3G3IA 4H5FA 2GHBA 1EH3A 4WEPA 2QJEA 3KN8A 4AB5A 2XXYA 1XHYA 1M5BA 4P11A 3GBBA 3L6HA 1HSEA 1XC1A 1Y4CA 2QL3A 4YMAA 3OXNA 3W15C 1I6BA 2R6GE 4C1UA 4BDMA 3TELA 3RNNA 1POY1 3N6UA 1B1XA 1VR5A 4RPOA 3CVGA 4KD5A 3MVXA 1UTBB 5JTYB 1S50A 2F97A 4ZZEA 1B32A 4XKQA 1D9YA 1MQGA 4EF2A 3O29A 1UQWA 3Q27A 1UTHA 1IUDA 1UTBA 5JTYA 3IOUA 2IA4A 1N3WA 5ICTA 2O69A 3KN3A 4LQ2A 4LQ5A 1LCTA 2W7YA 3UORA 5AA2D 3FJMA 4G8NA 1B52A 1FTJA 4FORA 5AE4A 3VFJA 1TWYA 2NUVA 2FNCA 1US4A 3P7IA 5IAIA 4OWDA 4KCCA 4F3GA 5I2NB 3O6IA 4RK9A 2DYXA 4H67A 1YTVA 3LC8A 3LSWA 4M1VA 2LAOA 2F5XA 3OELA 1S7YA 4EQBA 5L8DA 1URSA 1MDP1 4I62A 1PB9A 1F9BA 1OIBA 4HW8A 4H8IA 3RGYA 4GL8A 3LBSA 1QKBA 3T96B 5A5XA 1PC3A 3H03A 3G3FA 4RNSA 3S2VA 3SEXA 4G8HA 5AA2A 4OTEA 2Y84A 3HV1A 3MZ9A 5EYFA 3MW0A 3WAFA 2VHAA 2FYIA 1B6HA 2UYEA 3FVGA 2ANJA 3FXRA 3KJ7A 3FUZA 5H8NB 1NNPA 1NNKA 1MS7A 4ELOA 3DP6A 2O51A 2ZYNA 4ESWA 3S9NC 2I0CA 2UXAA 1JEVA 5ELVA 5H8NA 4QFOA 4F31B 4FECA 4Q30B 2UVGA 3VLVA 1N84A 4M4GA 4ECFA 3C33A 3LR1A 1OMPA 3DELB 4ND9A 3RLFE 3ZS6A 4ZEKA 2ZNUA 2A5TB 1Y3QA 3IOVA 2NVUB 3VXCA 4BDOA 3RUMA 3TTKA 1TFAA 4ZDMA 4ZE8A 3PPNA 2A5TA 1OVBA 1LFGA 5EHMA 3KZGA 5CBSA 2UVHA 3SEUA 4PFTA 1A54A 1PEBA 1LAFE 5K2YA 2DVZA 2Q89A 4LONB 3MZBA 4IO7A 4OHNA 1MY0A 3UA8A 4H8JA 2NOOA 2XXWA 4PE5B 1LSTA 2Z22A 1AH5A 4IB2A 3N5LA 1RYOA 3UK4A 2UVJA 4HCWA 5L9OA 4F1VA 2UYFA 1MXUA 3FJGA 1JQFA 1USYH 3MBPA 4YICA 2RC8A 1ATGA 1VE4A 3IB2A 3T9XB 4YAHX 4YKJA 2ONKE 3CG1A 5FHMA 4GF8A 1R9LA 1QJMA 1SW1A 5CMCA 1MPCA 5DVIA 3C4MA 4NF6B 4IGTA 3VLUA 4OZ9A 5FTHA 4BDNA 3TMGA 1EZ9A 2ZMBA 1SI1A 3MWBA 4XXUA 1II5A 4NF6A 1BP5A 2Y7PA 4MH5A 1B40A 2QS4A 2F36A 2RKMA 4R75A 1B3FA 2CMOA 2ESNA 3QAXA 4FJPA 2O1LA 2HCAA 3OO7A 5I2KA 4UACA 1AOVA 2ZNSA 5TPAB 3TCGA 3EQ1A 4G68B 1DTZA 1HSJA 3K1PA 5TU0A 2V3TA 3UIFA 1Q35A 1MQJA 4GVOA 2QS3A 4EUOA 1GGGA 5ITOA 1ZMGA 3MP8A 4BLAA 4IO3A 4GD5A 2YLNA 3KOTA 4TOZA 5TPAA 3G7WA 4G68A 4R74A 4H0WA 2HFBA 4EF1A 1XS5A 4YZZA 4O3BA 1B3GA 4GWOA 2RCBA 1DPPA 1Y20A 3IJXB 4N6PA 2O7IA 4EXKA 4KI0E 4L17A 1FTLA 3PD9A 5CC2A 1BTJA 2I0BA 3USDA 3CFZA 2I58A 1NKXA 5I59B 5J1DA 1VFEA 2XXQA 3THIA 1Z7ME 1N04A 2H9BA 4G68C 1HSLA 1B51A 1IIWA 2ONRA 2HAVA 4DIGA 1LBCA 3KGCA 2R71A 4TLLB 4E0WA 5I59A 2F35A 2BJJX 4IO4A 1O7TA 2VD2A 3R7XA 3PPOA 3H4ZA 4LUBA 2OBGA 3QIMA 5CBRA 3CFLA 1LLSA 3GBAA 2B65A 5DEXB 1IXHA 3GZGA 3BBRA 1MY2A 3PUXE 4YKPA 3D4CA 1YPNA 4JWXA 2P2AA 3RT6B 2HAUA 1NH7A 4HS7A 4F2QA 3SETA 3G3GA 4H5GA 2OK2A 1LCFA 5DEXA 4OFOA 1SQYA 1SYIA 1R9QA 1MH3A 2E0SA 1LB9A 2F34A 4N07A 4JDFA 2P0SA 3GLBA 1OLAA 5CMBA 1N76A 4P0IA 2X7PA 3CR9A 3O2AA 1FTKA 1Y9UA 1FQEA 3PD8A 3O6GA 1XT8A 2KLFA 4KYSA 4EQ7A 2X7QA 3K0VA 4RPNA 4QFKA 5CI5A 2I4CA 3LSFB 2Z8DA 4FIMA 2I3WA 2F6PA 1MH4A 4OMBA 5JK4A 4GFRA 3DP8A 4BDRA 4WXJA 3BKIB 2X26A 2XXXA 3R6UA 2Q2CA 4ZS9A 3M3KA 4TQUQ 5I58B 3VVEA 4ZZAA 5BUUA 1MXZA 1MPDA 2OZZA 2XX7A 3T93B 2DVCA 1QUJA 3FV2A 1LAXA 4HCYA 1QW0A 3OSRA 3PU5A 2XD2A 2O7UA 5I58A 2V84A 1UTHB 4C0RA 2UVIA 2AL5A 2HZLA 2PT2A 1ZIUA 2XXIA 4NF4A 1ANFA 3OO6A 4JWOA 2FA7A 1OVTA 1NNTA 2ZNTA 3SERA 1I6AA 1B0HA 5DTBA 3GXAA 3LSLA 4QRZA 1D3KA 1A55A 4I1DA 1O63A 3G3HA 4WEDA 3MPLA 1JVYA 4LZ5A 3TPAA 1B5HA 1KWHA 5H8FB 1VFDA 5A5XB 2XD3A 3V89B 2ALUA 3K6VA 2GFEA 3KSXA 1LFIA 3ILTB 1A40A 3MZ1A 5AA2B 1OQHA 4JSDA 3O6HA 3HO7A 3G3KA 3BFTA 3H3GA 5H8FA 3N6TA 2QS1A 1QKAA 1MPBA 4NEDA 2QSXA 4PETA 2NXOA 1JEUA 4NMYA 1PBPA 3KG2A 2OWSA 4KYDA 4R2FA 3HSTA 1Y1ZA 4F22A 1N3XA 4FATA 5FHNA 1B58A 1B4HA 2XX9A 1LGBC 3RY3A 5B7DA 4OVJA 3D4GA 1WVJA 3CIJA 4U1ZA 3BFUA 1MY1A 2F6GA 3IOWA 2F8DA 3FVKA 1SD3A 4QSCA 5ITPA 4KQPA 3TUSA 3FXQA 2Q9TA 4YMBA 3EHSA 1MDQA 5F1QA 2WKYA 1P1UA 3EN3A 1URGA 3M3FA 4GXAA 4LP2B 2XHDA 4QSEA 4OEUA 4F3PA 1B05A 3MPKA 1N7WA 1USYE 1IEJA 2H5YA 3U8QA 1DPEA 2ZYKA 4U1OA 2Q88A 4EXLA 3EHTA 4KYEA 4NF5B 1N0TA 2QMWA 3K02A 2Q8JA 2G93A 3FD3A 4GL0A 1DSNA 1MY4A 4F29A 4DDDA 5L9SA 5I56B 4NF5A 3LUYA 1NNFA 1D9VA 5HM4B 4DLDA 3W9WA 4R9FA 1P99A 3VDFA 3OD7A 3MJNA 3TDJA 3TTNA 5I84A 3SESA 3ODBA 5I56A 1SVXB 1S9TA 1SYHA 4PP0A 3CSBA 4AB6A 4F1UA 2XXUA 4ONYA
chains in the Genus database with same CATH superfamily
4I8CA 2VT5A 4MBPA 5K2XA 4GRKA 3ZKKA 4I40A 1AL3A 4XF5A 1JNFA 4QXDA 1JW1A 4R72A 2HEUA 3FJ7A 3S4UA 1QUIA 3DLNA 2CZKA 2F7AA 4QFPA 3PV0E 1IXCA 4PCDA 2XXPA 4N4UA 2VP1A 1XVXA 4PQJA 1JETA 5IM2A 2QVRA 3TODA 3FGSA 4FEDA 1PB7A 3PPPA 3OEKA 3T66A 3UGWA 3IX1A 3K6XA 3OO8A 5KDTB 4MMPA 3HN0A 4LVQA 3FATA 5DVJA 5I2KB 1B1HA 3JYRA 1Q9DA 4F18A 4EDPA 4PFYA 3C34A 4X04A 4RXLA 2ONSA 3IB0A 4R6YA 3VVFA 5KDTA 2D3IA 5LOMA 2GH9A 2DE3A 3CI8A 5EHSA 4KHZE 1B2HA 4POWA 1CE2A 1DTGA 2Y7RA 2AIXA 3N94A 5F24A 2P3NA 4MX6A 3K1MA 1LAHE 1PDAA 1EZPA 5ET7A 3A09A 3FZVA 1Z7NE 1MQDA 1NV7A 1QUKA 4OESA 2Z8FA 5H8SA 1US5A 4OETA 3V83A 4ZEDA 1YCJA 2OLBA 5H8HB 5DT6A 3OO9A 4KCDA 4FE8A 4PFWA 3T22A 1IZ1A 4O3AA 1IMCA 1G0IA 1SI0A 4G77A 1B7ZA 3FASA 1Y3PA 4XKNA 1DMBA 5H8HA 1A8EA 3SEYA 2F7CA 1B46A 1B5JA 4ELPA 3E4RA 5F7VA 3UN6A 1NI9A 4I9DA 1BKAA 4P47A 4IGRA 1FQCA 4G8MA 2I49A 2G29A 2RCAA 3C32A 4FEBA 3IK6B 4HE0A 1B3EA 3TFLA 1YYZA 2V3QA 4GIZA 3H6VA 2O68A 3OOAA 2I4BA 1H44A 4F39A 4E0XA 2PCRA 5CMKA 4JB7A 5CM6A 1IXGA 1FPGA 3Q26A 1D4NA 4XTCQ 3H6UA 4OVQA 3FXUA 3QUJA 2O6AA 3SZPA 2P1SA 3U92A 4QFNA 1B7HA 2DQVA 3VVDA 3ECRA 3FIRA 2XXHA 4MF3A 1CNQA 3I6VA 4AQ4A 2DSFA 2DE2A 1FSAA 3O9PA 3OENA 3ILUB 4FBPA 4EQ9A 1ZJLA 2V93A 3LSXA 4NE4A 2A5SA 4OVPA 1GR2A 4K3FA 1TFDA 4GXSB 1QVSA 3TQLA 4UA8A 3A3UA 1URDA 5ICQA 4O94A 4OENA 2O1MA 2R9JA 3V8XB 2PYYA 1B5IA 2QRYA 1MQIA 1VSOA 3ISPA 3B6WA 3JZJA 4ZECA 3OEMA 1AIVA 4AS4A 3MVZA 4NWDA 5CRYA 2YJPA 1Y1MA 1NMUA 3ZSFA 2DXYA 2PMSA 5JEIA 5L9MA 1FQAA 2FIXA 4FAJA 3W9VA 4YB7A 3I5OA 4GWZA 1A7LA 1FW0A 1MQHA 4PFIA 3KC1A 3K2DA 1NV4A 4RYAA 1UIVA 3TTRA 4RK2A 1MXYA 5B70A 4NF8B 1SW5A 4OYVA 4YKIA 4Z0IA 3T1BA 4F3SA 1ZLQA 3CRBA 4N13A 2XWOA 4ZE9A 4ZEIA 2DWHA 2MKZA 1KA0A 1MXXA 2RF1A 4NF8A 5CMMA 1QULA 1FBHA 2V25A 1J1NA 3E78A 3V5AA 4Q8RA 1P1WA 1M5FA 5IKBA 4GQOA 3HCQA 4Q0CA 3K4UA 3MQ9A 3I3VA 1O64A 4NQ8A 3PUZE 4R73A 3HHGA 1L5TA 1M5CA 4H6DA 1Y4TA 4P1LA 3KN7A 4YB5A 3QYTA 4NF4B 2Y7IA 4DXBA 1SBPA 2PVUA 5BWJA 4XKPA 4GOTA 3FVNA 3EHUA 3IJOB 3BIGA 1M5DA 4ELRA 3KEIA 4PF6A 5I3SA 2B3FA 1PBQA 3JV9A 4PGPA 1H45A 3H6TA 2O84X 2RINA 1P1OA 4U4SA 5EQ9A 1B9JA 4C1TA 1TXFA 2CZIA 5TP9B 5I57B 4IO2A 4N15A 2QMXA 3ONMA 4G4PA 3B7DA 1LAGE 2H98A 3N26A 4MFIA 3MVWA 4DCXA 4NTLA 5TP9A 2CZHA 4Z7EA 5I57A 4P8BA 3L6GA 3OSQA 3TZAA 1NV2A 5FBPA 1LBBA 1YAEA 2D21A 1FTMA 4QF9A 4F3BA 2H99A 2XXVA 4G61A 2KR0A 2Z8EA 2WBDA 5FTIA 1M5EA 4QBAA 4GX6A 1EYJA 5ET8A 2CZLA 3RPWA 3KBRA 3RN8A 3VXBA 5EYHA 2H4IA 3PUVE 1NFTA 3Q28A 3PUWE 1WDNA 5KCJB 4OEVA 1ELJA 1GVCA 3TEPA 3RTFB 4BDQA 4QHQA 1ZU0A 3SEVA 1EU8A 2DP8A 3IOTA 5I2NA 4U21A 1FPFA 3B6QA 4G2ZA 3MUQA 5KCJA 2XXRA 5LDZA 1SW2A 3S9LC 3MP6A 1OQGA 1ZTYA 2BJIA 4PAKA 4GX4A 4JVCA 2PBWA 4QFLA 1DOTA 3IB1A 3MP1A 3ROJA 3K6UA 1FQFA 1IXIA 5H8QB 3OMBA 1H76A 4R2BA 4U23A 4NN3A 2ZYOA 4F1YA 4NX1A 4X9TA 1GTKA 2XXTA 1R1NA 4F19A 2B3BA 1H3DA 1N7XA 1I69A 3O97A 2VOZA 1XVYA 4IO6A 4TLMB 1SDXA 3IO6A 1H43A 4NAPA 5H8QA 4H1XA 3T9UA 2F7BA 2FBPA 4KPTA 2OWTA 4N91A 4X1BA 2HZKA 2VD3A 2OJTA 3IAZA 3K1NA 1FTOA 3K01A 2DWIA 2AL4A 3KOSA 2E1SA 5AA4B 3PPRA 4HTGA 2I6EA 2Q2AA 1ZKBA 3SKPA 4N6KA 4DXCA 1IMDA 5M2VA 1ZBMA 4OFJA 4U2RA 3U72A 3SDFA 4R6HA 5AA4A 1A99A 5AA3A 1NUWA 3UP9A 2I48A 4PDHA 5HBCA 4YKKA 4ZEBA 3TCHA 3RT8A 3PUYE 3M3LA 2DE4A 4IY5A 3HPIA 2ABHA 3ZKLA 1B0LA 3S9MC 1OLCA 3QK6A 1FQBA 3KFMA 1YZ0A 2DDKA 3VE1B 5EQ7A 4OERA 1FTAA 2ZYMA 4U4XA 4GLIA 1DBZA 3PMVA 4DE8A 3VV5A 2GRVA 1MG1A 4QSDA 1I6QA 3K6WA 3H6WA 5AA1A 3MAMA 1JW5A 1LB8A 3E3KA 2VGQA 1MM6A 1RKMA 4X48A 3VLWA 3M8UA 3CSGA 4DCYA 2HXWA 3TYHA 3U93A 4DZ1A 3C9HA 1EYIA 3PMXA 3LV0A 3WAEA 4OFLA 2YPNA 1P1QA 3HHFA 4THIA 1P1NA 4P0GA 4ZEFA 1IITA 1MXWA 3R26A 1XOCA 4XFEA 4POXA 4R6KA 4PAIA 4YB6A 2KQZA 2RC9A 2Q8MA 4H65A 4LZ8A 1SW4A 3C35A 2Y7WA 4F2OA 1BIYA 4RY1A 3MC2A 3G3JA 1WODA 3B6TA 5ESYA 1MM7A 3EF7A 2DS9A 2IEEA 3EPEA 2F78A 3QSLA 4NWCA 1NH8A 4N8YA 4KFQA 2DWJA 2WEFA 1FQDA 3E9XA 3O28A 3QUFA 3C31A 4PFRA 4KR5A 2GQ1A 1B3LA 1FJ6A 1NV6A 1POTA 4OXVA 3C36A 2HPGA 1MY3A 3B50A 2DOJA 5DVFA 3DP4A 3NOHA 1B4ZA 3EKIA 1RYXA 3TTMA 3KJTA 5HPQA 3T9HB 3Q25A 1JW4A 3KSJA 2GHAA 4OVTA 1NV0A 3QXMA 4RA1A 3FVOA 3H7MA 4GBVA 1A8FA 1FPLA 2FIEA 1MRPA 3IORA 3A29A 4MLQA 4JVIA 3RQTA 4U22A 3TCFA 1NUXA 3O66A 3CFXA 3DM0A 2HHMA 4DXUA 4WKMA 1GV8A 1FPIA 2HXRA 2P3VA 2REJA 2DWAA 2Y5LA 4Q5TA 1K9ZA 1B3HA 2QPQA 1G0HA 4LZ7A 4O3CA 3H06B 2XX8A 2THIA 3E13X 4ISUA 1MXVA 3CG3A 5DYHA 4R9GA 4JSOA 1EZOA 1CB6A 3TQWA 3IR1A 2H25A 4NF0A 4PC9A 1T0KA 2HQ0A 2WX9A 3PPQA 1PB8A 3TTLA 4GWSA 3HFUA 1Q1KA 3U94A 3K00A 5LTCA 3KBZA 4JBZA 3PMWA 2DXRA 4JWYA 1LFHA 1AMFA 1IQ7A 2M8CA 4ELQA 1UIUA 4JXIA 4ESXA 5KZTA 1TT1A 3T9VA 2I3VA 4LATA 2QS2A 3Q29A 4RJZA 1Y3NA 2QFLA 2Y7KA 2D5WA 4LA9A 4MCOA 2NWJA 1FCKA 2RC7A 4I3YA 2REGA 1INPA 3A3CA 2PX1A 5EQAA 4IO5A 3AXFA 1FPDA 4XIGQ 4N8GA 1B7UA 2AYSA 2Z23A 2ZXTA 5ISUA 4XKRA 4YU0A 4BDLA 3IL1B 4HE2A 3LUZA 3PGFA 4MLVA 3U1OA 3SEWA 3IO4A 3TAJA 3S9EA 3RTWB 2PT1A 3TKDA 3MSTA 3MVYA 4OQOA 4X1DA 4PFUA 3F11A 4IY6A 2OCUA 2V3UA 4MEVA 5FHOA 3FV1A 1R6ZA 1JVXA 1NL5A 1BLFA 3G3IA 4H5FA 2GHBA 1EH3A 4WEPA 2QJEA 3KN8A 1LEVA 4AB5A 2XXYA 1IMFA 1XHYA 1LBXA 3U65A 1YXIA 5EQ8A 1M5BA 4P11A 3GBBA 3L6HA 1HSEA 1XC1A 1Y4CA 2QL3A 4YMAA 3OXNA 4HE1A 3W15C 1I6BA 4O7IA 4IR8A 2R6GE 4P9KA 4C1UA 4BDMA 3TELA 3RNNA 1POY1 3N6UA 1B1XA 1VR5A 4RPOA 3CVGA 4KD5A 1FPKA 1QGXA 3MVXA 1UTBB 5JTYB 1S50A 2F97A 1RDYA 4ZZEA 4DI4B 1B32A 4XKQA 1D9YA 1MQGA 4EF2A 3O29A 1UQWA 3Q27A 5IZ1A 1UTHA 1IUDA 1UTBA 5JTYA 3IOUA 2IA4A 1N3WA 5ICTA 2O69A 3KN3A 4LQ2A 4LQ5A 1DCUA 1LCTA 2W7YA 3UORA 5AA2D 3FJMA 4G8NA 1B52A 1FTJA 4FORA 5AE4A 1LBWA 3VFJA 1TWYA 5I7IA 2NUVA 2QVUA 2FNCA 1US4A 3P7IA 5IAIA 4OWDA 4KCCA 4F3GA 5I2NB 3O6IA 1FJ9A 4RK9A 2DYXA 4H67A 4PF8A 1YTVA 3LC8A 3LSWA 4M1VA 4PE3A 2LAOA 2F5XA 3OELA 1S7YA 4EQBA 2PFYA 5L8DA 1URSA 1MDP1 4I62A 1PB9A 4P1EA 1F9BA 1OIBA 4HW8A 5J16A 4H8IA 4MIJA 3RGYA 4GL8A 2VPOA 3LBSA 4GWXA 1QKBA 3T96B 5A5XA 2XWKA 4N81A 1PC3A 3H03A 3G3FA 4MNIA 4RNSA 3S2VA 3SEXA 4G8HA 5AA2A 4OTEA 2Y84A 3HV1A 3MZ9A 4PBQA 5EYFA 3MW0A 3WAFA 2VHAA 2FYIA 1B6HA 2UYEA 3FVGA 2ANJA 3FXRA 1KZ8A 3KJ7A 3FUZA 5H8NB 2FVZA 1NNPA 1FPEA 1NNKA 1MS7A 4ELOA 3DP6A 2O51A 4GWWA 2ZYNA 4ESWA 1FBCA 3S9NC 2ZZXA 2I0CA 2UXAA 1JEVA 5ELVA 2B4MA 5H8NA 4QFOA 4F31B 1BK4A 4FECA 4Q30B 2UVGA 5IGAA 3VLVA 1N84A 4M4GA 4ECFA 3C33A 3LR1A 1OMPA 4GX3A 3DELB 4ND9A 3RLFE 4ZEKA 3ZS6A 2ZNUA 2A5TB 1Y3QA 3IOVA 2NVUB 3VXCA 4BDOA 3RUMA 3TTKA 1TFAA 4ZDMA 4ZE8A 3PPNA 2A5TA 1OVBA 4JVDA 1LFGA 2WYKA 5EHMA 3KZGA 5CBSA 2UVHA 3SEUA 4PFTA 1A54A 2B4LA 1PEBA 1LAFE 1FBGA 5K2YA 2DVZA 2Q89A 4LONB 1D9QA 3MZBA 5IZZA 4IO7A 4OHNA 1MY0A 3UA8A 4MJOA 4OA4A 4H8JA 2NOOA 2F3BA 2XXWA 4PE5B 1LSTA 2Z22A 1AH5A 4N17A 4IB2A 3N5LA 1RYOA 3UK4A 2UVJA 4HCWA 5L9OA 4F1VA 2Q74A 2UYFA 1MXUA 3FJGA 1JQFA 4O8MA 1USYH 3MBPA 4YICA 2RC8A 4O7MA 1ATGA 1VE4A 3IB2A 5A5LA 1NV3A 3T9XB 4YAHX 4YKJA 2ONKE 2V4CA 3CG1A 5FHMA 5DW8A 4GF8A 1R9LA 5IZ3B 4PBHA 1QJMA 3B8BA 1SW1A 5CMCA 1MPCA 4MNPA 5DVIA 2WYPA 3C4MA 5ET6A 4NF6B 5ET5A 4LN5A 4IGTA 2JJKA 3VLUA 4OZ9A 5FTHA 4BDNA 2QVVA 1LBZA 3TMGA 4KXPA 5IZ3A 1EZ9A 2ZMBA 1SI1A 4P3LA 3MWBA 4XXUA 1II5A 1FBPA 4NF6A 1BP5A 2Y7PA 4MHFA 4MH5A 1B40A 2QS4A 4NG7A 3BIHA 2ZZVA 2F36A 3FXBA 2RKMA 1SPIA 4R75A 1B3FA 2CMOA 2ESNA 3QAXA 4FJPA 2FHYA 2O1LA 2XA5A 2HCAA 2VPNA 3OO7A 5I2KA 4UACA 1AWBA 1AOVA 2ZNSA 5TPAB 3TCGA 3EQ1A 4NGUA 4G68B 1DTZA 1HSJA 3K1PA 5TU0A 5T3JA 2V3TA 3UIFA 1Q35A 1MQJA 4GVOA 2QS3A 4EUOA 1GGGA 5ITOA 1ZMGA 3D1RA 3MP8A 4BLAA 4IO3A 1LBYA 4GD5A 2YLNA 3KOTA 4TOZA 5TPAA 3G7WA 4G68A 4R74A 4H0WA 2HFBA 4EF1A 1XS5A 4YZZA 4O3BA 1B3GA 4GWOA 2RCBA 2F3DA 1DPPA 1KA1A 1Y20A 3IJXB 4N6PA 2O7IA 4EXKA 4KI0E 4L17A 1FTLA 3PD9A 5CC2A 1BTJA 2I0BA 3USDA 3CFZA 2I58A 1NKXA 5I59B 5J1DA 1VFEA 2XXQA 3THIA 1Z7ME 2R8TA 1RDZA 1N04A 2H9BA 4G68C 1HSLA 1B51A 1IIWA 2ONRA 2CEXA 2HAVA 2XWIA 4DIGA 1FBEA 1LBCA 3KGCA 4OANA 2R71A 4TLLB 4E0WA 5I59A 2F35A 2BJJX 4IO4A 1O7TA 5I5PA 1IMEA 2VD2A 3PPOA 3R7XA 3H4ZA 4LUBA 2OBGA 4PFBA 3QIMA 5CBRA 3CFLA 3RYDA 1NUZA 1LLSA 2XXKA 3GBAA 2B65A 5DEXB 1IXHA 3GZGA 3GYYA 3BBRA 1MY2A 2XWVA 3PUXE 4YKPA 3D4CA 1YPNA 4JWXA 2P2AA 3RT6B 2HAUA 1NH7A 4HXVA 4HS7A 4F2QA 3SETA 1RDXA 3G3GA 4H5GA 2OK2A 4GWYA 1LCFA 3PTYA 5DEXA 4PAFA 4OFOA 1SQYA 1SYIA 1R9QA 1MH3A 2E0SA 2L5VA 1LB9A 2F34A 4N07A 4JDFA 2P0SA 3GLBA 1OLAA 4DI3D 5CMBA 1N76A 4P0IA 1FBDA 1NV5A 2X7PA 3CR9A 2WBBA 3CHGA 3O2AA 1FTKA 1Y9UA 1FQEA 3PD8A 3O6GA 1XT8A 3E79A 2KLFA 4KYSA 4EQ7A 2X7QA 3K0VA 4RPNA 4QFKA 4I3EA 5CI5A 2I4CA 3LSFB 2Z8DA 4FIMA 2I3WA 2F6PA 3FBPA 4OVSA 1MH4A 4OMBA 5JK4A 4GFRA 3DP8A 4BDRA 4WXJA 3BKIB 2X26A 2XXXA 3R6UA 2Q2CA 4AS5A 4ZS9A 3M3KA 4TQUQ 5I58B 3VVEA 4ZZAA 5EYGA 5BUUA 1MXZA 4H45A 1MPDA 2OZZA 2XX7A 3T93B 2DVCA 1QUJA 1FPBA 3FV2A 1JP4A 1LAXA 4HCYA 1QW0A 3OSRA 3PU5A 2XD2A 2O7UA 5I58A 2V84A 1UTHB 4N6DA 4C0RA 2UVIA 2Y5KA 2AL5A 2HZLA 2PFZA 2PT2A 4MNCA 4OVRA 1ZIUA 2XXIA 4NF4A 1ANFA 3OO6A 4JWOA 2FA7A 1OVTA 1NNTA 2ZNTA 3SERA 1I6AA 1B0HA 5DTBA 1K9YA 3GXAA 3LSLA 4QRZA 1D3KA 1A55A 4I1DA 4UABA 1O63A 3G3HA 4WEDA 3MPLA 1JVYA 4LZ5A 3RPLB 3TPAA 1B5HA 4X8RA 1KWHA 2OX3A 5H8FB 3IFCA 1VFDA 5A5XB 2XD3A 2ZZWA 3V89B 2ALUA 4PDDA 3K6VA 3RPLA 2GFEA 3KSXA 1LFIA 3ILTB 1A40A 3MZ1A 5AA2B 4MAGA 1OQHA 4JSDA 3O6HA 3HO7A 3G3KA 4H46A 3BFTA 3H3GA 5H8FA 3N6TA 2QS1A 1QKAA 1MPBA 1EYKA 4NEDA 2QSXA 4PETA 2NXOA 1JEUA 3T0JA 4NMYA 1LBVA 1PBPA 3KG2A 2OWSA 4KYDA 4R2FA 3HSTA 1Y1ZA 4F22A 1NV1A 1NUYA 1N3XA 4FATA 5FHNA 1B58A 1B4HA 2XX9A 1LGBC 3RY3A 5B7DA 4OVJA 3D4GA 1WVJA 3CIJA 4U1ZA 4XEQA 3BFUA 1MY1A 2F6GA 3IOWA 2F8DA 3FVKA 3MYUA 1SD3A 4QSCA 5ITPA 4KQPA 3TUSA 3FXQA 2Q9TA 4YMBA 3EHSA 4PTKA 1MDQA 2OWZA 5F1QA 2WKYA 1FRPA 1P1UA 3EN3A 1URGA 3M3FA 4GXAA 4LP2B 2XHDA 4QSEA 4OEUA 4F3PA 1B05A 3MPKA 1N7WA 1USYE 1IEJA 2H5YA 3U8QA 1DPEA 4NHBA 1DK4A 2ZYKA 4U1OA 2Q88A 1IMAA 1FPJA 4EXLA 3EHTA 4KYEA 4NF5B 1N0TA 3IFAA 2QMWA 1VDWA 3K02A 3QMFA 2Q8JA 4GBWA 2G93A 3FD3A 4GL0A 1DSNA 1MY4A 4F29A 1XI6A 4DDDA 5L9SA 5I56B 4P56A 4NF5A 3LUYA 1IMBA 1NNFA 1D9VA 2CEYA 5HM4B 4DLDA 3W9WA 4R9FA 1P99A 3VDFA 3OD7A 3MJNA 3TDJA 4GWUA 3TTNA 5I84A 4PGNA 3SESA 3ODBA 5I56A 3KC0A 1SVXB 1S9TA 1SYHA 4PP0A 3CSBA 4AB6A 4F1UA 2XXUA 1FBFA 4ONYA
chains in the Genus database with same CATH topology
4I8CA 4MBPA 5K2XA 4GRKA 3ZKKA 1AL3A 1JNFA 1JW1A 4R72A 2HEUA 3FJ7A 3S4UA 1QUIA 3DLNA 2F7AA 4QFPA 3PV0E 1IXCA 2XXPA 2VP1A 1XVXA 4PQJA 1JETA 3TODA 3FGSA 4FEDA 1PB7A 3PPPA 3OEKA 3T66A 3UGWA 3IX1A 3K6XA 3OO8A 5KDTB 3HN0A 4LVQA 3FATA 5DVJA 5I2KB 1B1HA 3JYRA 4F18A 4EDPA 4PFYA 3C34A 4RXLA 2ONSA 3IB0A 4R6YA 3VVFA 5KDTA 2D3IA 5LOMA 2GH9A 2DE3A 5EHSA 3CI8A 4KHZE 1B2HA 4POWA 1CE2A 1DTGA 2Y7RA 2AIXA 3N94A 3K1MA 1LAHE 1PDAA 1EZPA 3A09A 3FZVA 1Z7NE 1MQDA 1QUKA 4OESA 2Z8FA 5H8SA 1US5A 4OETA 3V83A 4ZEDA 1YCJA 2OLBA 5H8HB 5DT6A 3OO9A 4KCDA 4FE8A 4PFWA 3T22A 1IZ1A 4O3AA 1SI0A 4G77A 1B7ZA 3FASA 1Y3PA 4XKNA 1DMBA 5H8HA 1A8EA 3SEYA 2F7CA 1B46A 1B5JA 4ELPA 3E4RA 5F7VA 3UN6A 4I9DA 1BKAA 4IGRA 1FQCA 4G8MA 2I49A 2G29A 2RCAA 3C32A 4FEBA 3IK6B 3TFLA 1B3EA 2V3QA 4GIZA 3H6VA 2O68A 3OOAA 2I4BA 1H44A 4F39A 4E0XA 5CMKA 4JB7A 5CM6A 1IXGA 3Q26A 1D4NA 4XTCQ 3H6UA 3FXUA 3QUJA 2O6AA 2P1SA 3U92A 4QFNA 1B7HA 2DQVA 3VVDA 3ECRA 3FIRA 2XXHA 4MF3A 3I6VA 4AQ4A 2DSFA 2DE2A 3O9PA 3OENA 3ILUB 4EQ9A 1ZJLA 2V93A 3LSXA 4NE4A 2A5SA 1GR2A 4K3FA 1TFDA 4GXSB 1QVSA 3TQLA 4UA8A 3A3UA 1URDA 5ICQA 4OENA 2O1MA 2R9JA 3V8XB 2PYYA 1B5IA 2QRYA 1MQIA 1VSOA 3B6WA 3JZJA 4ZECA 3OEMA 1AIVA 3MVZA 4NWDA 5CRYA 2YJPA 1Y1MA 1NMUA 3ZSFA 2DXYA 2PMSA 5JEIA 5L9MA 1FQAA 4FAJA 3W9VA 4YB7A 3I5OA 1A7LA 1FW0A 1MQHA 3K2DA 4RYAA 1UIVA 3TTRA 4RK2A 1MXYA 5B70A 4NF8B 1SW5A 4OYVA 4YKIA 4Z0IA 4F3SA 1ZLQA 3CRBA 4N13A 4ZE9A 4ZEIA 2DWHA 1MXXA 2RF1A 4NF8A 5CMMA 1QULA 2V25A 1J1NA 3V5AA 4Q8RA 1P1WA 1M5FA 5IKBA 4GQOA 3HCQA 4Q0CA 3K4UA 3MQ9A 3I3VA 1O64A 3PUZE 4R73A 3HHGA 1L5TA 1M5CA 4H6DA 1Y4TA 3KN7A 4YB5A 3QYTA 4NF4B 2Y7IA 4DXBA 1SBPA 2PVUA 5BWJA 4XKPA 4GOTA 3FVNA 3EHUA 3IJOB 1M5DA 4ELRA 3KEIA 2B3FA 1PBQA 3JV9A 1H45A 3H6TA 2O84X 2RINA 1P1OA 4U4SA 1B9JA 4C1TA 1TXFA 5TP9B 5I57B 4IO2A 2QMXA 3ONMA 4G4PA 3B7DA 1LAGE 2H98A 3N26A 4MFIA 3MVWA 4DCXA 4NTLA 5TP9A 4Z7EA 5I57A 3L6GA 3OSQA 3TZAA 1LBBA 1YAEA 2D21A 1FTMA 4QF9A 4F3BA 2H99A 2XXVA 2Z8EA 5FTIA 1M5EA 2CZLA 3RPWA 3KBRA 3RN8A 3VXBA 2H4IA 3PUVE 1NFTA 3Q28A 3PUWE 1WDNA 5KCJB 4OEVA 1ELJA 1GVCA 3TEPA 3RTFB 4BDQA 4QHQA 1ZU0A 3SEVA 1EU8A 2DP8A 3IOTA 5I2NA 4U21A 3B6QA 4G2ZA 3MUQA 5KCJA 2XXRA 1SW2A 3S9LC 3MP6A 1OQGA 1ZTYA 2PBWA 4QFLA 1DOTA 3IB1A 3MP1A 3K6UA 1FQFA 1IXIA 5H8QB 3OMBA 1H76A 4R2BA 4U23A 2ZYOA 4F1YA 4X9TA 1GTKA 2XXTA 1R1NA 4F19A 2B3BA 1H3DA 1N7XA 1I69A 3O97A 2VOZA 1XVYA 4IO6A 4TLMB 1SDXA 3IO6A 1H43A 5H8QA 4H1XA 3T9UA 2F7BA 4KPTA 2OWTA 4X1BA 2HZKA 2VD3A 2OJTA 3IAZA 3K1NA 1FTOA 3K01A 2DWIA 2AL4A 3KOSA 2E1SA 5AA4B 3PPRA 4HTGA 2I6EA 2Q2AA 1ZKBA 3SKPA 4DXCA 5M2VA 1ZBMA 4OFJA 4U2RA 3U72A 3SDFA 4R6HA 5AA4A 1A99A 5AA3A 3UP9A 2I48A 5HBCA 4YKKA 4ZEBA 3TCHA 3RT8A 3PUYE 3M3LA 2DE4A 4IY5A 3HPIA 2ABHA 3ZKLA 1B0LA 3S9MC 1OLCA 3QK6A 1FQBA 3KFMA 3VE1B 4OERA 2ZYMA 4U4XA 4GLIA 3PMVA 4DE8A 3VV5A 2GRVA 1MG1A 4QSDA 1I6QA 3K6WA 3H6WA 5AA1A 3MAMA 1JW5A 1LB8A 3E3KA 2VGQA 1MM6A 1RKMA 4X48A 3VLWA 3M8UA 3CSGA 4DCYA 2HXWA 3TYHA 3U93A 4DZ1A 3C9HA 3PMXA 3WAEA 4OFLA 2YPNA 1P1QA 3HHFA 4THIA 1P1NA 4P0GA 4ZEFA 1IITA 1MXWA 3R26A 1XOCA 4POXA 4R6KA 4YB6A 2RC9A 4H65A 4LZ8A 1SW4A 3C35A 2Y7WA 4F2OA 1BIYA 4RY1A 3MC2A 3G3JA 1WODA 3B6TA 1MM7A 3EF7A 2DS9A 2IEEA 3EPEA 2F78A 3QSLA 4NWCA 1NH8A 4KFQA 2DWJA 1FQDA 3E9XA 3O28A 3QUFA 3C31A 4KR5A 1B3LA 1POTA 4OXVA 3C36A 1MY3A 2DOJA 5DVFA 3DP4A 1B4ZA 1RYXA 3TTMA 3KJTA 5HPQA 3T9HB 3Q25A 1JW4A 3KSJA 2GHAA 4RA1A 3QXMA 3FVOA 3H7MA 1A8FA 1MRPA 3IORA 4MLQA 3RQTA 4U22A 3TCFA 3O66A 3CFXA 3DM0A 4DXUA 4WKMA 1GV8A 2REJA 2DWAA 4Q5TA 1B3HA 2QPQA 4LZ7A 4O3CA 3H06B 2XX8A 2THIA 3E13X 4ISUA 1MXVA 3CG3A 5DYHA 4R9GA 4JSOA 1EZOA 1CB6A 3TQWA 3IR1A 2H25A 1T0KA 2HQ0A 3PPQA 1PB8A 3TTLA 1Q1KA 3U94A 3K00A 4JBZA 3PMWA 2DXRA 4JWYA 1LFHA 1AMFA 1IQ7A 2M8CA 4ELQA 1UIUA 4JXIA 4ESXA 5KZTA 1TT1A 3T9VA 2I3VA 4LATA 2QS2A 3Q29A 4RJZA 1Y3NA 2Y7KA 4LA9A 2D5WA 2NWJA 1FCKA 2RC7A 2REGA 3A3CA 2PX1A 4IO5A 3AXFA 4XIGQ 1B7UA 2AYSA 2Z23A 2ZXTA 5ISUA 4XKRA 4YU0A 4BDLA 3IL1B 3PGFA 4MLVA 3U1OA 3SEWA 3IO4A 3TAJA 3S9EA 3RTWB 2PT1A 3TKDA 3MVYA 4OQOA 4X1DA 4PFUA 3F11A 4IY6A 2OCUA 2V3UA 5FHOA 3FV1A 1R6ZA 1JVXA 1NL5A 1BLFA 3G3IA 4H5FA 2GHBA 1EH3A 4WEPA 2QJEA 3KN8A 4AB5A 2XXYA 1XHYA 1M5BA 4P11A 3GBBA 3L6HA 1HSEA 1XC1A 1Y4CA 2QL3A 4YMAA 3OXNA 3W15C 1I6BA 2R6GE 4C1UA 4BDMA 3TELA 3RNNA 1POY1 3N6UA 1B1XA 1VR5A 4RPOA 3CVGA 4KD5A 3MVXA 1UTBB 5JTYB 1S50A 2F97A 4ZZEA 1B32A 4XKQA 1D9YA 1MQGA 4EF2A 3O29A 1UQWA 3Q27A 1UTHA 1IUDA 1UTBA 5JTYA 3IOUA 2IA4A 1N3WA 5ICTA 2O69A 3KN3A 4LQ2A 4LQ5A 1LCTA 2W7YA 3UORA 5AA2D 3FJMA 4G8NA 1B52A 1FTJA 4FORA 5AE4A 3VFJA 1TWYA 2NUVA 2FNCA 1US4A 3P7IA 5IAIA 4OWDA 4KCCA 4F3GA 5I2NB 3O6IA 4RK9A 2DYXA 4H67A 1YTVA 3LC8A 3LSWA 4M1VA 2LAOA 2F5XA 3OELA 1S7YA 4EQBA 5L8DA 1URSA 1MDP1 4I62A 1PB9A 1F9BA 1OIBA 4HW8A 4H8IA 3RGYA 4GL8A 3LBSA 1QKBA 3T96B 5A5XA 1PC3A 3H03A 3G3FA 4RNSA 3S2VA 3SEXA 4G8HA 5AA2A 4OTEA 2Y84A 3HV1A 3MZ9A 5EYFA 3MW0A 3WAFA 2VHAA 2FYIA 1B6HA 2UYEA 3FVGA 2ANJA 3FXRA 3KJ7A 3FUZA 5H8NB 1NNPA 1NNKA 1MS7A 4ELOA 3DP6A 2O51A 2ZYNA 4ESWA 3S9NC 2I0CA 2UXAA 1JEVA 5ELVA 5H8NA 4QFOA 4F31B 4FECA 4Q30B 2UVGA 3VLVA 1N84A 4M4GA 4ECFA 3C33A 3LR1A 1OMPA 3DELB 4ND9A 3RLFE 3ZS6A 4ZEKA 2ZNUA 2A5TB 1Y3QA 3IOVA 2NVUB 3VXCA 4BDOA 3RUMA 3TTKA 1TFAA 4ZDMA 4ZE8A 3PPNA 2A5TA 1OVBA 1LFGA 5EHMA 3KZGA 5CBSA 2UVHA 3SEUA 4PFTA 1A54A 1PEBA 1LAFE 5K2YA 2DVZA 2Q89A 4LONB 3MZBA 4IO7A 4OHNA 1MY0A 3UA8A 4H8JA 2NOOA 2XXWA 4PE5B 1LSTA 2Z22A 1AH5A 4IB2A 3N5LA 1RYOA 3UK4A 2UVJA 4HCWA 5L9OA 4F1VA 2UYFA 1MXUA 3FJGA 1JQFA 1USYH 3MBPA 4YICA 2RC8A 1ATGA 1VE4A 3IB2A 3T9XB 4YAHX 4YKJA 2ONKE 3CG1A 5FHMA 4GF8A 1R9LA 1QJMA 1SW1A 5CMCA 1MPCA 5DVIA 3C4MA 4NF6B 4IGTA 3VLUA 4OZ9A 5FTHA 4BDNA 3TMGA 1EZ9A 2ZMBA 1SI1A 3MWBA 4XXUA 1II5A 4NF6A 1BP5A 2Y7PA 4MH5A 1B40A 2QS4A 2F36A 2RKMA 4R75A 1B3FA 2CMOA 2ESNA 3QAXA 4FJPA 2O1LA 2HCAA 3OO7A 5I2KA 4UACA 1AOVA 2ZNSA 5TPAB 3TCGA 3EQ1A 4G68B 1DTZA 1HSJA 3K1PA 5TU0A 2V3TA 3UIFA 1Q35A 1MQJA 4GVOA 2QS3A 4EUOA 1GGGA 5ITOA 1ZMGA 3MP8A 4BLAA 4IO3A 4GD5A 2YLNA 3KOTA 4TOZA 5TPAA 3G7WA 4G68A 4R74A 4H0WA 2HFBA 4EF1A 1XS5A 4YZZA 4O3BA 1B3GA 4GWOA 2RCBA 1DPPA 1Y20A 3IJXB 4N6PA 2O7IA 4EXKA 4KI0E 4L17A 1FTLA 3PD9A 5CC2A 1BTJA 2I0BA 3USDA 3CFZA 2I58A 1NKXA 5I59B 5J1DA 1VFEA 2XXQA 3THIA 1Z7ME 1N04A 2H9BA 4G68C 1HSLA 1B51A 1IIWA 2ONRA 2HAVA 4DIGA 1LBCA 3KGCA 2R71A 4TLLB 4E0WA 5I59A 2F35A 2BJJX 4IO4A 1O7TA 2VD2A 3R7XA 3PPOA 3H4ZA 4LUBA 2OBGA 3QIMA 5CBRA 3CFLA 1LLSA 3GBAA 2B65A 5DEXB 1IXHA 3GZGA 3BBRA 1MY2A 3PUXE 4YKPA 3D4CA 1YPNA 4JWXA 2P2AA 3RT6B 2HAUA 1NH7A 4HS7A 4F2QA 3SETA 3G3GA 4H5GA 2OK2A 1LCFA 5DEXA 4OFOA 1SQYA 1SYIA 1R9QA 1MH3A 2E0SA 1LB9A 2F34A 4N07A 4JDFA 2P0SA 3GLBA 1OLAA 5CMBA 1N76A 4P0IA 2X7PA 3CR9A 3O2AA 1FTKA 1Y9UA 1FQEA 3PD8A 3O6GA 1XT8A 2KLFA 4KYSA 4EQ7A 2X7QA 3K0VA 4RPNA 4QFKA 5CI5A 2I4CA 3LSFB 2Z8DA 4FIMA 2I3WA 2F6PA 1MH4A 4OMBA 5JK4A 4GFRA 3DP8A 4BDRA 4WXJA 3BKIB 2X26A 2XXXA 3R6UA 2Q2CA 4ZS9A 3M3KA 4TQUQ 5I58B 3VVEA 4ZZAA 5BUUA 1MXZA 1MPDA 2OZZA 2XX7A 3T93B 2DVCA 1QUJA 3FV2A 1LAXA 4HCYA 1QW0A 3OSRA 3PU5A 2XD2A 2O7UA 5I58A 2V84A 1UTHB 4C0RA 2UVIA 2AL5A 2HZLA 2PT2A 1ZIUA 2XXIA 4NF4A 1ANFA 3OO6A 4JWOA 2FA7A 1OVTA 1NNTA 2ZNTA 3SERA 1I6AA 1B0HA 5DTBA 3GXAA 3LSLA 4QRZA 1D3KA 1A55A 4I1DA 1O63A 3G3HA 4WEDA 3MPLA 1JVYA 4LZ5A 3TPAA 1B5HA 1KWHA 5H8FB 1VFDA 5A5XB 2XD3A 3V89B 2ALUA 3K6VA 2GFEA 3KSXA 1LFIA 3ILTB 1A40A 3MZ1A 5AA2B 1OQHA 4JSDA 3O6HA 3HO7A 3G3KA 3BFTA 3H3GA 5H8FA 3N6TA 2QS1A 1QKAA 1MPBA 4NEDA 2QSXA 4PETA 2NXOA 1JEUA 4NMYA 1PBPA 3KG2A 2OWSA 4KYDA 4R2FA 3HSTA 1Y1ZA 4F22A 1N3XA 4FATA 5FHNA 1B58A 1B4HA 2XX9A 1LGBC 3RY3A 5B7DA 4OVJA 3D4GA 1WVJA 3CIJA 4U1ZA 3BFUA 1MY1A 2F6GA 3IOWA 2F8DA 3FVKA 1SD3A 4QSCA 5ITPA 4KQPA 3TUSA 3FXQA 2Q9TA 4YMBA 3EHSA 1MDQA 5F1QA 2WKYA 1P1UA 3EN3A 1URGA 3M3FA 4GXAA 4LP2B 2XHDA 4QSEA 4OEUA 4F3PA 1B05A 3MPKA 1N7WA 1USYE 1IEJA 2H5YA 3U8QA 1DPEA 2ZYKA 4U1OA 2Q88A 4EXLA 3EHTA 4KYEA 4NF5B 1N0TA 2QMWA 3K02A 2Q8JA 2G93A 3FD3A 4GL0A 1DSNA 1MY4A 4F29A 4DDDA 5L9SA 5I56B 4NF5A 3LUYA 1NNFA 1D9VA 5HM4B 4DLDA 3W9WA 4R9FA 1P99A 3VDFA 3OD7A 3MJNA 3TDJA 3TTNA 5I84A 3SESA 3ODBA 5I56A 1SVXB 1S9TA 1SYHA 4PP0A 3CSBA 4AB6A 4F1UA 2XXUA 4ONYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I8C A;  4MBP A;  5K2X A;  4GRK A;  3ZKK A;  1AL3 A;  1JNF A;  1JW1 A;  4R72 A;  2HEU A;  3FJ7 A;  3S4U A;  1QUI A;  3DLN A;  2F7A A;  4QFP A;  3PV0 E;  1IXC A;  2XXP A;  2VP1 A;  1XVX A;  4PQJ A;  1JET A;  3TOD A;  3FGS A;  4FED A;  1PB7 A;  3PPP A;  3OEK A;  3T66 A;  3UGW A;  3IX1 A;  3K6X A;  3OO8 A;  5KDT B;  3HN0 A;  4LVQ A;  3FAT A;  5DVJ A;  5I2K B;  1B1H A;  3JYR A;  4F18 A;  4EDP A;  4PFY A;  3C34 A;  4RXL A;  2ONS A;  3IB0 A;  4R6Y A;  3VVF A;  5KDT A;  2D3I A;  5LOM A;  2GH9 A;  2DE3 A;  5EHS A;  3CI8 A;  4KHZ E;  1B2H A;  4POW A;  1CE2 A;  1DTG A;  2Y7R A;  2AIX A;  3N94 A;  3K1M A;  1LAH E;  1PDA A;  1EZP A;  3A09 A;  3FZV A;  1Z7N E;  1MQD A;  1QUK A;  4OES A;  2Z8F A;  5H8S A;  1US5 A;  4OET A;  3V83 A;  4ZED A;  1YCJ A;  2OLB A;  5H8H B;  5DT6 A;  3OO9 A;  4KCD A;  4FE8 A;  4PFW A;  3T22 A;  1IZ1 A;  4O3A A;  1SI0 A;  4G77 A;  1B7Z A;  3FAS A;  1Y3P A;  4XKN A;  1DMB A;  5H8H A;  1A8E A;  3SEY A;  2F7C A;  1B46 A;  1B5J A;  4ELP A;  3E4R A;  5F7V A;  3UN6 A;  4I9D A;  1BKA A;  4IGR A;  1FQC A;  4G8M A;  2I49 A;  2G29 A;  2RCA A;  3C32 A;  4FEB A;  3IK6 B;  3TFL A;  1B3E A;  2V3Q A;  4GIZ A;  3H6V A;  2O68 A;  3OOA A;  2I4B A;  1H44 A;  4F39 A;  4E0X A;  5CMK A;  4JB7 A;  5CM6 A;  1IXG A;  3Q26 A;  1D4N A;  4XTC Q;  3H6U A;  3FXU A;  3QUJ A;  2O6A A;  2P1S A;  3U92 A;  4QFN A;  1B7H A;  2DQV A;  3VVD A;  3ECR A;  3FIR A;  2XXH A;  4MF3 A;  3I6V A;  4AQ4 A;  2DSF A;  2DE2 A;  3O9P A;  3OEN A;  3ILU B;  4EQ9 A;  1ZJL A;  2V93 A;  3LSX A;  4NE4 A;  2A5S A;  1GR2 A;  4K3F A;  1TFD A;  4GXS B;  1QVS A;  3TQL A;  4UA8 A;  3A3U A;  1URD A;  5ICQ A;  4OEN A;  2O1M A;  2R9J A;  3V8X B;  2PYY A;  1B5I A;  2QRY A;  1MQI A;  1VSO A;  3B6W A;  3JZJ A;  4ZEC A;  3OEM A;  1AIV A;  3MVZ A;  4NWD A;  5CRY A;  2YJP A;  1Y1M A;  1NMU A;  3ZSF A;  2DXY A;  2PMS A;  5JEI A;  5L9M A;  1FQA A;  4FAJ A;  3W9V A;  4YB7 A;  3I5O A;  1A7L A;  1FW0 A;  1MQH A;  3K2D A;  4RYA A;  1UIV A;  3TTR A;  4RK2 A;  1MXY A;  5B70 A;  4NF8 B;  1SW5 A;  4OYV A;  4YKI A;  4Z0I A;  4F3S A;  1ZLQ A;  3CRB A;  4N13 A;  4ZE9 A;  4ZEI A;  2DWH A;  1MXX A;  2RF1 A;  4NF8 A;  5CMM A;  1QUL A;  2V25 A;  1J1N A;  3V5A A;  4Q8R A;  1P1W A;  1M5F A;  5IKB A;  4GQO A;  3HCQ A;  4Q0C A;  3K4U A;  3MQ9 A;  3I3V A;  1O64 A;  3PUZ E;  4R73 A;  3HHG A;  1L5T A;  1M5C A;  4H6D A;  1Y4T A;  3KN7 A;  4YB5 A;  3QYT A;  4NF4 B;  2Y7I A;  4DXB A;  1SBP A;  2PVU A;  5BWJ A;  4XKP A;  4GOT A;  3FVN A;  3EHU A;  3IJO B;  1M5D A;  4ELR A;  3KEI A;  2B3F A;  1PBQ A;  3JV9 A;  1H45 A;  3H6T A;  2O84 X;  2RIN A;  1P1O A;  4U4S A;  1B9J A;  4C1T A;  1TXF A;  5TP9 B;  5I57 B;  4IO2 A;  2QMX A;  3ONM A;  4G4P A;  3B7D A;  1LAG E;  2H98 A;  3N26 A;  4MFI A;  3MVW A;  4DCX A;  4NTL A;  5TP9 A;  4Z7E A;  5I57 A;  3L6G A;  3OSQ A;  3TZA A;  1LBB A;  1YAE A;  2D21 A;  1FTM A;  4QF9 A;  4F3B A;  2H99 A;  2XXV A;  2Z8E A;  5FTI A;  1M5E A;  2CZL A;  3RPW A;  3KBR A;  3RN8 A;  3VXB A;  2H4I A;  3PUV E;  1NFT A;  3Q28 A;  3PUW E;  1WDN A;  5KCJ B;  4OEV A;  1ELJ A;  1GVC A;  3TEP A;  3RTF B;  4BDQ A;  4QHQ A;  1ZU0 A;  3SEV A;  1EU8 A;  2DP8 A;  3IOT A;  5I2N A;  4U21 A;  3B6Q A;  4G2Z A;  3MUQ A;  5KCJ A;  2XXR A;  1SW2 A;  3S9L C;  3MP6 A;  1OQG A;  1ZTY A;  2PBW A;  4QFL A;  1DOT A;  3IB1 A;  3MP1 A;  3K6U A;  1FQF A;  1IXI A;  5H8Q B;  3OMB A;  1H76 A;  4R2B A;  4U23 A;  2ZYO A;  4F1Y A;  4X9T A;  1GTK A;  2XXT A;  1R1N A;  4F19 A;  2B3B A;  1H3D A;  1N7X A;  1I69 A;  3O97 A;  2VOZ A;  1XVY A;  4IO6 A;  4TLM B;  1SDX A;  3IO6 A;  1H43 A;  5H8Q A;  4H1X A;  3T9U A;  2F7B A;  4KPT A;  2OWT A;  4X1B A;  2HZK A;  2VD3 A;  2OJT A;  3IAZ A;  3K1N A;  1FTO A;  3K01 A;  2DWI A;  2AL4 A;  3KOS A;  2E1S A;  5AA4 B;  3PPR A;  4HTG A;  2I6E A;  2Q2A A;  1ZKB A;  3SKP A;  4DXC A;  5M2V A;  1ZBM A;  4OFJ A;  4U2R A;  3U72 A;  3SDF A;  4R6H A;  5AA4 A;  1A99 A;  5AA3 A;  3UP9 A;  2I48 A;  5HBC A;  4YKK A;  4ZEB A;  3TCH A;  3RT8 A;  3PUY E;  3M3L A;  2DE4 A;  4IY5 A;  3HPI A;  2ABH A;  3ZKL A;  1B0L A;  3S9M C;  1OLC A;  3QK6 A;  1FQB A;  3KFM A;  3VE1 B;  4OER A;  2ZYM A;  4U4X A;  4GLI A;  3PMV A;  4DE8 A;  3VV5 A;  2GRV A;  1MG1 A;  4QSD A;  1I6Q A;  3K6W A;  3H6W A;  5AA1 A;  3MAM A;  1JW5 A;  1LB8 A;  3E3K A;  2VGQ A;  1MM6 A;  1RKM A;  4X48 A;  3VLW A;  3M8U A;  3CSG A;  4DCY A;  2HXW A;  3TYH A;  3U93 A;  4DZ1 A;  3C9H A;  3PMX A;  3WAE A;  4OFL A;  2YPN A;  1P1Q A;  3HHF A;  4THI A;  1P1N A;  4P0G A;  4ZEF A;  1IIT A;  1MXW A;  3R26 A;  1XOC A;  4POX A;  4R6K A;  4YB6 A;  2RC9 A;  4H65 A;  4LZ8 A;  1SW4 A;  3C35 A;  2Y7W A;  4F2O A;  1BIY A;  4RY1 A;  3MC2 A;  3G3J A;  1WOD A;  3B6T A;  1MM7 A;  3EF7 A;  2DS9 A;  2IEE A;  3EPE A;  2F78 A;  3QSL A;  4NWC A;  1NH8 A;  4KFQ A;  2DWJ A;  1FQD A;  3E9X A;  3O28 A;  3QUF A;  3C31 A;  4KR5 A;  1B3L A;  1POT A;  4OXV A;  3C36 A;  1MY3 A;  2DOJ A;  5DVF A;  3DP4 A;  1B4Z A;  1RYX A;  3TTM A;  3KJT A;  5HPQ A;  3T9H B;  3Q25 A;  1JW4 A;  3KSJ A;  2GHA A;  4RA1 A;  3QXM A;  3FVO A;  3H7M A;  1A8F A;  1MRP A;  3IOR A;  4MLQ A;  3RQT A;  4U22 A;  3TCF A;  3O66 A;  3CFX A;  3DM0 A;  4DXU A;  4WKM A;  1GV8 A;  2REJ A;  2DWA A;  4Q5T A;  1B3H A;  2QPQ A;  4LZ7 A;  4O3C A;  3H06 B;  2XX8 A;  2THI A;  3E13 X;  4ISU A;  1MXV A;  3CG3 A;  5DYH A;  4R9G A;  4JSO A;  1EZO A;  1CB6 A;  3TQW A;  3IR1 A;  2H25 A;  1T0K A;  2HQ0 A;  3PPQ A;  1PB8 A;  3TTL A;  1Q1K A;  3U94 A;  3K00 A;  4JBZ A;  3PMW A;  2DXR A;  4JWY A;  1LFH A;  1AMF A;  1IQ7 A;  2M8C A;  4ELQ A;  1UIU A;  4JXI A;  4ESX A;  5KZT A;  1TT1 A;  3T9V A;  2I3V A;  4LAT A;  2QS2 A;  3Q29 A;  4RJZ A;  1Y3N A;  2Y7K A;  4LA9 A;  2D5W A;  2NWJ A;  1FCK A;  2RC7 A;  2REG A;  3A3C A;  2PX1 A;  4IO5 A;  3AXF A;  4XIG Q;  1B7U A;  2AYS A;  2Z23 A;  2ZXT A;  5ISU A;  4XKR A;  4YU0 A;  4BDL A;  3IL1 B;  3PGF A;  4MLV A;  3U1O A;  3SEW A;  3IO4 A;  3TAJ A;  3S9E A;  3RTW B;  2PT1 A;  3TKD A;  3MVY A;  4OQO A;  4X1D A;  4PFU A;  3F11 A;  4IY6 A;  2OCU A;  2V3U A;  5FHO A;  3FV1 A;  1R6Z A;  1JVX A;  1NL5 A;  1BLF A;  3G3I A;  4H5F A;  2GHB A;  1EH3 A;  4WEP A;  2QJE A;  3KN8 A;  4AB5 A;  2XXY A;  1XHY A;  1M5B A;  4P11 A;  3GBB A;  3L6H A;  1HSE A;  1XC1 A;  1Y4C A;  2QL3 A;  4YMA A;  3OXN A;  3W15 C;  1I6B A;  2R6G E;  4C1U A;  4BDM A;  3TEL A;  3RNN A;  1POY 1;  3N6U A;  1B1X A;  1VR5 A;  4RPO A;  3CVG A;  4KD5 A;  3MVX A;  1UTB B;  5JTY B;  1S50 A;  2F97 A;  4ZZE A;  1B32 A;  4XKQ A;  1D9Y A;  1MQG A;  4EF2 A;  3O29 A;  1UQW A;  3Q27 A;  1UTH A;  1IUD A;  1UTB A;  5JTY A;  3IOU A;  2IA4 A;  1N3W A;  5ICT A;  2O69 A;  3KN3 A;  4LQ2 A;  4LQ5 A;  1LCT A;  2W7Y A;  3UOR A;  5AA2 D;  3FJM A;  4G8N A;  1B52 A;  1FTJ A;  4FOR A;  5AE4 A;  3VFJ A;  1TWY A;  2NUV A;  2FNC A;  1US4 A;  3P7I A;  5IAI A;  4OWD A;  4KCC A;  4F3G A;  5I2N B;  3O6I A;  4RK9 A;  2DYX A;  4H67 A;  1YTV A;  3LC8 A;  3LSW A;  4M1V A;  2LAO A;  2F5X A;  3OEL A;  1S7Y A;  4EQB A;  5L8D A;  1URS A;  1MDP 1;  4I62 A;  1PB9 A;  1F9B A;  1OIB A;  4HW8 A;  4H8I A;  3RGY A;  4GL8 A;  3LBS A;  1QKB A;  3T96 B;  5A5X A;  1PC3 A;  3H03 A;  3G3F A;  4RNS A;  3S2V A;  3SEX A;  4G8H A;  5AA2 A;  4OTE A;  2Y84 A;  3HV1 A;  3MZ9 A;  5EYF A;  3MW0 A;  3WAF A;  2VHA A;  2FYI A;  1B6H A;  2UYE A;  3FVG A;  2ANJ A;  3FXR A;  3KJ7 A;  3FUZ A;  5H8N B;  1NNP A;  1NNK A;  1MS7 A;  4ELO A;  3DP6 A;  2O51 A;  2ZYN A;  4ESW A;  3S9N C;  2I0C A;  2UXA A;  1JEV A;  5ELV A;  5H8N A;  4QFO A;  4F31 B;  4FEC A;  4Q30 B;  2UVG A;  3VLV A;  1N84 A;  4M4G A;  4ECF A;  3C33 A;  3LR1 A;  1OMP A;  3DEL B;  4ND9 A;  3RLF E;  3ZS6 A;  4ZEK A;  2ZNU A;  2A5T B;  1Y3Q A;  3IOV A;  2NVU B;  3VXC A;  4BDO A;  3RUM A;  3TTK A;  1TFA A;  4ZDM A;  4ZE8 A;  3PPN A;  2A5T A;  1OVB A;  1LFG A;  5EHM A;  3KZG A;  5CBS A;  2UVH A;  3SEU A;  4PFT A;  1A54 A;  1PEB A;  1LAF E;  5K2Y A;  2DVZ A;  2Q89 A;  4LON B;  3MZB A;  4IO7 A;  4OHN A;  1MY0 A;  3UA8 A;  4H8J A;  2NOO A;  2XXW A;  4PE5 B;  1LST A;  2Z22 A;  1AH5 A;  4IB2 A;  3N5L A;  1RYO A;  3UK4 A;  2UVJ A;  4HCW A;  5L9O A;  4F1V A;  2UYF A;  1MXU A;  3FJG A;  1JQF A;  1USY H;  3MBP A;  4YIC A;  2RC8 A;  1ATG A;  1VE4 A;  3IB2 A;  3T9X B;  4YAH X;  4YKJ A;  2ONK E;  3CG1 A;  5FHM A;  4GF8 A;  1R9L A;  1QJM A;  1SW1 A;  5CMC A;  1MPC A;  5DVI A;  3C4M A;  4NF6 B;  4IGT A;  3VLU A;  4OZ9 A;  5FTH A;  4BDN A;  3TMG A;  1EZ9 A;  2ZMB A;  1SI1 A;  3MWB A;  4XXU A;  1II5 A;  4NF6 A;  1BP5 A;  2Y7P A;  4MH5 A;  1B40 A;  2QS4 A;  2F36 A;  2RKM A;  4R75 A;  1B3F A;  2CMO A;  2ESN A;  3QAX A;  4FJP A;  2O1L A;  2HCA A;  3OO7 A;  5I2K A;  4UAC A;  1AOV A;  2ZNS A;  5TPA B;  3TCG A;  3EQ1 A;  4G68 B;  1DTZ A;  1HSJ A;  3K1P A;  5TU0 A;  2V3T A;  3UIF A;  1Q35 A;  1MQJ A;  4GVO A;  2QS3 A;  4EUO A;  1GGG A;  5ITO A;  1ZMG A;  3MP8 A;  4BLA A;  4IO3 A;  4GD5 A;  2YLN A;  3KOT A;  4TOZ A;  5TPA A;  3G7W A;  4G68 A;  4R74 A;  4H0W A;  2HFB A;  4EF1 A;  1XS5 A;  4YZZ A;  4O3B A;  1B3G A;  4GWO A;  2RCB A;  1DPP A;  1Y20 A;  3IJX B;  4N6P A;  2O7I A;  4EXK A;  4KI0 E;  4L17 A;  1FTL A;  3PD9 A;  5CC2 A;  1BTJ A;  2I0B A;  3USD A;  3CFZ A;  2I58 A;  1NKX A;  5I59 B;  5J1D A;  1VFE A;  2XXQ A;  3THI A;  1Z7M E;  1N04 A;  2H9B A;  4G68 C;  1HSL A;  1B51 A;  1IIW A;  2ONR A;  2HAV A;  4DIG A;  1LBC A;  3KGC A;  2R71 A;  4TLL B;  4E0W A;  5I59 A;  2F35 A;  2BJJ X;  4IO4 A;  1O7T A;  2VD2 A;  3R7X A;  3PPO A;  3H4Z A;  4LUB A;  2OBG A;  3QIM A;  5CBR A;  3CFL A;  1LLS A;  3GBA A;  2B65 A;  5DEX B;  1IXH A;  3GZG A;  3BBR A;  1MY2 A;  3PUX E;  4YKP A;  3D4C A;  1YPN A;  4JWX A;  2P2A A;  3RT6 B;  2HAU A;  1NH7 A;  4HS7 A;  4F2Q A;  3SET A;  3G3G A;  4H5G A;  2OK2 A;  1LCF A;  5DEX A;  4OFO A;  1SQY A;  1SYI A;  1R9Q A;  1MH3 A;  2E0S A;  1LB9 A;  2F34 A;  4N07 A;  4JDF A;  2P0S A;  3GLB A;  1OLA A;  5CMB A;  1N76 A;  4P0I A;  2X7P A;  3CR9 A;  3O2A A;  1FTK A;  1Y9U A;  1FQE A;  3PD8 A;  3O6G A;  1XT8 A;  2KLF A;  4KYS A;  4EQ7 A;  2X7Q A;  3K0V A;  4RPN A;  4QFK A;  5CI5 A;  2I4C A;  3LSF B;  2Z8D A;  4FIM A;  2I3W A;  2F6P A;  1MH4 A;  4OMB A;  5JK4 A;  4GFR A;  3DP8 A;  4BDR A;  4WXJ A;  3BKI B;  2X26 A;  2XXX A;  3R6U A;  2Q2C A;  4ZS9 A;  3M3K A;  4TQU Q;  5I58 B;  3VVE A;  4ZZA A;  5BUU A;  1MXZ A;  1MPD A;  2OZZ A;  2XX7 A;  3T93 B;  2DVC A;  1QUJ A;  3FV2 A;  1LAX A;  4HCY A;  1QW0 A;  3OSR A;  3PU5 A;  2XD2 A;  2O7U A;  5I58 A;  2V84 A;  1UTH B;  4C0R A;  2UVI A;  2AL5 A;  2HZL A;  2PT2 A;  1ZIU A;  2XXI A;  4NF4 A;  1ANF A;  3OO6 A;  4JWO A;  2FA7 A;  1OVT A;  1NNT A;  2ZNT A;  3SER A;  1I6A A;  1B0H A;  5DTB A;  3GXA A;  3LSL A;  4QRZ A;  1D3K A;  1A55 A;  4I1D A;  1O63 A;  3G3H A;  4WED A;  3MPL A;  1JVY A;  4LZ5 A;  3TPA A;  1B5H A;  1KWH A;  5H8F B;  1VFD A;  5A5X B;  2XD3 A;  3V89 B;  2ALU A;  3K6V A;  2GFE A;  3KSX A;  1LFI A;  3ILT B;  1A40 A;  3MZ1 A;  5AA2 B;  1OQH A;  4JSD A;  3O6H A;  3HO7 A;  3G3K A;  3BFT A;  3H3G A;  5H8F A;  3N6T A;  2QS1 A;  1QKA A;  1MPB A;  4NED A;  2QSX A;  4PET A;  2NXO A;  1JEU A;  4NMY A;  1PBP A;  3KG2 A;  2OWS A;  4KYD A;  4R2F A;  3HST A;  1Y1Z A;  4F22 A;  1N3X A;  4FAT A;  5FHN A;  1B58 A;  1B4H A;  2XX9 A;  1LGB C;  3RY3 A;  5B7D A;  4OVJ A;  3D4G A;  1WVJ A;  3CIJ A;  4U1Z A;  3BFU A;  1MY1 A;  2F6G A;  3IOW A;  2F8D A;  3FVK A;  1SD3 A;  4QSC A;  5ITP A;  4KQP A;  3TUS A;  3FXQ A;  2Q9T A;  4YMB A;  3EHS A;  1MDQ A;  5F1Q A;  2WKY A;  1P1U A;  3EN3 A;  1URG A;  3M3F A;  4GXA A;  4LP2 B;  2XHD A;  4QSE A;  4OEU A;  4F3P A;  1B05 A;  3MPK A;  1N7W A;  1USY E;  1IEJ A;  2H5Y A;  3U8Q A;  1DPE A;  2ZYK A;  4U1O A;  2Q88 A;  4EXL A;  3EHT A;  4KYE A;  4NF5 B;  1N0T A;  2QMW A;  3K02 A;  2Q8J A;  2G93 A;  3FD3 A;  4GL0 A;  1DSN A;  1MY4 A;  4F29 A;  4DDD A;  5L9S A;  5I56 B;  4NF5 A;  3LUY A;  1NNF A;  1D9V A;  5HM4 B;  4DLD A;  3W9W A;  4R9F A;  1P99 A;  3VDF A;  3OD7 A;  3MJN A;  3TDJ A;  3TTN A;  5I84 A;  3SES A;  3ODB A;  5I56 A;  1SVX B;  1S9T A;  1SYH A;  4PP0 A;  3CSB A;  4AB6 A;  4F1U A;  2XXU A;  4ONY A; 
#chains in the Genus database with same CATH topology
 4I8C A;  2VT5 A;  4MBP A;  5K2X A;  4GRK A;  3ZKK A;  4I40 A;  1AL3 A;  4XF5 A;  1JNF A;  4QXD A;  1JW1 A;  4R72 A;  2HEU A;  3FJ7 A;  3S4U A;  1QUI A;  3DLN A;  2CZK A;  2F7A A;  4QFP A;  3PV0 E;  1IXC A;  4PCD A;  2XXP A;  4N4U A;  2VP1 A;  1XVX A;  4PQJ A;  1JET A;  5IM2 A;  2QVR A;  3TOD A;  3FGS A;  4FED A;  1PB7 A;  3PPP A;  3OEK A;  3T66 A;  3UGW A;  3IX1 A;  3K6X A;  3OO8 A;  5KDT B;  4MMP A;  3HN0 A;  4LVQ A;  3FAT A;  5DVJ A;  5I2K B;  1B1H A;  3JYR A;  1Q9D A;  4F18 A;  4EDP A;  4PFY A;  3C34 A;  4X04 A;  4RXL A;  2ONS A;  3IB0 A;  4R6Y A;  3VVF A;  5KDT A;  2D3I A;  5LOM A;  2GH9 A;  2DE3 A;  3CI8 A;  5EHS A;  4KHZ E;  1B2H A;  4POW A;  1CE2 A;  1DTG A;  2Y7R A;  2AIX A;  3N94 A;  5F24 A;  2P3N A;  4MX6 A;  3K1M A;  1LAH E;  1PDA A;  1EZP A;  5ET7 A;  3A09 A;  3FZV A;  1Z7N E;  1MQD A;  1NV7 A;  1QUK A;  4OES A;  2Z8F A;  5H8S A;  1US5 A;  4OET A;  3V83 A;  4ZED A;  1YCJ A;  2OLB A;  5H8H B;  5DT6 A;  3OO9 A;  4KCD A;  4FE8 A;  4PFW A;  3T22 A;  1IZ1 A;  4O3A A;  1IMC A;  1G0I A;  1SI0 A;  4G77 A;  1B7Z A;  3FAS A;  1Y3P A;  4XKN A;  1DMB A;  5H8H A;  1A8E A;  3SEY A;  2F7C A;  1B46 A;  1B5J A;  4ELP A;  3E4R A;  5F7V A;  3UN6 A;  1NI9 A;  4I9D A;  1BKA A;  4P47 A;  4IGR A;  1FQC A;  4G8M A;  2I49 A;  2G29 A;  2RCA A;  3C32 A;  4FEB A;  3IK6 B;  4HE0 A;  1B3E A;  3TFL A;  1YYZ A;  2V3Q A;  4GIZ A;  3H6V A;  2O68 A;  3OOA A;  2I4B A;  1H44 A;  4F39 A;  4E0X A;  2PCR A;  5CMK A;  4JB7 A;  5CM6 A;  1IXG A;  1FPG A;  3Q26 A;  1D4N A;  4XTC Q;  3H6U A;  4OVQ A;  3FXU A;  3QUJ A;  2O6A A;  3SZP A;  2P1S A;  3U92 A;  4QFN A;  1B7H A;  2DQV A;  3VVD A;  3ECR A;  3FIR A;  2XXH A;  4MF3 A;  1CNQ A;  3I6V A;  4AQ4 A;  2DSF A;  2DE2 A;  1FSA A;  3O9P A;  3OEN A;  3ILU B;  4FBP A;  4EQ9 A;  1ZJL A;  2V93 A;  3LSX A;  4NE4 A;  2A5S A;  4OVP A;  1GR2 A;  4K3F A;  1TFD A;  4GXS B;  1QVS A;  3TQL A;  4UA8 A;  3A3U A;  1URD A;  5ICQ A;  4O94 A;  4OEN A;  2O1M A;  2R9J A;  3V8X B;  2PYY A;  1B5I A;  2QRY A;  1MQI A;  1VSO A;  3ISP A;  3B6W A;  3JZJ A;  4ZEC A;  3OEM A;  1AIV A;  4AS4 A;  3MVZ A;  4NWD A;  5CRY A;  2YJP A;  1Y1M A;  1NMU A;  3ZSF A;  2DXY A;  2PMS A;  5JEI A;  5L9M A;  1FQA A;  2FIX A;  4FAJ A;  3W9V A;  4YB7 A;  3I5O A;  4GWZ A;  1A7L A;  1FW0 A;  1MQH A;  4PFI A;  3KC1 A;  3K2D A;  1NV4 A;  4RYA A;  1UIV A;  3TTR A;  4RK2 A;  1MXY A;  5B70 A;  4NF8 B;  1SW5 A;  4OYV A;  4YKI A;  4Z0I A;  3T1B A;  4F3S A;  1ZLQ A;  3CRB A;  4N13 A;  2XWO A;  4ZE9 A;  4ZEI A;  2DWH A;  2MKZ A;  1KA0 A;  1MXX A;  2RF1 A;  4NF8 A;  5CMM A;  1QUL A;  1FBH A;  2V25 A;  1J1N A;  3E78 A;  3V5A A;  4Q8R A;  1P1W A;  1M5F A;  5IKB A;  4GQO A;  3HCQ A;  4Q0C A;  3K4U A;  3MQ9 A;  3I3V A;  1O64 A;  4NQ8 A;  3PUZ E;  4R73 A;  3HHG A;  1L5T A;  1M5C A;  4H6D A;  1Y4T A;  4P1L A;  3KN7 A;  4YB5 A;  3QYT A;  4NF4 B;  2Y7I A;  4DXB A;  1SBP A;  2PVU A;  5BWJ A;  4XKP A;  4GOT A;  3FVN A;  3EHU A;  3IJO B;  3BIG A;  1M5D A;  4ELR A;  3KEI A;  4PF6 A;  5I3S A;  2B3F A;  1PBQ A;  3JV9 A;  4PGP A;  1H45 A;  3H6T A;  2O84 X;  2RIN A;  1P1O A;  4U4S A;  5EQ9 A;  1B9J A;  4C1T A;  1TXF A;  2CZI A;  5TP9 B;  5I57 B;  4IO2 A;  4N15 A;  2QMX A;  3ONM A;  4G4P A;  3B7D A;  1LAG E;  2H98 A;  3N26 A;  4MFI A;  3MVW A;  4DCX A;  4NTL A;  5TP9 A;  2CZH A;  4Z7E A;  5I57 A;  4P8B A;  3L6G A;  3OSQ A;  3TZA A;  1NV2 A;  5FBP A;  1LBB A;  1YAE A;  2D21 A;  1FTM A;  4QF9 A;  4F3B A;  2H99 A;  2XXV A;  4G61 A;  2KR0 A;  2Z8E A;  2WBD A;  5FTI A;  1M5E A;  4QBA A;  4GX6 A;  1EYJ A;  5ET8 A;  2CZL A;  3RPW A;  3KBR A;  3RN8 A;  3VXB A;  5EYH A;  2H4I A;  3PUV E;  1NFT A;  3Q28 A;  3PUW E;  1WDN A;  5KCJ B;  4OEV A;  1ELJ A;  1GVC A;  3TEP A;  3RTF B;  4BDQ A;  4QHQ A;  1ZU0 A;  3SEV A;  1EU8 A;  2DP8 A;  3IOT A;  5I2N A;  4U21 A;  1FPF A;  3B6Q A;  4G2Z A;  3MUQ A;  5KCJ A;  2XXR A;  5LDZ A;  1SW2 A;  3S9L C;  3MP6 A;  1OQG A;  1ZTY A;  2BJI A;  4PAK A;  4GX4 A;  4JVC A;  2PBW A;  4QFL A;  1DOT A;  3IB1 A;  3MP1 A;  3ROJ A;  3K6U A;  1FQF A;  1IXI A;  5H8Q B;  3OMB A;  1H76 A;  4R2B A;  4U23 A;  4NN3 A;  2ZYO A;  4F1Y A;  4NX1 A;  4X9T A;  1GTK A;  2XXT A;  1R1N A;  4F19 A;  2B3B A;  1H3D A;  1N7X A;  1I69 A;  3O97 A;  2VOZ A;  1XVY A;  4IO6 A;  4TLM B;  1SDX A;  3IO6 A;  1H43 A;  4NAP A;  5H8Q A;  4H1X A;  3T9U A;  2F7B A;  2FBP A;  4KPT A;  2OWT A;  4N91 A;  4X1B A;  2HZK A;  2VD3 A;  2OJT A;  3IAZ A;  3K1N A;  1FTO A;  3K01 A;  2DWI A;  2AL4 A;  3KOS A;  2E1S A;  5AA4 B;  3PPR A;  4HTG A;  2I6E A;  2Q2A A;  1ZKB A;  3SKP A;  4N6K A;  4DXC A;  1IMD A;  5M2V A;  1ZBM A;  4OFJ A;  4U2R A;  3U72 A;  3SDF A;  4R6H A;  5AA4 A;  1A99 A;  5AA3 A;  1NUW A;  3UP9 A;  2I48 A;  4PDH A;  5HBC A;  4YKK A;  4ZEB A;  3TCH A;  3RT8 A;  3PUY E;  3M3L A;  2DE4 A;  4IY5 A;  3HPI A;  2ABH A;  3ZKL A;  1B0L A;  3S9M C;  1OLC A;  3QK6 A;  1FQB A;  3KFM A;  1YZ0 A;  2DDK A;  3VE1 B;  5EQ7 A;  4OER A;  1FTA A;  2ZYM A;  4U4X A;  4GLI A;  1DBZ A;  3PMV A;  4DE8 A;  3VV5 A;  2GRV A;  1MG1 A;  4QSD A;  1I6Q A;  3K6W A;  3H6W A;  5AA1 A;  3MAM A;  1JW5 A;  1LB8 A;  3E3K A;  2VGQ A;  1MM6 A;  1RKM A;  4X48 A;  3VLW A;  3M8U A;  3CSG A;  4DCY A;  2HXW A;  3TYH A;  3U93 A;  4DZ1 A;  3C9H A;  1EYI A;  3PMX A;  3LV0 A;  3WAE A;  4OFL A;  2YPN A;  1P1Q A;  3HHF A;  4THI A;  1P1N A;  4P0G A;  4ZEF A;  1IIT A;  1MXW A;  3R26 A;  1XOC A;  4XFE A;  4POX A;  4R6K A;  4PAI A;  4YB6 A;  2KQZ A;  2RC9 A;  2Q8M A;  4H65 A;  4LZ8 A;  1SW4 A;  3C35 A;  2Y7W A;  4F2O A;  1BIY A;  4RY1 A;  3MC2 A;  3G3J A;  1WOD A;  3B6T A;  5ESY A;  1MM7 A;  3EF7 A;  2DS9 A;  2IEE A;  3EPE A;  2F78 A;  3QSL A;  4NWC A;  1NH8 A;  4N8Y A;  4KFQ A;  2DWJ A;  2WEF A;  1FQD A;  3E9X A;  3O28 A;  3QUF A;  3C31 A;  4PFR A;  4KR5 A;  2GQ1 A;  1B3L A;  1FJ6 A;  1NV6 A;  1POT A;  4OXV A;  3C36 A;  2HPG A;  1MY3 A;  3B50 A;  2DOJ A;  5DVF A;  3DP4 A;  3NOH A;  1B4Z A;  3EKI A;  1RYX A;  3TTM A;  3KJT A;  5HPQ A;  3T9H B;  3Q25 A;  1JW4 A;  3KSJ A;  2GHA A;  4OVT A;  1NV0 A;  3QXM A;  4RA1 A;  3FVO A;  3H7M A;  4GBV A;  1A8F A;  1FPL A;  2FIE A;  1MRP A;  3IOR A;  3A29 A;  4MLQ A;  4JVI A;  3RQT A;  4U22 A;  3TCF A;  1NUX A;  3O66 A;  3CFX A;  3DM0 A;  2HHM A;  4DXU A;  4WKM A;  1GV8 A;  1FPI A;  2HXR A;  2P3V A;  2REJ A;  2DWA A;  2Y5L A;  4Q5T A;  1K9Z A;  1B3H A;  2QPQ A;  1G0H A;  4LZ7 A;  4O3C A;  3H06 B;  2XX8 A;  2THI A;  3E13 X;  4ISU A;  1MXV A;  3CG3 A;  5DYH A;  4R9G A;  4JSO A;  1EZO A;  1CB6 A;  3TQW A;  3IR1 A;  2H25 A;  4NF0 A;  4PC9 A;  1T0K A;  2HQ0 A;  2WX9 A;  3PPQ A;  1PB8 A;  3TTL A;  4GWS A;  3HFU A;  1Q1K A;  3U94 A;  3K00 A;  5LTC A;  3KBZ A;  4JBZ A;  3PMW A;  2DXR A;  4JWY A;  1LFH A;  1AMF A;  1IQ7 A;  2M8C A;  4ELQ A;  1UIU A;  4JXI A;  4ESX A;  5KZT A;  1TT1 A;  3T9V A;  2I3V A;  4LAT A;  2QS2 A;  3Q29 A;  4RJZ A;  1Y3N A;  2QFL A;  2Y7K A;  2D5W A;  4LA9 A;  4MCO A;  2NWJ A;  1FCK A;  2RC7 A;  4I3Y A;  2REG A;  1INP A;  3A3C A;  2PX1 A;  5EQA A;  4IO5 A;  3AXF A;  1FPD A;  4XIG Q;  4N8G A;  1B7U A;  2AYS A;  2Z23 A;  2ZXT A;  5ISU A;  4XKR A;  4YU0 A;  4BDL A;  3IL1 B;  4HE2 A;  3LUZ A;  3PGF A;  4MLV A;  3U1O A;  3SEW A;  3IO4 A;  3TAJ A;  3S9E A;  3RTW B;  2PT1 A;  3TKD A;  3MST A;  3MVY A;  4OQO A;  4X1D A;  4PFU A;  3F11 A;  4IY6 A;  2OCU A;  2V3U A;  4MEV A;  5FHO A;  3FV1 A;  1R6Z A;  1JVX A;  1NL5 A;  1BLF A;  3G3I A;  4H5F A;  2GHB A;  1EH3 A;  4WEP A;  2QJE A;  3KN8 A;  1LEV A;  4AB5 A;  2XXY A;  1IMF A;  1XHY A;  1LBX A;  3U65 A;  1YXI A;  5EQ8 A;  1M5B A;  4P11 A;  3GBB A;  3L6H A;  1HSE A;  1XC1 A;  1Y4C A;  2QL3 A;  4YMA A;  3OXN A;  4HE1 A;  3W15 C;  1I6B A;  4O7I A;  4IR8 A;  2R6G E;  4P9K A;  4C1U A;  4BDM A;  3TEL A;  3RNN A;  1POY 1;  3N6U A;  1B1X A;  1VR5 A;  4RPO A;  3CVG A;  4KD5 A;  1FPK A;  1QGX A;  3MVX A;  1UTB B;  5JTY B;  1S50 A;  2F97 A;  1RDY A;  4ZZE A;  4DI4 B;  1B32 A;  4XKQ A;  1D9Y A;  1MQG A;  4EF2 A;  3O29 A;  1UQW A;  3Q27 A;  5IZ1 A;  1UTH A;  1IUD A;  1UTB A;  5JTY A;  3IOU A;  2IA4 A;  1N3W A;  5ICT A;  2O69 A;  3KN3 A;  4LQ2 A;  4LQ5 A;  1DCU A;  1LCT A;  2W7Y A;  3UOR A;  5AA2 D;  3FJM A;  4G8N A;  1B52 A;  1FTJ A;  4FOR A;  5AE4 A;  1LBW A;  3VFJ A;  1TWY A;  5I7I A;  2NUV A;  2QVU A;  2FNC A;  1US4 A;  3P7I A;  5IAI A;  4OWD A;  4KCC A;  4F3G A;  5I2N B;  3O6I A;  1FJ9 A;  4RK9 A;  2DYX A;  4H67 A;  4PF8 A;  1YTV A;  3LC8 A;  3LSW A;  4M1V A;  4PE3 A;  2LAO A;  2F5X A;  3OEL A;  1S7Y A;  4EQB A;  2PFY A;  5L8D A;  1URS A;  1MDP 1;  4I62 A;  1PB9 A;  4P1E A;  1F9B A;  1OIB A;  4HW8 A;  5J16 A;  4H8I A;  4MIJ A;  3RGY A;  4GL8 A;  2VPO A;  3LBS A;  4GWX A;  1QKB A;  3T96 B;  5A5X A;  2XWK A;  4N81 A;  1PC3 A;  3H03 A;  3G3F A;  4MNI A;  4RNS A;  3S2V A;  3SEX A;  4G8H A;  5AA2 A;  4OTE A;  2Y84 A;  3HV1 A;  3MZ9 A;  4PBQ A;  5EYF A;  3MW0 A;  3WAF A;  2VHA A;  2FYI A;  1B6H A;  2UYE A;  3FVG A;  2ANJ A;  3FXR A;  1KZ8 A;  3KJ7 A;  3FUZ A;  5H8N B;  2FVZ A;  1NNP A;  1FPE A;  1NNK A;  1MS7 A;  4ELO A;  3DP6 A;  2O51 A;  4GWW A;  2ZYN A;  4ESW A;  1FBC A;  3S9N C;  2ZZX A;  2I0C A;  2UXA A;  1JEV A;  5ELV A;  2B4M A;  5H8N A;  4QFO A;  4F31 B;  1BK4 A;  4FEC A;  4Q30 B;  2UVG A;  5IGA A;  3VLV A;  1N84 A;  4M4G A;  4ECF A;  3C33 A;  3LR1 A;  1OMP A;  4GX3 A;  3DEL B;  4ND9 A;  3RLF E;  4ZEK A;  3ZS6 A;  2ZNU A;  2A5T B;  1Y3Q A;  3IOV A;  2NVU B;  3VXC A;  4BDO A;  3RUM A;  3TTK A;  1TFA A;  4ZDM A;  4ZE8 A;  3PPN A;  2A5T A;  1OVB A;  4JVD A;  1LFG A;  2WYK A;  5EHM A;  3KZG A;  5CBS A;  2UVH A;  3SEU A;  4PFT A;  1A54 A;  2B4L A;  1PEB A;  1LAF E;  1FBG A;  5K2Y A;  2DVZ A;  2Q89 A;  4LON B;  1D9Q A;  3MZB A;  5IZZ A;  4IO7 A;  4OHN A;  1MY0 A;  3UA8 A;  4MJO A;  4OA4 A;  4H8J A;  2NOO A;  2F3B A;  2XXW A;  4PE5 B;  1LST A;  2Z22 A;  1AH5 A;  4N17 A;  4IB2 A;  3N5L A;  1RYO A;  3UK4 A;  2UVJ A;  4HCW A;  5L9O A;  4F1V A;  2Q74 A;  2UYF A;  1MXU A;  3FJG A;  1JQF A;  4O8M A;  1USY H;  3MBP A;  4YIC A;  2RC8 A;  4O7M A;  1ATG A;  1VE4 A;  3IB2 A;  5A5L A;  1NV3 A;  3T9X B;  4YAH X;  4YKJ A;  2ONK E;  2V4C A;  3CG1 A;  5FHM A;  5DW8 A;  4GF8 A;  1R9L A;  5IZ3 B;  4PBH A;  1QJM A;  3B8B A;  1SW1 A;  5CMC A;  1MPC A;  4MNP A;  5DVI A;  2WYP A;  3C4M A;  5ET6 A;  4NF6 B;  5ET5 A;  4LN5 A;  4IGT A;  2JJK A;  3VLU A;  4OZ9 A;  5FTH A;  4BDN A;  2QVV A;  1LBZ A;  3TMG A;  4KXP A;  5IZ3 A;  1EZ9 A;  2ZMB A;  1SI1 A;  4P3L A;  3MWB A;  4XXU A;  1II5 A;  1FBP A;  4NF6 A;  1BP5 A;  2Y7P A;  4MHF A;  4MH5 A;  1B40 A;  2QS4 A;  4NG7 A;  3BIH A;  2ZZV A;  2F36 A;  3FXB A;  2RKM A;  1SPI A;  4R75 A;  1B3F A;  2CMO A;  2ESN A;  3QAX A;  4FJP A;  2FHY A;  2O1L A;  2XA5 A;  2HCA A;  2VPN A;  3OO7 A;  5I2K A;  4UAC A;  1AWB A;  1AOV A;  2ZNS A;  5TPA B;  3TCG A;  3EQ1 A;  4NGU A;  4G68 B;  1DTZ A;  1HSJ A;  3K1P A;  5TU0 A;  5T3J A;  2V3T A;  3UIF A;  1Q35 A;  1MQJ A;  4GVO A;  2QS3 A;  4EUO A;  1GGG A;  5ITO A;  1ZMG A;  3D1R A;  3MP8 A;  4BLA A;  4IO3 A;  1LBY A;  4GD5 A;  2YLN A;  3KOT A;  4TOZ A;  5TPA A;  3G7W A;  4G68 A;  4R74 A;  4H0W A;  2HFB A;  4EF1 A;  1XS5 A;  4YZZ A;  4O3B A;  1B3G A;  4GWO A;  2RCB A;  2F3D A;  1DPP A;  1KA1 A;  1Y20 A;  3IJX B;  4N6P A;  2O7I A;  4EXK A;  4KI0 E;  4L17 A;  1FTL A;  3PD9 A;  5CC2 A;  1BTJ A;  2I0B A;  3USD A;  3CFZ A;  2I58 A;  1NKX A;  5I59 B;  5J1D A;  1VFE A;  2XXQ A;  3THI A;  1Z7M E;  2R8T A;  1RDZ A;  1N04 A;  2H9B A;  4G68 C;  1HSL A;  1B51 A;  1IIW A;  2ONR A;  2CEX A;  2HAV A;  2XWI A;  4DIG A;  1FBE A;  1LBC A;  3KGC A;  4OAN A;  2R71 A;  4TLL B;  4E0W A;  5I59 A;  2F35 A;  2BJJ X;  4IO4 A;  1O7T A;  5I5P A;  1IME A;  2VD2 A;  3PPO A;  3R7X A;  3H4Z A;  4LUB A;  2OBG A;  4PFB A;  3QIM A;  5CBR A;  3CFL A;  3RYD A;  1NUZ A;  1LLS A;  2XXK A;  3GBA A;  2B65 A;  5DEX B;  1IXH A;  3GZG A;  3GYY A;  3BBR A;  1MY2 A;  2XWV A;  3PUX E;  4YKP A;  3D4C A;  1YPN A;  4JWX A;  2P2A A;  3RT6 B;  2HAU A;  1NH7 A;  4HXV A;  4HS7 A;  4F2Q A;  3SET A;  1RDX A;  3G3G A;  4H5G A;  2OK2 A;  4GWY A;  1LCF A;  3PTY A;  5DEX A;  4PAF A;  4OFO A;  1SQY A;  1SYI A;  1R9Q A;  1MH3 A;  2E0S A;  2L5V A;  1LB9 A;  2F34 A;  4N07 A;  4JDF A;  2P0S A;  3GLB A;  1OLA A;  4DI3 D;  5CMB A;  1N76 A;  4P0I A;  1FBD A;  1NV5 A;  2X7P A;  3CR9 A;  2WBB A;  3CHG A;  3O2A A;  1FTK A;  1Y9U A;  1FQE A;  3PD8 A;  3O6G A;  1XT8 A;  3E79 A;  2KLF A;  4KYS A;  4EQ7 A;  2X7Q A;  3K0V A;  4RPN A;  4QFK A;  4I3E A;  5CI5 A;  2I4C A;  3LSF B;  2Z8D A;  4FIM A;  2I3W A;  2F6P A;  3FBP A;  4OVS A;  1MH4 A;  4OMB A;  5JK4 A;  4GFR A;  3DP8 A;  4BDR A;  4WXJ A;  3BKI B;  2X26 A;  2XXX A;  3R6U A;  2Q2C A;  4AS5 A;  4ZS9 A;  3M3K A;  4TQU Q;  5I58 B;  3VVE A;  4ZZA A;  5EYG A;  5BUU A;  1MXZ A;  4H45 A;  1MPD A;  2OZZ A;  2XX7 A;  3T93 B;  2DVC A;  1QUJ A;  1FPB A;  3FV2 A;  1JP4 A;  1LAX A;  4HCY A;  1QW0 A;  3OSR A;  3PU5 A;  2XD2 A;  2O7U A;  5I58 A;  2V84 A;  1UTH B;  4N6D A;  4C0R A;  2UVI A;  2Y5K A;  2AL5 A;  2HZL A;  2PFZ A;  2PT2 A;  4MNC A;  4OVR A;  1ZIU A;  2XXI A;  4NF4 A;  1ANF A;  3OO6 A;  4JWO A;  2FA7 A;  1OVT A;  1NNT A;  2ZNT A;  3SER A;  1I6A A;  1B0H A;  5DTB A;  1K9Y A;  3GXA A;  3LSL A;  4QRZ A;  1D3K A;  1A55 A;  4I1D A;  4UAB A;  1O63 A;  3G3H A;  4WED A;  3MPL A;  1JVY A;  4LZ5 A;  3RPL B;  3TPA A;  1B5H A;  4X8R A;  1KWH A;  2OX3 A;  5H8F B;  3IFC A;  1VFD A;  5A5X B;  2XD3 A;  2ZZW A;  3V89 B;  2ALU A;  4PDD A;  3K6V A;  3RPL A;  2GFE A;  3KSX A;  1LFI A;  3ILT B;  1A40 A;  3MZ1 A;  5AA2 B;  4MAG A;  1OQH A;  4JSD A;  3O6H A;  3HO7 A;  3G3K A;  4H46 A;  3BFT A;  3H3G A;  5H8F A;  3N6T A;  2QS1 A;  1QKA A;  1MPB A;  1EYK A;  4NED A;  2QSX A;  4PET A;  2NXO A;  1JEU A;  3T0J A;  4NMY A;  1LBV A;  1PBP A;  3KG2 A;  2OWS A;  4KYD A;  4R2F A;  3HST A;  1Y1Z A;  4F22 A;  1NV1 A;  1NUY A;  1N3X A;  4FAT A;  5FHN A;  1B58 A;  1B4H A;  2XX9 A;  1LGB C;  3RY3 A;  5B7D A;  4OVJ A;  3D4G A;  1WVJ A;  3CIJ A;  4U1Z A;  4XEQ A;  3BFU A;  1MY1 A;  2F6G A;  3IOW A;  2F8D A;  3FVK A;  3MYU A;  1SD3 A;  4QSC A;  5ITP A;  4KQP A;  3TUS A;  3FXQ A;  2Q9T A;  4YMB A;  3EHS A;  4PTK A;  1MDQ A;  2OWZ A;  5F1Q A;  2WKY A;  1FRP A;  1P1U A;  3EN3 A;  1URG A;  3M3F A;  4GXA A;  4LP2 B;  2XHD A;  4QSE A;  4OEU A;  4F3P A;  1B05 A;  3MPK A;  1N7W A;  1USY E;  1IEJ A;  2H5Y A;  3U8Q A;  1DPE A;  4NHB A;  1DK4 A;  2ZYK A;  4U1O A;  2Q88 A;  1IMA A;  1FPJ A;  4EXL A;  3EHT A;  4KYE A;  4NF5 B;  1N0T A;  3IFA A;  2QMW A;  1VDW A;  3K02 A;  3QMF A;  2Q8J A;  4GBW A;  2G93 A;  3FD3 A;  4GL0 A;  1DSN A;  1MY4 A;  4F29 A;  1XI6 A;  4DDD A;  5L9S A;  5I56 B;  4P56 A;  4NF5 A;  3LUY A;  1IMB A;  1NNF A;  1D9V A;  2CEY A;  5HM4 B;  4DLD A;  3W9W A;  4R9F A;  1P99 A;  3VDF A;  3OD7 A;  3MJN A;  3TDJ A;  4GWU A;  3TTN A;  5I84 A;  4PGN A;  3SES A;  3ODB A;  5I56 A;  3KC0 A;  1SVX B;  1S9T A;  1SYH A;  4PP0 A;  3CSB A;  4AB6 A;  4F1U A;  2XXU A;  1FBF A;  4ONY A; 
#chains in the Genus database with same CATH homology
 4I8C A;  4MBP A;  5K2X A;  4GRK A;  3ZKK A;  1AL3 A;  1JNF A;  1JW1 A;  4R72 A;  2HEU A;  3FJ7 A;  3S4U A;  1QUI A;  3DLN A;  2F7A A;  4QFP A;  3PV0 E;  1IXC A;  2XXP A;  2VP1 A;  1XVX A;  4PQJ A;  1JET A;  3TOD A;  3FGS A;  4FED A;  1PB7 A;  3PPP A;  3OEK A;  3T66 A;  3UGW A;  3IX1 A;  3K6X A;  3OO8 A;  5KDT B;  3HN0 A;  4LVQ A;  3FAT A;  5DVJ A;  5I2K B;  1B1H A;  3JYR A;  4F18 A;  4EDP A;  4PFY A;  3C34 A;  4RXL A;  2ONS A;  3IB0 A;  4R6Y A;  3VVF A;  5KDT A;  2D3I A;  5LOM A;  2GH9 A;  2DE3 A;  5EHS A;  3CI8 A;  4KHZ E;  1B2H A;  4POW A;  1CE2 A;  1DTG A;  2Y7R A;  2AIX A;  3N94 A;  3K1M A;  1LAH E;  1PDA A;  1EZP A;  3A09 A;  3FZV A;  1Z7N E;  1MQD A;  1QUK A;  4OES A;  2Z8F A;  5H8S A;  1US5 A;  4OET A;  3V83 A;  4ZED A;  1YCJ A;  2OLB A;  5H8H B;  5DT6 A;  3OO9 A;  4KCD A;  4FE8 A;  4PFW A;  3T22 A;  1IZ1 A;  4O3A A;  1SI0 A;  4G77 A;  1B7Z A;  3FAS A;  1Y3P A;  4XKN A;  1DMB A;  5H8H A;  1A8E A;  3SEY A;  2F7C A;  1B46 A;  1B5J A;  4ELP A;  3E4R A;  5F7V A;  3UN6 A;  4I9D A;  1BKA A;  4IGR A;  1FQC A;  4G8M A;  2I49 A;  2G29 A;  2RCA A;  3C32 A;  4FEB A;  3IK6 B;  3TFL A;  1B3E A;  2V3Q A;  4GIZ A;  3H6V A;  2O68 A;  3OOA A;  2I4B A;  1H44 A;  4F39 A;  4E0X A;  5CMK A;  4JB7 A;  5CM6 A;  1IXG A;  3Q26 A;  1D4N A;  4XTC Q;  3H6U A;  3FXU A;  3QUJ A;  2O6A A;  2P1S A;  3U92 A;  4QFN A;  1B7H A;  2DQV A;  3VVD A;  3ECR A;  3FIR A;  2XXH A;  4MF3 A;  3I6V A;  4AQ4 A;  2DSF A;  2DE2 A;  3O9P A;  3OEN A;  3ILU B;  4EQ9 A;  1ZJL A;  2V93 A;  3LSX A;  4NE4 A;  2A5S A;  1GR2 A;  4K3F A;  1TFD A;  4GXS B;  1QVS A;  3TQL A;  4UA8 A;  3A3U A;  1URD A;  5ICQ A;  4OEN A;  2O1M A;  2R9J A;  3V8X B;  2PYY A;  1B5I A;  2QRY A;  1MQI A;  1VSO A;  3B6W A;  3JZJ A;  4ZEC A;  3OEM A;  1AIV A;  3MVZ A;  4NWD A;  5CRY A;  2YJP A;  1Y1M A;  1NMU A;  3ZSF A;  2DXY A;  2PMS A;  5JEI A;  5L9M A;  1FQA A;  4FAJ A;  3W9V A;  4YB7 A;  3I5O A;  1A7L A;  1FW0 A;  1MQH A;  3K2D A;  4RYA A;  1UIV A;  3TTR A;  4RK2 A;  1MXY A;  5B70 A;  4NF8 B;  1SW5 A;  4OYV A;  4YKI A;  4Z0I A;  4F3S A;  1ZLQ A;  3CRB A;  4N13 A;  4ZE9 A;  4ZEI A;  2DWH A;  1MXX A;  2RF1 A;  4NF8 A;  5CMM A;  1QUL A;  2V25 A;  1J1N A;  3V5A A;  4Q8R A;  1P1W A;  1M5F A;  5IKB A;  4GQO A;  3HCQ A;  4Q0C A;  3K4U A;  3MQ9 A;  3I3V A;  1O64 A;  3PUZ E;  4R73 A;  3HHG A;  1L5T A;  1M5C A;  4H6D A;  1Y4T A;  3KN7 A;  4YB5 A;  3QYT A;  4NF4 B;  2Y7I A;  4DXB A;  1SBP A;  2PVU A;  5BWJ A;  4XKP A;  4GOT A;  3FVN A;  3EHU A;  3IJO B;  1M5D A;  4ELR A;  3KEI A;  2B3F A;  1PBQ A;  3JV9 A;  1H45 A;  3H6T A;  2O84 X;  2RIN A;  1P1O A;  4U4S A;  1B9J A;  4C1T A;  1TXF A;  5TP9 B;  5I57 B;  4IO2 A;  2QMX A;  3ONM A;  4G4P A;  3B7D A;  1LAG E;  2H98 A;  3N26 A;  4MFI A;  3MVW A;  4DCX A;  4NTL A;  5TP9 A;  4Z7E A;  5I57 A;  3L6G A;  3OSQ A;  3TZA A;  1LBB A;  1YAE A;  2D21 A;  1FTM A;  4QF9 A;  4F3B A;  2H99 A;  2XXV A;  2Z8E A;  5FTI A;  1M5E A;  2CZL A;  3RPW A;  3KBR A;  3RN8 A;  3VXB A;  2H4I A;  3PUV E;  1NFT A;  3Q28 A;  3PUW E;  1WDN A;  5KCJ B;  4OEV A;  1ELJ A;  1GVC A;  3TEP A;  3RTF B;  4BDQ A;  4QHQ A;  1ZU0 A;  3SEV A;  1EU8 A;  2DP8 A;  3IOT A;  5I2N A;  4U21 A;  3B6Q A;  4G2Z A;  3MUQ A;  5KCJ A;  2XXR A;  1SW2 A;  3S9L C;  3MP6 A;  1OQG A;  1ZTY A;  2PBW A;  4QFL A;  1DOT A;  3IB1 A;  3MP1 A;  3K6U A;  1FQF A;  1IXI A;  5H8Q B;  3OMB A;  1H76 A;  4R2B A;  4U23 A;  2ZYO A;  4F1Y A;  4X9T A;  1GTK A;  2XXT A;  1R1N A;  4F19 A;  2B3B A;  1H3D A;  1N7X A;  1I69 A;  3O97 A;  2VOZ A;  1XVY A;  4IO6 A;  4TLM B;  1SDX A;  3IO6 A;  1H43 A;  5H8Q A;  4H1X A;  3T9U A;  2F7B A;  4KPT A;  2OWT A;  4X1B A;  2HZK A;  2VD3 A;  2OJT A;  3IAZ A;  3K1N A;  1FTO A;  3K01 A;  2DWI A;  2AL4 A;  3KOS A;  2E1S A;  5AA4 B;  3PPR A;  4HTG A;  2I6E A;  2Q2A A;  1ZKB A;  3SKP A;  4DXC A;  5M2V A;  1ZBM A;  4OFJ A;  4U2R A;  3U72 A;  3SDF A;  4R6H A;  5AA4 A;  1A99 A;  5AA3 A;  3UP9 A;  2I48 A;  5HBC A;  4YKK A;  4ZEB A;  3TCH A;  3RT8 A;  3PUY E;  3M3L A;  2DE4 A;  4IY5 A;  3HPI A;  2ABH A;  3ZKL A;  1B0L A;  3S9M C;  1OLC A;  3QK6 A;  1FQB A;  3KFM A;  3VE1 B;  4OER A;  2ZYM A;  4U4X A;  4GLI A;  3PMV A;  4DE8 A;  3VV5 A;  2GRV A;  1MG1 A;  4QSD A;  1I6Q A;  3K6W A;  3H6W A;  5AA1 A;  3MAM A;  1JW5 A;  1LB8 A;  3E3K A;  2VGQ A;  1MM6 A;  1RKM A;  4X48 A;  3VLW A;  3M8U A;  3CSG A;  4DCY A;  2HXW A;  3TYH A;  3U93 A;  4DZ1 A;  3C9H A;  3PMX A;  3WAE A;  4OFL A;  2YPN A;  1P1Q A;  3HHF A;  4THI A;  1P1N A;  4P0G A;  4ZEF A;  1IIT A;  1MXW A;  3R26 A;  1XOC A;  4POX A;  4R6K A;  4YB6 A;  2RC9 A;  4H65 A;  4LZ8 A;  1SW4 A;  3C35 A;  2Y7W A;  4F2O A;  1BIY A;  4RY1 A;  3MC2 A;  3G3J A;  1WOD A;  3B6T A;  1MM7 A;  3EF7 A;  2DS9 A;  2IEE A;  3EPE A;  2F78 A;  3QSL A;  4NWC A;  1NH8 A;  4KFQ A;  2DWJ A;  1FQD A;  3E9X A;  3O28 A;  3QUF A;  3C31 A;  4KR5 A;  1B3L A;  1POT A;  4OXV A;  3C36 A;  1MY3 A;  2DOJ A;  5DVF A;  3DP4 A;  1B4Z A;  1RYX A;  3TTM A;  3KJT A;  5HPQ A;  3T9H B;  3Q25 A;  1JW4 A;  3KSJ A;  2GHA A;  4RA1 A;  3QXM A;  3FVO A;  3H7M A;  1A8F A;  1MRP A;  3IOR A;  4MLQ A;  3RQT A;  4U22 A;  3TCF A;  3O66 A;  3CFX A;  3DM0 A;  4DXU A;  4WKM A;  1GV8 A;  2REJ A;  2DWA A;  4Q5T A;  1B3H A;  2QPQ A;  4LZ7 A;  4O3C A;  3H06 B;  2XX8 A;  2THI A;  3E13 X;  4ISU A;  1MXV A;  3CG3 A;  5DYH A;  4R9G A;  4JSO A;  1EZO A;  1CB6 A;  3TQW A;  3IR1 A;  2H25 A;  1T0K A;  2HQ0 A;  3PPQ A;  1PB8 A;  3TTL A;  1Q1K A;  3U94 A;  3K00 A;  4JBZ A;  3PMW A;  2DXR A;  4JWY A;  1LFH A;  1AMF A;  1IQ7 A;  2M8C A;  4ELQ A;  1UIU A;  4JXI A;  4ESX A;  5KZT A;  1TT1 A;  3T9V A;  2I3V A;  4LAT A;  2QS2 A;  3Q29 A;  4RJZ A;  1Y3N A;  2Y7K A;  4LA9 A;  2D5W A;  2NWJ A;  1FCK A;  2RC7 A;  2REG A;  3A3C A;  2PX1 A;  4IO5 A;  3AXF A;  4XIG Q;  1B7U A;  2AYS A;  2Z23 A;  2ZXT A;  5ISU A;  4XKR A;  4YU0 A;  4BDL A;  3IL1 B;  3PGF A;  4MLV A;  3U1O A;  3SEW A;  3IO4 A;  3TAJ A;  3S9E A;  3RTW B;  2PT1 A;  3TKD A;  3MVY A;  4OQO A;  4X1D A;  4PFU A;  3F11 A;  4IY6 A;  2OCU A;  2V3U A;  5FHO A;  3FV1 A;  1R6Z A;  1JVX A;  1NL5 A;  1BLF A;  3G3I A;  4H5F A;  2GHB A;  1EH3 A;  4WEP A;  2QJE A;  3KN8 A;  4AB5 A;  2XXY A;  1XHY A;  1M5B A;  4P11 A;  3GBB A;  3L6H A;  1HSE A;  1XC1 A;  1Y4C A;  2QL3 A;  4YMA A;  3OXN A;  3W15 C;  1I6B A;  2R6G E;  4C1U A;  4BDM A;  3TEL A;  3RNN A;  1POY 1;  3N6U A;  1B1X A;  1VR5 A;  4RPO A;  3CVG A;  4KD5 A;  3MVX A;  1UTB B;  5JTY B;  1S50 A;  2F97 A;  4ZZE A;  1B32 A;  4XKQ A;  1D9Y A;  1MQG A;  4EF2 A;  3O29 A;  1UQW A;  3Q27 A;  1UTH A;  1IUD A;  1UTB A;  5JTY A;  3IOU A;  2IA4 A;  1N3W A;  5ICT A;  2O69 A;  3KN3 A;  4LQ2 A;  4LQ5 A;  1LCT A;  2W7Y A;  3UOR A;  5AA2 D;  3FJM A;  4G8N A;  1B52 A;  1FTJ A;  4FOR A;  5AE4 A;  3VFJ A;  1TWY A;  2NUV A;  2FNC A;  1US4 A;  3P7I A;  5IAI A;  4OWD A;  4KCC A;  4F3G A;  5I2N B;  3O6I A;  4RK9 A;  2DYX A;  4H67 A;  1YTV A;  3LC8 A;  3LSW A;  4M1V A;  2LAO A;  2F5X A;  3OEL A;  1S7Y A;  4EQB A;  5L8D A;  1URS A;  1MDP 1;  4I62 A;  1PB9 A;  1F9B A;  1OIB A;  4HW8 A;  4H8I A;  3RGY A;  4GL8 A;  3LBS A;  1QKB A;  3T96 B;  5A5X A;  1PC3 A;  3H03 A;  3G3F A;  4RNS A;  3S2V A;  3SEX A;  4G8H A;  5AA2 A;  4OTE A;  2Y84 A;  3HV1 A;  3MZ9 A;  5EYF A;  3MW0 A;  3WAF A;  2VHA A;  2FYI A;  1B6H A;  2UYE A;  3FVG A;  2ANJ A;  3FXR A;  3KJ7 A;  3FUZ A;  5H8N B;  1NNP A;  1NNK A;  1MS7 A;  4ELO A;  3DP6 A;  2O51 A;  2ZYN A;  4ESW A;  3S9N C;  2I0C A;  2UXA A;  1JEV A;  5ELV A;  5H8N A;  4QFO A;  4F31 B;  4FEC A;  4Q30 B;  2UVG A;  3VLV A;  1N84 A;  4M4G A;  4ECF A;  3C33 A;  3LR1 A;  1OMP A;  3DEL B;  4ND9 A;  3RLF E;  3ZS6 A;  4ZEK A;  2ZNU A;  2A5T B;  1Y3Q A;  3IOV A;  2NVU B;  3VXC A;  4BDO A;  3RUM A;  3TTK A;  1TFA A;  4ZDM A;  4ZE8 A;  3PPN A;  2A5T A;  1OVB A;  1LFG A;  5EHM A;  3KZG A;  5CBS A;  2UVH A;  3SEU A;  4PFT A;  1A54 A;  1PEB A;  1LAF E;  5K2Y A;  2DVZ A;  2Q89 A;  4LON B;  3MZB A;  4IO7 A;  4OHN A;  1MY0 A;  3UA8 A;  4H8J A;  2NOO A;  2XXW A;  4PE5 B;  1LST A;  2Z22 A;  1AH5 A;  4IB2 A;  3N5L A;  1RYO A;  3UK4 A;  2UVJ A;  4HCW A;  5L9O A;  4F1V A;  2UYF A;  1MXU A;  3FJG A;  1JQF A;  1USY H;  3MBP A;  4YIC A;  2RC8 A;  1ATG A;  1VE4 A;  3IB2 A;  3T9X B;  4YAH X;  4YKJ A;  2ONK E;  3CG1 A;  5FHM A;  4GF8 A;  1R9L A;  1QJM A;  1SW1 A;  5CMC A;  1MPC A;  5DVI A;  3C4M A;  4NF6 B;  4IGT A;  3VLU A;  4OZ9 A;  5FTH A;  4BDN A;  3TMG A;  1EZ9 A;  2ZMB A;  1SI1 A;  3MWB A;  4XXU A;  1II5 A;  4NF6 A;  1BP5 A;  2Y7P A;  4MH5 A;  1B40 A;  2QS4 A;  2F36 A;  2RKM A;  4R75 A;  1B3F A;  2CMO A;  2ESN A;  3QAX A;  4FJP A;  2O1L A;  2HCA A;  3OO7 A;  5I2K A;  4UAC A;  1AOV A;  2ZNS A;  5TPA B;  3TCG A;  3EQ1 A;  4G68 B;  1DTZ A;  1HSJ A;  3K1P A;  5TU0 A;  2V3T A;  3UIF A;  1Q35 A;  1MQJ A;  4GVO A;  2QS3 A;  4EUO A;  1GGG A;  5ITO A;  1ZMG A;  3MP8 A;  4BLA A;  4IO3 A;  4GD5 A;  2YLN A;  3KOT A;  4TOZ A;  5TPA A;  3G7W A;  4G68 A;  4R74 A;  4H0W A;  2HFB A;  4EF1 A;  1XS5 A;  4YZZ A;  4O3B A;  1B3G A;  4GWO A;  2RCB A;  1DPP A;  1Y20 A;  3IJX B;  4N6P A;  2O7I A;  4EXK A;  4KI0 E;  4L17 A;  1FTL A;  3PD9 A;  5CC2 A;  1BTJ A;  2I0B A;  3USD A;  3CFZ A;  2I58 A;  1NKX A;  5I59 B;  5J1D A;  1VFE A;  2XXQ A;  3THI A;  1Z7M E;  1N04 A;  2H9B A;  4G68 C;  1HSL A;  1B51 A;  1IIW A;  2ONR A;  2HAV A;  4DIG A;  1LBC A;  3KGC A;  2R71 A;  4TLL B;  4E0W A;  5I59 A;  2F35 A;  2BJJ X;  4IO4 A;  1O7T A;  2VD2 A;  3R7X A;  3PPO A;  3H4Z A;  4LUB A;  2OBG A;  3QIM A;  5CBR A;  3CFL A;  1LLS A;  3GBA A;  2B65 A;  5DEX B;  1IXH A;  3GZG A;  3BBR A;  1MY2 A;  3PUX E;  4YKP A;  3D4C A;  1YPN A;  4JWX A;  2P2A A;  3RT6 B;  2HAU A;  1NH7 A;  4HS7 A;  4F2Q A;  3SET A;  3G3G A;  4H5G A;  2OK2 A;  1LCF A;  5DEX A;  4OFO A;  1SQY A;  1SYI A;  1R9Q A;  1MH3 A;  2E0S A;  1LB9 A;  2F34 A;  4N07 A;  4JDF A;  2P0S A;  3GLB A;  1OLA A;  5CMB A;  1N76 A;  4P0I A;  2X7P A;  3CR9 A;  3O2A A;  1FTK A;  1Y9U A;  1FQE A;  3PD8 A;  3O6G A;  1XT8 A;  2KLF A;  4KYS A;  4EQ7 A;  2X7Q A;  3K0V A;  4RPN A;  4QFK A;  5CI5 A;  2I4C A;  3LSF B;  2Z8D A;  4FIM A;  2I3W A;  2F6P A;  1MH4 A;  4OMB A;  5JK4 A;  4GFR A;  3DP8 A;  4BDR A;  4WXJ A;  3BKI B;  2X26 A;  2XXX A;  3R6U A;  2Q2C A;  4ZS9 A;  3M3K A;  4TQU Q;  5I58 B;  3VVE A;  4ZZA A;  5BUU A;  1MXZ A;  1MPD A;  2OZZ A;  2XX7 A;  3T93 B;  2DVC A;  1QUJ A;  3FV2 A;  1LAX A;  4HCY A;  1QW0 A;  3OSR A;  3PU5 A;  2XD2 A;  2O7U A;  5I58 A;  2V84 A;  1UTH B;  4C0R A;  2UVI A;  2AL5 A;  2HZL A;  2PT2 A;  1ZIU A;  2XXI A;  4NF4 A;  1ANF A;  3OO6 A;  4JWO A;  2FA7 A;  1OVT A;  1NNT A;  2ZNT A;  3SER A;  1I6A A;  1B0H A;  5DTB A;  3GXA A;  3LSL A;  4QRZ A;  1D3K A;  1A55 A;  4I1D A;  1O63 A;  3G3H A;  4WED A;  3MPL A;  1JVY A;  4LZ5 A;  3TPA A;  1B5H A;  1KWH A;  5H8F B;  1VFD A;  5A5X B;  2XD3 A;  3V89 B;  2ALU A;  3K6V A;  2GFE A;  3KSX A;  1LFI A;  3ILT B;  1A40 A;  3MZ1 A;  5AA2 B;  1OQH A;  4JSD A;  3O6H A;  3HO7 A;  3G3K A;  3BFT A;  3H3G A;  5H8F A;  3N6T A;  2QS1 A;  1QKA A;  1MPB A;  4NED A;  2QSX A;  4PET A;  2NXO A;  1JEU A;  4NMY A;  1PBP A;  3KG2 A;  2OWS A;  4KYD A;  4R2F A;  3HST A;  1Y1Z A;  4F22 A;  1N3X A;  4FAT A;  5FHN A;  1B58 A;  1B4H A;  2XX9 A;  1LGB C;  3RY3 A;  5B7D A;  4OVJ A;  3D4G A;  1WVJ A;  3CIJ A;  4U1Z A;  3BFU A;  1MY1 A;  2F6G A;  3IOW A;  2F8D A;  3FVK A;  1SD3 A;  4QSC A;  5ITP A;  4KQP A;  3TUS A;  3FXQ A;  2Q9T A;  4YMB A;  3EHS A;  1MDQ A;  5F1Q A;  2WKY A;  1P1U A;  3EN3 A;  1URG A;  3M3F A;  4GXA A;  4LP2 B;  2XHD A;  4QSE A;  4OEU A;  4F3P A;  1B05 A;  3MPK A;  1N7W A;  1USY E;  1IEJ A;  2H5Y A;  3U8Q A;  1DPE A;  2ZYK A;  4U1O A;  2Q88 A;  4EXL A;  3EHT A;  4KYE A;  4NF5 B;  1N0T A;  2QMW A;  3K02 A;  2Q8J A;  2G93 A;  3FD3 A;  4GL0 A;  1DSN A;  1MY4 A;  4F29 A;  4DDD A;  5L9S A;  5I56 B;  4NF5 A;  3LUY A;  1NNF A;  1D9V A;  5HM4 B;  4DLD A;  3W9W A;  4R9F A;  1P99 A;  3VDF A;  3OD7 A;  3MJN A;  3TDJ A;  3TTN A;  5I84 A;  3SES A;  3ODB A;  5I56 A;  1SVX B;  1S9T A;  1SYH A;  4PP0 A;  3CSB A;  4AB6 A;  4F1U A;  2XXU A;  4ONY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...