4NFBA

Structure of paired immunoglobulin-like type 2 receptor (pilr )
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
120
structure length
120
Chain Sequence
b'MLYGVTQPKHLSASMGGSVEIPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFLNWTEGQKSGFLRISNLQKQDQSVYFCRVELDTRSSGRQQWQSIEGTKLSIT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Paired immunoglobulin-like type 2 receptor alpha
publication title PILR alpha and PILR beta have a siglec fold and provide the basis of binding to sialic acid
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 29
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2013-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nfbA00
5KANG 2NX5E 2ZUVA 1RUMH 4NFBA 1BLNB 5D2LF 4L3AA 4JHAH 3EJYC 3ZKNC 4PB9L 3L7FA 5B38G 3TBTA 4L4TB 3MGTB 4DEPB 2XV6B 2E6PA 4YX2L 3RKDC 3NFNA 3Q0HA 1ZLVH 3TVMA 3ARSA 2IAND 3U46A 5SWZE 1BFOB 5EOTA 5LQBL 3JV0A 1V7NH 1QSFA 4Y5YC 1I4FA 3PXJA 1CZ8H 1S7VA 1E4WH 3JTSA 1PYWA 3QH3B 4Z0BH 4HULB 5DT1H 1IGFH 5DRZA 4HGKC 5T3ZD 5I1DA 2C26A 4O58H 1GGBL 3ZKMD 5B39A 1W0VA 2ATKA 5C86A 1OAKL 3GI8L 3IU3A 5T5FH 43CAB 3I3BA 2J3SA 5KANI 4WDIB 3WS3B 1YEJL 1FNGA 1U93B 2GUOB 3INUH 2NLJA 25C8L 4U1IA 1TVBB 3KPRE 3VFOA 1G7LB 1NKRA 3O0RH 3GJFK 4ODWB 4NQCB 1ED3B 4L9LB 5ITBH 3KDMA 1B2WL 1SYSA 1UM6L 1H3PH 1MREH 1ZLWH 1EFXA 5JZ7D 2BC4A 4P46A 2L4OA 4K71B 5GQBA 4XMLH 2A9MH 5FGSA 4NHUA 4O02H 1TETH 3DMMB 3KJ4B 1L0YA 3MODH 1AO7B 2ZOKB 1AFVH 4P9HC 5EFIB 4LHUB 4G8EA 4O2EA 4QRTB 4OF8A 4QT5B 1ZKAA 5GSVB 4M6ML 3O4OB 3T3ME 1U58A 2OI9B 3MREA 4GAJH 1A9BB 2C3VA 2UUDH 5BV7L 2IFFL 2YN5A 3FTGB 3ARED 1JE6A 2XTJB 1MAML 2R4RH 5TF1L 2DLHA 1MQKL 3DYOA 5MI0B 3TZVA 1U91B 4BSWA 2D7MA 4RAVB 1ORQB 4HBQA 3S96A 3CVHA 4IOFC 1T6VN 5ESQB 1CDHA 4FTVB 2CUMA 4UB0H 4IRZL 2I60L 3DI2B 4UUJA 4XWOC 4JN1H 4NZTL 4ZMAT 1MCHA 4JFYB 1RJYA 1YC8A 1RFDL 4N0FB 1KNOB 2VZOA 5KSUB 2X70A 3AVEA 5F7KC 2R2CA 1ZGLA 4X7SL 5AZ2H 2D7PA 1I1AC 3ZTNH 3V5DA 2GFBB 2WIMA 3D39E 1VKXA 3IB4A 4J4PA 3PGCA 2APXA 2VDRL 2NW3A 4NBZB 5ILTH 1JGVH 4OGAD 4OZGB 4WGVB 2RFXB 5DJDA 1NL0L 1X3DA 4HS6B 4DZ8A 4M62H 5EZLB 3FO1A 1AQDA 3N1FC 1W72H 4PRID 1L9MA 5F9DC 1L0QA 3JV5A 3WUWA 5H37H 3LPWA 2W60A 5GGUA 4FXKA 4KHTL 1RZKL 3OR6A 2IBBA 4WWKC 5JW3L 5KS9A 1AXSA 4MMZC 1SJEA 1LO2H 2DYPB 1KB9J 4FQ1H 1UJ3C 5FFLA 4HKJB 5AYUH 1PW3A 2JJTA 2BHUA 1FORL 5CP3H 3L3JB 1DEEA 3HPJA 3TT1L 5FXCH 3NCJH 2DI7A 4N9GB 3HC0A 4RBPH 1DLFH 5DD0H 3RWEB 2W9EH 5D1XB 5KN5B 5IROA 4XRCA 3SDXA 4QTIL 2HWZH 1F11A 1U3HA 3NFPB 4JRXD 4L3CA 2R69L 1N7ML 3GJFH 3TWCL 3SGDH 5GS1A 3Q3GB 3MJ9H 5EU6E 3C5SB 4M7ZC 4OKVA 1RZJL 4N5EC 1FZJB 3S34L 1CXKA 2IQAB 2XKUA 1MVFA 1Y6NR 1KG0A 2DMCA 4ZFOB 4UQ2A 3DV4B 1MCWW 2VDLL 2YK1H 3DRQB 3OGOE 5HYIA 1R3LA 3THMH 5ISZD 3PL6A 3SKJL 2F5BL 1LO5B 3O2DL 4PJEB 1UXSA 1L9NA 2X1PA 3ALXA 3IJYA 2D4DA 3OHXA 5GRUH 4PY7B 3FFCA 1OAUH 2EYSB 1S7WB 2FECL 4NNYA 1NKOA 1FFOA 5MENB 32C2B 5EU5A 5GS0C 1GZPB 4KVCL 1Z0NA 4OGXL 1WAAE 4WFHE 1EK3A 3ZDYF 2V7NA 5IBLD 3BGAA 4GO6B 3ZYZA 1YYMH 3LS4L 4HJ0C 2V7HA 4LRNL 4CJ1A 3U7AA 3CJJA 1A4JB 1QSEA 3WLWD 4NGHH 4PV9A 2BRRH 3O4LA 1MCFA 2DMBA 4DQOH 3TO4B 5IFJA 3UTQA 1R3JB 5C6TH 3VG0L 1XGRB 1V7ML 2GY7B 4AEIL 4KC3B 3G5VB 3K7UA 4XCEA 3V6OE 1YEIL 3HCVA 1I8LC 5HGDB 5C71A 1A6AA 5HJ3A 4HZAA 1WWCA 3U0TA 1GJIA 4RGMB 2VDPH 1A2YA 2JJWA 2Q8AL 2DQIH 2YRPA 3GGWB 5IBTL 2VUOA 2DQGH 1XF5A 5FB8A 1P6AB 1NCBL 2F74A 5D7KD 2AKRB 2YD2A 4I5BA 3DGGA 1QRNA 4NZRL 1DN0A 3F12A 5GGTL 5BRZE 2ZUYA 3S6CA 4HXAL 2ADFH 3SGKC 2P43B 1DBAL 5CSZA 1S5IL 3BAEL 2FJFA 1OTTC 1KJMB 3B9KB 3LN9A 3RTQC 3VCLA 4OM0H 3QUXC 4P2OD 4S1DC 5DD1H 1FAIL 3VXSD 2XNAB 5C0EA 5EC1A 2HJFB 1IQWL 4O2CA 5FOBA 2HLAA 1KJVB 2VLLB 4RGOL 1HEZA 4JHZA 3QFJD 5IFHH 3EDEA 1CLOH 4FQLH 5KSAD 1U8NA 4OZ4B 4C59B 4HKBA 3VFGH 5D1QB 3CU1A 5BOPA 3BESR 2QV2A 5DRWB 5LXGH 2P8PB 5DJZA 3BFOA 4Z7VE 5I8CB 3Q5OA 1INEH 4TNWF 4LLMB 3MRIA 2YBRB 3NIDE 5LGJA 5GJSL 2YKLL 5EZJA 1HXYB 2IFGA 4ZFFB 4PJFA 2D31A 3EO0B 2XZAH 4IOIB 3BH9B 1ZANH 4PUBH 3IJHB 1MCKA 2HT3C 1TQBB 4U31A 3P4NA 3VXUD 1QTYT 3T2NH 1FL6A 2W9LA 3LIZL 4DZBB 5M94B 5I66B 5J1TC 1RMFL 2ADIA 1KCSL 4UNTA 1BP3B 1D6EA 4J3UA 2P5WE 5FUOH 5EUOF 4ELMA 1A7OL 2DQFB 3BGMA 4NQXA 4TVPE 4ODTL 4XNQA 2W59A 5I15H 4CNIA 3PHOA 3N06B 3QXAB 2HVKB 4MAYA 1A7RL 1CR9H 3QDMA 3OKMB 4JFQB 2Z93A 2DQEH 4PJHA 4CVZB 4WEBH 1UH2A 4HJJL 5D7LD 3V6OC 3MBEA 1EAJA 3S88L 3RY5A 5C09A 3EYUL 3IAQA 5FK9B 2LAAA 3V0WH 3T08A 4PJDB 1AGCB 3IDMB 3MLXL 4MNQA 5TFSL 4AG4L 1FO0A 2EYTB 4B50A 1LO0L 4C4KO 1TZIA 1I1YA 4G42A 4JREB 5FM8A 4B53A 3AXLA 1HK6A 3DIFA 4CVWA 3O3AB 3GIVA 1ZAGA 2F54D 1XF1A 3ARGA 5D7IF 2ICEA 5FYLH 2MQ3A 3S4SG 3RA7L 3O11A 3SGJA 3SDAD 1N3NA 1XCTB 3DUSA 3Q1SH 3QDJB 1AC0A 5D7JC 2X4NA 5GGSY 2AXFB 5J12B 3D2UD 2EH8L 1KFAH 3WBDA 3KPQB 4YDKL 3RVUC 2XWBB 1VDGA 1ACZA 4GG6F 2FIKA 4I2XB 4HEPG 4U3HA 4Y4HC 5GHWL 1F58H 1AHWB 4PJCF 1CXFA 3NH7L 4ALAL 3VXTB 3ARVA 1T04B 4JFFB 5E4IA 3ARZA 2YN3A 1FFNB 3VRJA 4GRWE 5E5MB 3VDAA 4P2RA 1JV5A 1W0WA 5GS3A 3A6BH 3ULVC 1U6AL 1GGTA 1WC7B 2MHAB 4PY8I 2E7LC 2OX5A 2FATH 4KAQH 3D3VA 2P4AB 1B0WA 2JCCE 3IFPA 2VZSA 3MOBH 1JYVA 1NCUA 2F19L 1DLHA 2M1KA 3ELAT 2X4TA 4ODHL 4NJAL 5I76A 5T3ZE 1BBJA 3TBTB 2AXHA 4KHXL 3BN9C 5JW4R 3OAUL 1MCCA 3N0PB 5LGKA 3H42L 2NY0C 3PGFH 3NFNB 4OIAA 2OJZL 1PY9A 3TVMB 1NLBL 5C3LD 4HIXH 3U46B 5K9JH 1NMAH 4XB8A 5EOTB 5I8KL 2Y36L 1QSFB 2CGRH 4W68A 3TJEH 4OB5H 4N0RA 1I4FB 1S7VB 3JTSB 4WWKA 5C08D 2IBGA 5JXED 5DRZB 5C0CD 3T0VA 1KT2A 3WIIH 4LSUH 2HFEA 5DGQA 4M1GL 3CFKA 5B39B 1W0VB 2ATKB 1D9KD 3ZHLA 3IU3B 3IFNH 4UDTA 2P5ED 1HH9A 1FNGB 2DI8A 4F8TA 5D93C 3CSGA 2EEAA 2NLJB 4NWUL 1JHKL 5DZLA 2CRYA 4JPWH 5GRVK 4OCXL 3TH2T 3O9WA 5DA0B 3ULUD 4FFZL 4QHNA 1G9MC 2YD4A 4HPOL 1J0IA 1SYSB 4ZFGL 3ARFC 4JM2F 1EFXB 1ZE3C 2APTA 1HXMA 2BC4B 4P46B 4KTDH 4NHUB 3G6JB 1UZ6F 5EO1A 4HLZH 2AS5M 5C0AA 5DQDL 4JVPA 4GQ9L 4OZHE 4RZCA 4O2EB 4Z7OF 3X11A 1X4YA 3BSZH 2QEJA 4UV4L 1IGJA 2OS7A 3WFDL 3MJGX 3OMZA 5A40E 4X7FC 1TPXB 4PJXE 3MREB 5B3JF 2R0KH 3GSXA 4P23B 1U8QA 2C3VB 3ROOA 2ESVA 1TTFA 3PABB 3W9EA 5IB5A 2APWA 3TZVB 1T7XA 3L9RA 4BSWB 4NHCH 4GFTB 4M6NL 3S96B 5D6CA 3CVHB 3UTPD 3U9UA 2E7MA 3RWFA 1NSNL 3BKYH 1AI1H 5KVDH 2NY4B 1FHGA 1CVRA 4OBSA 4MMXC 4NQEA 1IC4L 4YC2C 1DQMH 5D9SB 1KULA 4H88H 4HUWB 1RJYB 4JFDD 2DLFL 2IAMD 5JOFA 4F15C 4IRJC 4M7KL 3I2CL 1ZGLB 2XWJA 3ZT6A 3VFRA 3V4VH 3VW3L 3C2AL 3K4ZA 2QHRH 3PGCB 2NW3B 3ZYJA 4OLZL 1JBJA 4DZ8B 4L4VD 1N59B 1JZ8A 3KPSA 3IDIB 3FO1B 1AQDB 3U1SL 4BKLA 1FIGL 1GRWA 2F53A 1VFMA 1BMGA 3GMMA 4ZUTA 4PJGF 2M2DA 3WUWB 1WJ3A 3IDGB 5LGHL 4X5XA 5GGUB 1ZV5A 4FXKB 3T65A 3OR6B 4XC3L 5FCSH 5KS9B 1AXSB 2B4CC 4NQVA 1SJEB 3HZKA 1FCGA 5IV2A 5CBEA 2QHLA 3OBAA 3MLVL 4TVPH 2E6QA 1WLHA 2X5PA 1F90H 2OTPA 3QEQA 4JRXE 4U1MA 5GJTH 4WW2F 1GGIL 2FSEA 3BP5A 1AR2A 3QFDA 1DEEB 3DO7A 4L4JA 1OVZA 5ITFA 3HC0B 3C5JA 4TNVF 4F57H 2FECI 3ZE0E 2PXYD 4YDVA 3ULSA 4XRCB 1Q0XL 4LNRB 3SDXB 1F11B 5GGTA 1QFWH 3OR7A 4L3CB 5DLML 1CDGA 1EMTH 5KVEH 4NKIH 4NO0B 3W5NA 3OJ2C 5GS1B 2F8VA 4OKVB 1EJOL 3IYLW 5GGRB 3DSFH 4XMKL 1KG0B 4NZUL 4UQ2B 2HRPH 5SWSA 5FCUL 4R0LC 3PL6B 5DWUL 4LU5L 4E0RA 4QXGH 1REIA 5IWLC 1RUQH 4JDVA 3IJYB 3OHXB 4K8RH 4Q9QL 3PP3K 1S9YA 4DVRL 2HG5A 3RZCD 1TJHL 3CK0L 1T1XB 4NNYB 1FFOB 2VLRB 1RD6A 1KSRA 3SO5A 1QD0A 4X98A 2VWEC 3VXQA 4LIQE 1LHZA 1BFVH 1OP9A 3WHE0 2V7NB 4FFYL 4N1CA 1YEFL 5J56B 3HNTH 2V7HB 2WAHA 3H9SD 1V5JA 4GRWH 4G8GA 1QSEB 3WFHA 4PV9B 3CZJA 3WKMH 3O4LB 2CKNA 1L0XA 4NO2B 5INCA 3UTQB 5IFJB 3WXWH 5L6YH 3W0WD 4YBQD 5D7KE 3RJQB 4BFEA 2FX7H 2YUXA 4K9EH 4XCEB 2R0WL 1DQTA 4QWWC 3AAZB 1A6AB 5F9WC 5HJ3B 2FGZA 2DN7A 3H3KA 5T3ZH 3U0TB 2DQJL 2K3TA 4KI1A 1A2YB 3U30C 4D9LH 4RX4D 1XF5B 5FB8B 2FGWH 1ADQH 2CJUH 3NA9H 3SCMD 1EFQA 3DGGB 3VXSE 4X7CC 5AAMA 4Z7WF 4UINL 1VHPA 2D2OA 3FOMA 2RCSL 4ZXBA 5CIPB 5CSZB 4U6VL 5IVXE 2FJFB 1GOHA 1VPOH 1FDLH 1XF4A 5E8DL 4FZ8L 1A1NA 5DF0A 3VCLB 1CD0A 2F58H 2HTLC 1WWAX 5C0EB 1QO3A 4HV8A 1OPGH 4X9FA 5FOBB 2HLAB 5D2LE 4ZS7H 4DGYH 1HEZB 2V5MA 3ZHKA 3UC0H 3BISA 2G60H 1U8NB 4Z0XA 2P46B 3VXUE 3WKNA 4RGND 4JFED 4KKBC 4YHLL 2D9CA 3MV8D 2A1WL 4ZNCD 2IQ9H 5LGJB 5EZJB 4PJFB 1UENA 4TUKL 2D31B 4JO3L 5E5RB 1KLFA 3CMGA 4K3JL 5SX5K 3VGGA 5CJOL 4AEEA 2V9RA 1VEOA 3TIDB 4JB9L 4KPHH 2W65A 4K3DL 4NN7C 3P4NB 1VFUA 1XR8B 3EYOA 3QO0A 3QXUA 3VXME 1GVIA 3JWOC 1D6VL 3KPMA 3LKOA 2WANA 2VDQL 5DFWH 4BFGA 3N85H 4MJIA 5DC4B 3RL1B 4X5WA 2ADIB 4GBXC 1NBQA 1JGLL 1WK0A 2YD8A 3SKUD 3UTOA 4IOSD 4LFHG 4HIHA 3WJLA 1D6EB 5K9OA 4G6AC 4ELMB 4KMQA 2Y23A 3OV6A 3BGMB 4XNQB 5DURD 1G9EA 4AL8L 4CNIB 3PHOB 4LF3A 1JNLL 1KV3A 5DHVA 4MAYB 4AH2A 3F7QA 4L29A 4ZTOL 2M8XA 4FQIL 2RAMA 3N9GL 1ACYL 1JHLH 3QDMB 2Z93B 4PJHB 5CBAA 3L5JA 3MBEB 1JZ5A 3WO3B 3AS0A 5C09B 3BKJL 4ONOA 5L8LB 2F54E 4QXUH 3V95A 3GMOB 5DVOA 2I5YH 4MNQB 3G6DH 4JM2D 3BX7C 1FO0B 2FEDC 4IRSD 1UKQA 2NR6C 3MRDA 1TZIB 4G42B 1T89A 3LQAC 5EB9A 1UWGH 2J8UF 3V8OA 3PNWB 5JW4Q 4EQ2A 3AXLB 4C55A 3DIFB 1S7UB 1A4KA 3GIVB 4FNLH 4P3WA 3ARGB 5BZWA 2ICEB 3DVNA 4HZLA 3QIBA 1R6VA 1N3NB 1LE9A 1UJTA 3RPIA 2X4NB 2CIIA 5A2KH 1KEMH 4NZDA 5ID1A 5F72S 1X5YA 1UCBL 1RK1A 2FD6L 2FIKB 4XP4L 1JRHH 3C60C 4NRYA 2H2PC 4S0TD 1X9QA 3WD5H 3C5ZA 2VC2L 1J0KA 3MRLA 3TA3A 1G6RL 1MHPH 1VSCA 2ED7A 3TN0A 4PTTA 4G3YH 4QF1A 5KVFH 2AI0L 1JV5B 1RZFL 1W0WB 2A74B 5DD3H 4ZD3H 1VFOA 4R9HA 4JDTL 2WWMD 5I6XB 2VLKA 2XRAL 2HT2D 2P49B 5CKGA 5AZEL 1YMMA 3D3VB 2BHZA 4HK3J 2DLEA 3MRQA 1IGML 1FG9C 2R4SL 4WGWB 4DKFH 4Z7UF 1DLHB 1KCVH 4K7PH 3PQYA 4TTDD 1BBJB 4OZIF 1EBPA 1RUML 1TZGH 2YXMA 1MLCB 4QGTA 4JHAL 4LVNC 2P5EE 1M6OA 1JWUA 4BQ9A 4C83A 5SX5H 1F5WA 4WWKB 1KT2B 1V7NL 3UBXG 1G7IA 2ICES 1CZ8L 1E4WL 4Z0BL 1IGFL 1FBIH 1UQSA 2Q86A 1TJIH 2LABA 4LIQH 4LP5A 1HH9B 3LEYH 4O58L 4ENED 5HGBA 4WUUD 3DHJA 1JVKA 3FQUA 1IAIM 5GIRB 1ITBB 1A0QH 5T5FL 3ZLQC 1NC4A 3WHXB 2DB8A 3O9WB 1WF5A 5BOZG 4QHNB 3INUL 4FQ2H 2ZSVB 1B4RA 3O0RL 4NKOA 4O5LL 2ZCHH 1HXMB 4R26H 5ITBL 4Y19A 4N8CH 5JMOC 3BMVA 1T1YA 1H3PL 1Q94A 1MREL 5EO1B 1S3KL 4M7ZB 4WENB 5AD0B 5C0AB 5HGHB 4PRHA 3RUGA 4ZS6D 1JNHA 2A9ML 4XMLL 4LLYA 4RZCB 3VRIA 5GZOC 4O02L 1K8DA 3WDIA 3X11B 2JE8A 3QCVH 1TETL 2NY5H 1IGJB 3MODL 4WI5A 1HKLH 3KHOA 1AFVL 3UTPE 4R0LA 5I19H 1TNMA 3LQAH 1P1ZB 3QXTA 1MUJA 3ZDYE 2VITA 3BGFC 3ROOB 1U8HA 1J5OH 2ESVB 2GK2A 4RDQG 3W9EB 2JJUA 4GAJL 5IB5B 1NGWA 1U3HD 3D0VA 3L9RB 2EIBA 2RGSA 4JFDE 2FEEL 5D6CB 5IOPA 3U7WL 4B41A 3MRMB 1GAFH 4HUNB 2X9WA 4H26A 2DM2A 2NY6D 3V6FA 4G6JH 4S1RH 4NQEB 5DD5H 1HHJB 4UU9A 1UB5B 5IB2A 5IW6A 4UB0L 5CJQH 4N5UA 1AD0A 2VZ3A 5JOFB 4UQ3A 5E00A 1U92A 1S7QA 3ZZ1A 4PJ7A 2XWJB 3FFCD 2LE9A 4MZ2A 3V0AC 3VFRB 5FO8A 4PJ5A 2HKFH 2LTQB 5IQ7H 5AZ2L 3ZTNL 3KLSA 3KPSB 4BKLB 5KOMC 2R15A 2F53B 3GHBH 1IZKA 1EHLH 5ILTL 3GMMB 1JGVL 3GIZH 4M62L 4MVBC 5ACZA 1W72L 3PWVA 4NQVB 3HZKB 1YUHA 3BW9A 4FFWC 3V2AR 5IV2B 2E7BA 3LB6C 2QLVB 5CBEB 3HG1E 1YEEH 4U1MB 2FSEB 3HZYA 3QFDB 4V1DE 1I8KA 3NABH 1LO2L 4FQ1L 3W39A 3DO7B 1T03H 4QRRE 3RI5F 4KKAC 2K7QA 5AYUL 4LLVA 3C5JB 3QISA 2VH5H 3MRHA 4DGIL 5L7XH 5CS7A 1VADA 1OOAA 4OTXH 3NCJL 5C1MB 1ZGLP 4RMSA 4M5ZH 3ULSB 1PQZA 1DQLH 5HHMB 3OKEB 2BJMH 2H2SD 4HWBH 5DD0L 2BNRB 1QRND 3F7RA 3OR7B 3QUMH 4YHNA 2W9EL 4PLJD 1BD2D 2FBJH 3H3BC 5E6IC 3AU1A 2R2EA 2HWZL 2FIRT 4F9LC 5I30L 1NFDF 4JRYD 3U7YH 3HE6A 5CSGA 3VD9A 1B3JA 2OSLA 4WTWA 2JF1A 2MPAH 1JZ7A 3QRFM 1HYRC 3BUTA 3MJ9L 5EUOE 5SWSB 4JHBA 2BOCA 2Z31D 5I75C 4PJ9D 4E0RB 4FQXC 1BAFH 1XCQA 4JDVB 2YK1L 3WNPA 1S9YB 3WLBA 5JORA 2VLJA 3NCCB 4MB5A 3UZEA 4DKAA 4JLRA 2QSTA 4OD1H 4WI2A 4X98B 1OAUL 3HE7C 3VXQB 2WWKO 2EEDA 5HDQH 1SY6A 5E08H 2EE9A 4G8GB 3CAFA 3WFHB 3C8HA 4PJIE 1TVDA 5INCB 4MQ7A 5BXFA 3MUGA 5D7IE 4NGHL 1KGCD 1P4BH 2BRRL 2D4FA 1KLUA 4DQOL 5DJCA 3VXRE 3QUZC 3P9WB 5C6TL 5FDYA 2A83B 3OX8A 4U1JA 5FEBA 3FQXA 1I9JL 3BUYA 4PRNA 4R97B 1S5HA 4RA0C 4X6EA 4OF6A 2VN7A 2VDPL 4POZC 4PJCE 5IVOA 4XNXH 2DQIL 5F7LB 2DQGL 3FOMB 3HNSH 5JO5A 1BM3H 3T0EC 3ZYIA 4MJ2A 1FL5A 3NGBC 1A1NB 1FNLA 4TNWK 4GAYA 1NH6A 2VSCA 1MLBA 4JFEE 3V5KA 3K81A 2CR3A 3MV8E 3SDYH 3TH4T 3OXRA 5CZVH 4OM0L 1YDPA 1ZS8B 3PWUA 4Z6AT 3ARWA 4HV8B 1G6VK 3LMJH 4X8XA 4K3GA 1M05B 3ECBA 3HAEH 4HS8L 4OZFG 3S36X 4K3HA 4Y5VA 4Z0XB 1FNAA 4LARH 1GSMA 2AXGA 5IFHL 2LV4A 4LBEB 4FQLL 4QHMA 4K3EL 3VFGL 4D0BA 5GGVH 5EOQH 4L8CA 1BEYH 5LXGL 4N8VA 1GGYA 1INEL 1UZ8A 2NYYD 3G9VA 2NW2A 1QFHA 2W65B 2XN9D 3EYOB 4X4YA 3OGCA 1ZANL 4PUBL 4MJIB 4P2RD 4X5WB 3T2NL 3HMXH 4HIHB 5TQ0H 1Q9KA 3CXHJ 5K9OB 4WO4C 1D5IH 5B8CA 1TZHA 2CLRA 1HE7A 2KDGA 2XZQH 5DHVB 3IF1A 5FUOL 4AH2B 3KNBA 4L29B 4OZGF 5D93B 4JCMA 5F89A 5I15L 5C07D 4E5XA 2BDNH 3N1MC 1MSPA 1UZ6E 5I17A 3T4AA 5FYKD 5CBAB 2FJGA 3KLAA 5CD3A 3QWRA 1CR9L 1BQUA 4YZFF 4Z7OE 1ITCA 4AY0A 3HMWH 4WEBL 4L8BA 4RMVA 2GSIA 2P1YA 4ETQA 3V0WL 4Z5RB 5B3JE 1UKTA 3F7YB 3WMSA 5HHNB 1FFRA 4LVHC 1S8DA 1R0AH 3MUJA 1A4KB 3DYPA 3C9NA 5IK3A 5BZWB 1CIDA 3BP7A 3DVNB 1T83A 3GMNA 4HZLB 3QIBB 4MNHA 2NXYD 5IFAH 1A64A 3RPIB 3RHWF 4AENA 2PW1A 2Z92A 5FYLL 3P0GB 2HFGH 3KXFA 1MJJA 1WBZA 2CIIB 5MERA 2X7LA 3O6FC 1AXIB 3KPNB 4G9FE 3Q1SL 1NC2A 3S3JA 3I3DA 4DCQB 5ID1B 1WSST 1KEGH 3S37H 5BS0A 5IHLB 1RK1B 3B9DA 4KDTC 1KFAL 4ZUUA 3RIFF 3T77B 4NRYB 1JTTA 5EZOH 3ARDC 4IM8A 5DFVC 1H0DA 3C5ZB 3MLSH 1CGYA 3MRLB 4NUJA 3TA3B 1F58L 3TN0B 8FABA 4PTTB 4QF1B 4PJEF 4WFFE 4L3EA 4JKWA 3GMPA 2EDRA 3FOLA 3AB0B 1CIUA 1YMMB 2NXZB 1OF2A 3MRQB 4IRJB 3PWPE 2AEPH 4PJGE 2EDJA 2YD6A 4LCUA 5EN2A 4LCWD 2FATL 4JFHD 4KAQL 3PQYB 1DDHA 1Q72H 2O5ZH 1OQXA 3MOBL 2NZ9C 4QRPA 5C0NC 3OKNA 2A6JA 3NCFB 1JWUB 1WZMA 2QJDA 2I27N 4C83B 5E8OA 3PGFL 2PTVA 5ESAA 4CGTA 1F13A 4N68A 4HIXL 5K9JL 1NMAL 3RGVA 3BWUC 4X9BA 2CGRL 3TJEL 1N5YL 4OB5L 1G7IB 1BBDH 2NY1D 1UQSB 2Q86B 3WIIL 4LSUL 2AEIT 5HGBB 1I1RA 3IFNL 3MV9D 1NC4B 2CDEA 2QADC 5DJAA 3CDYA 1K4CA 4M48H 4S1QH 1PDKA 1LE5A 1T5XA 3EO1A 4NKOB 4JPWL 1JF1A 2FEEI 4RISH 5HHQA 3TCXA 4Y8DC 5EH1A 2H41A 1KTLA 4Y19B 4F37F 2KKQA 1OGAA 1T1YB 1W72A 1FV1B 1Q94B 3U4EA 3O8XA 2GHWB 3QJHA 3QIWD 4KTDL 4PRHB 1JNHB 4LLYB 2IC2A 3MFFA 1K8DB 2PR4L 4KTEH 2IADA 4C56A 1GC1H 3QEQD 3IU4H 3QUYA 4P2QD 4YDLC 5HGGS 1BFSA 3V52H 5H37G 2PETA 1IE5A 4R0LB 3D18A 2Z8VC 2MFNA 1HOCA 5DYOA 3QJFA 2OBGA 3BSZL 2AJUH 2GT9B 1MUJB 4MAUH 1CFBA 5FUZH 1OAXH 43C9A 4G6MH 3ALWA 1MCOH 4HFUH 1NGWB 3D0VB 4MXQC 1JN6A 2NMSA 3RWCA 4Z77A 1F2QA 1CD9B 1XIWD 1EUUA 4MA1C 4NQDE 4H26B 5J6GA 4XX1G 3EHBD 3OZ9H 1EEZA 3UTTE 3I50H 3E1F1 3BKYL 1AI1L 5KVDL 5IB2B 5IW6B 3TESA 3P9LA 4LOUD 5HHOA 1AD0B 3PV7A 4Z9KB 4P5TC 4UQ3B 1DQML 3QDGA 1KJ2H 1YPZE 4H88L 3BQUA 2W38A 5FO8B 4PJ5B 1FH5H 3LEVH 4WW2C 5KSBA 3U30B 1AGBA 1N5AA 1J0YA 4NCC2 4HDIA 3V4VL 1UWXK 4JQXA 3V7AG 4QOKE 4I0CC 4PJDF 1PFCA 5FYJU 1A22B 1Q38A 2VLMD 4M6AA 5ACZB 3VWKC 2ZNWA 3PWVB 1YUHB 3BW9B 1DE4A 1OLLA 5C0DA 3N50A 1DUZA 1UYWH 8CGTA 4UOJA 2W07A 2AV1A 2OCFD 1I9EA 3HZYB 2G5RA 1I8KB 2VDNH 3HI1A 2B0SH 4JVUA 2EDWA 3LPGA 3W39B 4TVPL 5DA4A 7CGTA 4KDVA 1F90L 5GJTL 2NX5A 1MJ8H 4JRYE 1S7SB 3MRHB 5HPOA 5FM4A 5BVPH 1FAKT 1VADB 4PR5B 4S11A 2J6EH 5T33H 4F57L 4KH2A 2V2WA 4YHNB 4HKZA 3MRPA 1XH3A 4H25A 3DXAD 2FDBP 3HZMA 4ZXBD 3AU1B 2R2EB 1O7VA 1QFWL 2Q20A 2R0LH 5GRVL 4H8WH 1Q0YL 3HE6B 4O9HH 1EMTL 3BD3A 3MOAH 4NKIL 5KVEL 2KPNA 2OSLB 1KXVC 4J3SA 4NOFA 4MQXC 2BOCB 4J7RA 4QHUA 3DSFL 4YBHA 5GGRY 2Q7YA 3R4DA 4XXDA 1XCQB 1CU4H 1FZMA 1KYOK 5DR5H 4Y2DA 3NOIA 4EUPA 4CN4A 3WLBB 1GZQA 4QXGL 4X99A 2PYED 5JORB 4HUMB 2VLJB 4K8RL 1JNNL 4PJ8A 2XACC 3EYQD 4OCMC 2WBJA 3GSNH 1N6VA 4GG8A 3BXNB 3OKYA 1KGCE 3B43A 4LKCB 3LCYA 5A2LH 3WXVH 2PTUA 1TIUA 3IT8D 5E4EC 2LVCA 4OD2A 3EOTH 1BFVL 2VL4A 5MHSD 5FA3A 3SDCD 1RSFA 1N2RA 1AXTH 3FT4A 2KQMA 3HNTL 2J8UE 3NCMA 4LFHD 4LL9A 1F6FB 5J06A 2XI9A 2E3VA 4MQ7B 3H8NA 3MUGB 1WFTA 1Y6KR 2WW8A 4NQSA 3WKML 5E8EA 3TBWB 2UY7A 1KLUB 1FLTX 5DJCB 3B2VH 1B0GB 1UC6A 4NN6B 2R9HC 3WXWL 5L6YL 1T66D 2YEZA 4JQVC 1AJ7L 2FX7L 1NBZA 4K9EL 4NC0B 3FQXB 1MHCA 3BUYB 4PRNB 1DUYA 4LKXB 1S5HB 3BPOC 4X6EB 5T3ZL 1VACB 1B88A 2GITA 1OSZB 2X6MA 1A6UH 4D9LL 3BEVA 4QHKJ 4R4FH 5F7YC 2FGWL 1ADQL 2CJUL 2BVYA 3NA9L 4NSKB 5DVNA 2E8YA 3G6JF 1IEBA 2VZTA 3VGAC 3M8OH 1FL5B 4NC1E 1H15A 4KDTA 3DYMA 2BY0A 3K2MC 3PGDA 1ZHKA 4OI8A 3KYMA 2WK2A 3RL2A 1VPOL 1FDLL 3V5KB 1MI5D 4XNMA 1ERNA 3OXRB 4GRLD 2F58L 4FFVD 3L95A 3PWUB 3GSRA 3CX5K 1IGYA 2OR8A 3DGCR 1S78D 3U0PA 1CE6A 1F02I 3D39A 1CXLA 1SVCP 5DUPH 4OZIE 3JZ7A 4Y5VB 1N4XH 1OPGL 2XN9E 4HUKB 5C0IB 4ZS7L 4PG9A 3L3GA 4DGYL 2AXGB 2FL5A 3UC0L 2G60L 4QHMB 3SE4A 4D0BB 1T7WA 4MX7A 4PRPE 4L8CB 1CGSH 4N8VB 2BVQA 4N0UE 3TBSA 3P0YH 3NIFF 3GMLB 2IQ9L 3QI9D 4KI5F 1JTOA 4LVNB 4X4YB 1KIQA 1MH5A 4U0RC 3KPOA 3OGCB 1OD7A 4KPHL 5C07E 1KCRH 5HD8C 5FYKE 1Q9KB 3N85L 2VLKD 5B8CB 2G2RA 3MLRH 1TZHB 3JVGA 3QG6B 4ODSH 2CLRB 2G5BA 3IF1B 3KNBB 1R24A 2Y6SC 5F89B 5F8QC 4XHJD 1J0ZA 2PW2A 4XI5D 4E5XB 1ZGLM 5EU6A 3T4AB 1QACA 2FJGB 3KLAB 5T1LA 5CD3B 3MUY1 1JHLL 4QRQA 4NP4H 3P9MA 4L8BB 5KS9F 4BQ6A 2GSIB 1QSZA 4U6YA 4CL7A 3T2OA 3QZWA 4QXUL 2I5YL 5IHUH 1MCDA 4ZAKD 3DETC 3G6DL 4M93C 4Y5XA 1S8DB 3VH8A 4A2LA 3CFBB 1S7RA 5BZDB 5IK3B 3BP7B 5FUCC 1UWGL 1ZK9A 3GMNB 4MNHB 3QPQD 5DHYA 1H8SA 1WAAA 4NC1C 4QHLA 5D6DA 4FNLL 4F2MA 3SDXF 2Z92B 1DL7H 4U1GC 4XP6H 4HC1H 1MJJB 1WBZB 4GKNB 5D1ZD 2KZWA 2X7LB 3CFJA 3EYSH 3C09C 2BY3A 2R2BA 4U7KA 5BS0B 1FC1A 5CEZH 4ZUUB 1KEML 4Z7QF 2K1MA 4TOYH 3AY4A 5DJ8A 1OP5K 1BJ1H 2Y5TA 4W4OC 5DJYA 1H0DB 3K4AA 2EZ0D 1JRHL 4UI2A 4NUJB 1EBAA 4LCWE 8FABB 2ZOLA 4JFHE 2OR9H 3WD5L 4DVBB 1K8IA 5EC2B 2C3HA 3CH1A 4L3EB 3TC9A 3WFCH 1XFPA 3GMPB 4FQJH 4H1LA 1MHPL 1NGQH 3LSOA 4G3YL 5KVFL 3FOLB 3O3BB 2IF7A 3V4PH 3PJSA 4O4YH 5DD3L 4ZD3L 3VD3A 3QQ9C 1OF2B 2YWZA 5HBBA 1HQRA 4RRPA 4B5EA 4LCUB 5DUBA 5DZNA 5EN2B 5BRZA 4NM8H 5F9AC 3GBLA 1MFEH 2ADGA 4DKFL 1QHPA 1OAZH 1KCVL 4K7PL 3OKNB 3B4NA 5L2KE 4J3TA 1C7TA 1U95A 4GSDH 5E8OB 1TZGL 3GSVA 5ESAB 3PV6A 5IMMB 3MLTA 3CVIL 1QEWA 3FHQA 3VWKA 1AH1A 3FCTA 3VI3E 3RGVB 1CCZA 4JG0H 4F3FA 2EE2A 4Y4KD 4FHBD 5ETUA 1NCAH 2OZ4A 1R3KA 4XNZB 1ONQA 2J4WH 2XFXA 1NUNB 1QBAA 4JO2H 3NACH 1FC2D 5I1GL 1DANU 4Y1AA 3W5MA 1K2DA 1FBIL 2VXTH 3WIFA 2CDEB 1TJIL 1U3JA 5DJAB 1K4CB 4LIQL 3LEYL 4XTRD 3V4UL 3OAYH 3FQNB 5IQ9A 1HDMB 1A0QL 4EVNA 1T5XB 4KKCC 5HHQB 3O6MH 5TE7H 1BQHB 4FQ2L 1OGAB 1D3CA 1YNKH 5I1JH 4WU5A 2XZZA 3O8XB 3C6LC 2ZCHL 4JFXA 2UWEB 3QJHB 3HRPA 4ZPTA 1PG7W 4OLWL 4F7EA 4N8CL 4X6CE 2V5SA 1KIPA 3MFFB 4C56B 4HX1B 3WLWC 2P5WA 2AEQL 3QUYB 4RFNC 4WTZA 5I75B 4ZSOE 5DYOB 1HOCB 3QJFB 1H3UA 3QCVL 2NY5L 4OD3H 5C8JA 1HKLL 3AS3A 5I19L 2EECA 3LQAL 4Y16A 2J8OA 4LPTA 4Q0XH 1J5OL 4TVSa 4IJ3B 1JN6B 3RWCB 4Z77B 3UPRA 3HE7B 4PJFF 1LK2A 2YPLA 4HAFA 4PBWD 5J6GB 2DQHH 1EEZB 4LLUA 5TDOA 1MJ7H 2PYFA 35C8H 1GAFL 2BNQB 5CLTA 2IH1A 3B8SA 4U1LA 4RFOH 3P9LB 4TRPH 1CDIA 3RZWA 4G6JL 4S1RL 5HHOB 5DD5L 4M4RA 4PG2C 2N56A 4ELMF 3QDGB 4NQCE 2I9LB 5CJQL 5AAWA 3BQUB 5ALCH 3ZKXC 2EIDA 2VLME 1T20A 5A3ID 2OK0H 5KOVC 5KSBB 5HDOA 1IAIH 1AGBB 4ZOAA 4HG4J 1N5AB 5B4MC 3RI5K 2HKFL 4NCDA 1AO7E 2EC9U 4RQQA 1MCEA 1NMBH 1T4KB 2XY1A 5IQ7L 3O2VH 1IT9H 1K85A 3S8WA 3UZQA 3GHBL 1EHLL 5FYKH 4HGMA 3GIZL 3G04A 1RJLA 3TH3T 3BZEA 4YPGA 1G7QA 1BVLA 5C0DB 5JMRA 3SDDC 1DUZB 4PD4K 1TITA 2P44B 2AV1B 4D9RD 2WSKA 2XTJE 3SE9H 3EAKA 3HI1B 4NKMA 1TCRB 3BRDA 1IKNC 3T1WA 3RWIA 1YEEL 3VI4E 1JGUH 2NX5B 4X6FA 3NABL 1T03L 1G7PA 1EHAA 3TT3H 1TMCB 4LSTH 3IRZA 1J0JA 4FTVE 1Q9WA 1OD9A 4Y4FD 4MD4A 1KCUH 2V2WB 4OTXL 4DK6A 1ADQA 4HKZB 1EEUA 3MRPB 2D0GA 4M5ZL 4H25B 5D8JH 4WU7A 3HZMB 4U1NA 3T0BA 2H32H 2BJML 4JAMA 2H8PA 4HWBL 5LWYH 3QUML 1P5VA 2HYMA 5JTWA 4DEPC 2FBJL 1LP9E 3GFUA 4XBPB 3O3DA 3VFNA 2ORBH 2APBA 4J2XA 2P8LA 3L5XH 3R0NA 1WICA 3U7YL 4X6DE 4W6WB 4QHUB 2MPAL 4XPAL 5E1HB 4XXDB 2HLFD 5DQJA 4OZGE 3FAXA 1FZMB 2JELH 4Y2DB 3IDJA 4EUPB 2OXHA 1GZQB 1BAFL 2EICA 4X99B 4YFEA 2ZP0T 4PJ8B 1AKJA 1CFSA 2CDFA 4LLDA 4P4KD 4Q7DA 2H9GB 2WBJB 4YZFE 1FFQA 3X14A 5C0BD 4F8QA 1ZT1A 7FABH 4OD1L 3B5HA 3FMGL 4MJ5A 4OD2B 1ZEAH 2E5EA 5FA3B 3AREA 1N2RB 4L9LC 2P8MA 2D03H 3FT4B 4OZHA 5HDQL 3I9GH 1GCFA 4G8IA 1QBBA 3F5WA 5E08L 2QSCH 2B1AH 4HH8A 4NQSB 4K71C 1Y18A 5E8EB 1ZHLB 4KJPD 3DHMA 2VDMH 2DKSA 3DMMC 4P57B 3QUKA 1P4BL 2HT4D 3WV0A 2YEZB 4L5FH 2PCPA 1NBZB 1QG3A 2DWEA 3JUYA 4L8SA 1F8TH 5CILH 1MHCB 3O4OC 3RWHA 1DUYB 4ISVA 5J89A 1A1OB 4H20H 3H9HB 5I0ZA 2GITB 3MLYH 4DN3H 3P4OB 3D9AH 5GXBB 1MNUH 3QWRD 2VZVA 2AJVH 3O6FB 4XAWH 2Q6WA 3FB6A 4XNXL 3HB3D 4IHOA 1IEBB 2EC8A 5MI0C 1U8IA 3HNSL 4PYHA 3PGDB 2DQUH 3KYMB 2VB5A 3RL2B 1K6QH 1BM3L 3VGEA 4GAGH 4XNMB 4PRIA 2EIZA 5MENE 3ARPA 3L95B 2CLVA 3GSRB 4G6FD 1IGYB 4UMGA 4OUUA 3U0PB 1CE6B 3D39B 1SEBA 3JV4A 2GQHA 5CZVL 1NEZA 3LMJL 1YN7A 1F00I 5A43C 4PG9B 3L3GB 1VESA 2L0DA 4U7MA 1PVHA 4UIMA 3KXFD 2N7BA 4YUEH 5J0BA 1VGKA 4LARL 4MS8C 5I1CH 1NC2D 1WQVT 2BXZA 2BVQB 3TBSB 3ULUC 4ODVH 2Y72A 3AMLA 5GGVL 3R8BB 5EOQL 5DZOA 1BEYL 3WJJA 1K9TA 3ZE1F 1KIQB 3PWJB 5CZKA 1D7FA 1MH5B 3EZ8A 4JRXA 1SEQL 2C4XA 3KPOB 3DROA 3LOWA 3QQ4A 3K1KC 3CC5A 4KUZH 3K3QA 4DUWA 5IB3A 4RIRA 3IFLH 2G2RB 4Q9BA 2OQJA 3HMXL 5TQ0L 4JR9H 1CXHA 2G5BB 3WSQH 4OCWH 5IVNA 4I0PD 1D5IL 1R24B 2RHEA 1UCTA 4LMQE 3MTRA 2PW2B 1Z0MA 1EIBA 4DN4H 2XZQL 2UVFA 5EU6B 1YEDA 4PS4H 2GJ6B 5T1LB 3ZHDA 2VZ1A 4QRPD 1A02N 1DVFD 4KY1H 4R96A 5D1XC 4QRQB 1EX0A 2BDNL 4U1SA 3QQNA 5C2UB 2YD3A 4I3RH 4U6YB 4R2GD 2CSPA 3SHSA 1JRHI 2PO6D 1ZWIA 3HMWL 5BW7C 4WWID 2FO4A 4E41D 4Y5XB 2UVEA 4CMHC 3VH8B 4YDLB 1S7RB 5DDHA 5IHBA 1R0AL 4QHLB 3D6GA 3IXTA 1Z6JT 5GGQH 3VMOA 3AROA 1NPUA 1BQLH 1KTKE 5IFAL 3CFJB 3F8UB 3OAZK 4YHOH 1JZ4A 1J8HD 2R2BB 1Z9OA 1J8KA 4WI6A 2RR3A 5H35A 5J8OA 2HFGL 1P7KA 3GI9H 3MC0A 3IFOA 3T2PA 1W8NA 1QHOA 1KPUB 4PREA 1A6VH 3EJYD 4MA1B 5DJ8B 1KEGL 1NAMA 3S37L 5DJYB 2RJMA 5CFHA 5EZOL 5AYQA 2ZOLB 2CXGA 4OF7A 2DTSA 4XZUA 4BK5A 1K8IB 3CH1B 2WBKA 3MLSL 3TO4C 1OY3B 5E1AA 4H1LB 1CFNA 3LSOB 5I73B 1YECH 4P5TB 3PJSB 2GK0A 2VOTA 4HMCA 4P2OA 3GUTA 4EXPX 1HQRB 3VXSA 3SKOA 4PJDE 1A3QA 3P77A 1D5BA 1E4XH 2ADGB 4RGMC 4B0MM 2Q3ZA 2AEPL 4GH7B 5T1KD 3QFJA 2ZJSH 5KSAA 1A21A 3ILQD 4YHPA 4ZPVA 1G9NL 4P4RA 2IMNA 4S0SD 1U95B 2O5ZL 4QXTB 1NJ9B 1HSBA 3GSVB 5C92A 2E8ZA 3PV6B 4LSRH 1K4DB 2Y7QA 3MRRA 3MLTB 2DQCH 4PLKC 3VWKB 4NO3A 3FCTB 4NT6A 1MCJA 2QQKH 4X4ME 4F3FB 5ETUB 5DUMH 3REVB 3JV6A 2XFXB 3VXUA 3BH8A 3DVGB 2MKLC 4Y1AB 4WHTB 2XPGB 1K2DB 2H3NA 1ZHBB 4WI3A 3WIFB 3CU7A 4I2XE 5F7UA 5FKPA 2DICA 1TTUA 5IQ9B 1X5KA 2F15A 1P7HL 2MQ0A 4EVNB 1OGTA 1DSFH 2EDOA 4M48L 4S1QL 3UEZA 3TLRA 3OQ3B 5ADOH 3VXMA 1I8MA 4WU5B 3HZVA 2Y07H 4RISL 3T3PF 1GL4B 1PZ5B 2M26A 4ZPTB 5MEPA 4HS3A 3FRUA 1KIPB 3NCYS 4ESKA 2EXWD 5J1SC 1TQBC 4AYFA 4XWOD 1T2XA 4KTEL 3ULVF 1GC1L 1YJDC 3IU4L 3V52L 5I2IA 2JIXD 1F3RB 4JPVH 3SOBH 3U2SA 4M1DH 1IFHH 1CG9A 2AJUL 1L7TH 4KQ4H 4MAUL 4TUJA 2O93L 1QSFE 4L8DA 5FUZL 1I1AD 4ZYKA 4G6ML 3UPRB 5D7SH 4YEEA 2F54A 4QHKI 4HFUL 4HWBA 5SWZD 1LK2B 2YPLB 3QUMA 3K4DA 1S9KC 3SDAA 5E4EB 4HSQA 4CU7A 5F1KC 3D2UA 4LLUB 5TDOB 2MJWA 3U36B 1T1WB 2PYFB 2PF6A 4U1LB 3OZ9L 3GSUA 5IW1B 1BJ1J 2Q76A 4C54A 3I50L 2W92A 3OTTA 5DJ2A 3OKOB 3KPRD 4JREC 1DQJB 1LVEA 5L88H 1T20B 4NFCA 1U8JA 2GYSA 3HTLX 3G6JE 3QPXH 3WDJA 4YXLH 3BPOB 1I7TA 3HR6A 3BPNC 3MRCA 3S35X 1FH5L 4TSBH 3LEVL 3TNNA 3BKMH 4Q6YA 5J12C 5IT2H 2AJXH 4NBXB 2VXSL 3MLZH 5CJXA 1MFAH 4QY8B 5ECJE 3VGAB 1SM3L 3RVWD 1JHTA 1RJLB 1WFUA 1JTPA 2IALB 3MNVA 3VWJD 1G7QB 3BZEB 1BVLB 2BNUA 1ES0A 1AHWC 4YK4B 1OT2A 4ONGH 4ZNEE 4N5ED 2IANB 1YZZA 1OWRM 4NKMB 4LASH 4FQCL 1JYNA 1PKQE 1A7NH 1BFTA 1UYWL 4OQTL 1WZKA 2EXYC 5M7QA 5C08A 2VDNL 1PEZA 2B0SL 3WN5C 5JXEA 2X4UA 3WUZA 4F33B 5C0CA 1G7PB 3EFDH 1U8LA 5I1IH 5E0QA 1MJ8L 4GS7B 1Q9WB 3NIFE 1D9KA 4KI5E 5F7EH 5HGAB 4MD4B 5BVPL 5IIEA 2J6EL 4Z78A 2P5EA 2W0FA 2AK1H 4WU7B 4I3GA 4U1NB 4JAMB 2H8PB 1JPTH 1YNLH 4ZO9A 3O3DB 4U2ZA 5F7NC 4HJ0D 3VFNB 4M02A 2P8LB 3TVMC 4H8WL 4O9HL 4U0QB 3MOAL 3UCRA 4NJ9H 5C0BE 1HNFA 1NGYA 1UFUA 4CW1A 5F9OH 4PJBB 3I6GA 5DJ6A 5L2JA 2WM0A 4KUCD 4OLXH 3IDJB 3ETBF 4IIQA 3WNOA 3DARA 4BZYA 1CU4L 4Y7MA 5DR5L 3QHTC 5FYLD 4LLDB 1CFSB 2CDFB 1U2CA 1YN6A 5EU4A 3WL9B 4PY8J 5KS9E 1ZT1B 1JF5A 3HAEG 3GSNL 2H6PA 4LPCA 1XGTA 4TULH 3AREB 4YIQB 4LVEA 4WVRA 2P8MB 2FHCA 1FJ1A 4ZO6A 3UJIH 5DMJB 3BPLB 4G8IB 5DFTA 3EOTL 3F5WB 4KRMB 1AXTL 4P46C 1Y18B 5E2WH 1DP0A 1OTTD 4Z7NF 1YQVH 1UVQB 3RTQD 5E9DD 2GTWA 4XP1H 2C7UA 1P84K 3QUKB 3QUXD 5CKAA 2PCPB 2DWEB 3B2VL 4E9LA 4L8SB 3HUJB 4PRAA 3P11H 3RWHB 4ISVB 2FYYA 1T2QH 1CS6A 4JFDA 2HT2C 2IAMA 1AD9A 2OMNA 5HHXH 1DBMH 3S9DB 3LDBC 2Q6WB 2QTEA 3C09B 3EGSA 3FRPG 1A6UL 4IHOB 4MHHG 3P30H 3ZTJH 4R4FL 3TZVC 4TTDC 4XVUD 3MCLH 1U8IB 3BZ4B 4RWYH 3T8XB 4L4VA 4YH6A 2NTSP 3TYFA 3FL7A 4UT6H 3CDGA 5H2BB 2UZIH 4XVTH 3M8OL 4KWUA 1AE6H 5DS8A 4LDLB 4PRIB 4HH9A 2NY4C 2EIZB 4M7LH 2VLRE 4CMMA 3ABZA 1IM3A 4KI5C 4YNYA 5E2TH 4WV1A 4J3OC 4OUUB 3ZT5A 1SEBB 3JV4B 3LEXA 1NEZB 3CFCH 5E94A 5E5UB 2I26N 2MOVA 3KPLA 2YUWA 4HJGA 2GJZA 2E7HA 4CADA 5C7XH 1YN7B 2N7AA 1XGYH 1QSEE 4JKPH 5EULV 5DUPL 3O4LE 1V3KA 5DMKA 1JUFA 1N4XL 1VGKB 3FAWA 2PXYA 2CRMA 3IKKA 3HG1A 1CGSL 4QEGA 5BCAA 4JRXB 4GW4A 3P0YL 3DROB 3QQ4B 4OV6F 1XZ0B 3CC5B 1MIEH 1MFBH 1X7QA 4OUOA 1IGTA 2ENYA 5EO9A 4F7MA 2NY3D 4ZS6C 5IB3B 4RIRB 1KCRL 3HLAA 2YRZA 4POUB 2OQJB 1NUDA 2JJTC 3K2UH 5ISZB 4EDWH 1QSVA 4L9DA 4ODSL 3IJSB 1HSAA 4E41E 4HAGA 2EIEA 1VEMA 4R96B 5D7JD 1H8NA 3RZCA 5IROC 4U1SB 2DTMH 1U3HC 2E27H 1FLRH 5KSVA 4NRZA 1G7JB 4UOW0 3RVUD 5GS1C 4YXHH 4NP4L 1MPAH 4Y4HD 2FO4B 3H9SA 4BJLA 2NY6C 4MCYA 3G5YA 4NRXA 2JB6A 2MCG1 2VABA 5IHUL 2FB4H 3T0XA 4RFNB 2R8SH 2ZCLL 5DDHB 3PL6C 2FX9H 3W0WA 1IBGH 5C2BH 2CKBB 2I24N 1O0VA 2UYLA 3GO1H 2IPTH 1I7UA 1SJHA 4E42A 4BQ8A 2AJSH 1MJUH 4XC1H 1KIRA 2FHFA 5H35B 1DL7L 4XP6L 4PJIA 2EDQA 4HC1L 1P7KB 2XOTA 3IFOB 2L7UA 4RX4A 3EYSL 1FFPA 5D7IA 1NAMB 4ELME 3KVQA 3SCMA 3U6RA 1E6JH 4YHKH 3TFKD 5MEOA 3JWDH 2NY0D 2OTUB 3IGAA 4TOYL 5F3BA 4XX1E 4XZUB 2P5WD 3CVHH 4M00A 4TVPD 5E1AB 2DRUA 5F7WC 1CFNB 3QDME 2OR9L 4MDJA 4KU1A 4P2OB 3WFCL 1T22A 2CQVA 3GUTB 1EV2E 1IARB 1NGQL 3NCEB 4PJCA 3ZKXB 3VXSB 3SKOB 3V4PL 2BP3A 4Y16D 4O4YL 1QP1A 3SE8H 3P77B 2ZG3A 2AV7A 1D5BB 2MTPA 1KC5L 3GSQA 3QFJB 2DQTL 2V5TA 4NM8L 4X9IA 3S36H 3OXSA 2EDTA 5KSAB 4ZPVB 3GBNL 4X0KA 4YHPB 3BP6A 1MFEL 4P4RB 1BOYA 2H2SC 3EJZD 3UPAA 3OSKA 1MHHA 4GLRH 1P4IH 4JFEA 1OAZL 1HSBB 4JFZH 5K9QG 3MV8A 3ARFD 3MRRB 4U4BA 5AWNH 2AK4D 4RFEA 5DVKA 1X5AA 4WHYH 4NO3B 5HYEA 4NT6B 1RK0A 4GSDL 1KENH 2VISB 1DBJL 1S7XA 1IC1A 2AERT 3TNMA 3IAPA 2DJSA 1JWMA 1UG9A 5IB4A 3JV6B 2WINB 4JG0L 3X3GL 3VXUB 2ZCKH 2Z31C 1NCAL 5JOEA 3NPSC 4K8RD 4PJ9C 1XAUA 1LEIA 2J4WL 3WN5A 5FKPB 4JO2L 1FVEA 5TH2A 5SWQB 3FB8A 4QLRA 4KK6C 1UXWA 2BHYA 1OGTB 4DTGH 2CDGA 4HPYH 5B38A 5K9QI 2DI9A 1FZOA 3OB0H 4U6HA 4DOHE 1I8MB 1ZT7A 1JF6A 3HZVB 3KWWA 3O6ML 5TDNA 5MEPB 5TE7L 4HS3B 4CN1A 3FRUB 1YNKL 4M43H 5I1JL 5D7LB 3AC0A 2ERJC 3UDWA 2C4FT 1JPSH 1U8MA 4B7IA 5CGMA 4OQTA 4JG1H 5IBUG 2LAGB 4JM2A 4JCLA 4IRSA 3K8KA 3VFMA 5I2IB 2K9UA 4EIGB 3U2SB 5CEYA 1CG9B 2X2YA 1W2KT 5KVGH 1NGZA 1SJXA 4TUJB 2XA8L 4L8DB 4ZYKB 3O6LH 4MNGB 1HQ4A 2F54B 4MAYC 3NFSH 5ELIA 4F9PA 4Q0XL 3SDAB 4XAKD 1KACB 1RIUL 2BFVL 3CXDH 4PGBA 3D2UB 5JDSA 1OAYH 4HD9A 1JK8A 3MBEC 3QG7H 3R06A 2DQHL 1RJCA 3GSUB 4WI7A 3UXFA 4G8FA 2Q76B 1FL3A 1MJ7L 3HI5L 35C8L 3S7GA 3G9AB 3T0WA 4TRPL 5EPMA 5DJ2B 1G1CA 2GW5A 4MYWB 3CFIC 3LKSA 3D85D 5F96L 5TQ2H 1U8JB 4R8WL 1AKJD 5ALCL 4FZEH 3MRGA 4G9FA 3ARGC 3EJJX 1ZLUH 2OK0L 1I7TB 5GISH 3MRCB 3SGJC 1CGUA 3TNNB 1IAIL 2R2HA 2VKWA 4QCIA 1Q9LB 4NO5B 3V6ZA 3O2VL 2IMMA 1IT9L 3MNVB 3EFFA 1JIBA 2BNUB 3MV7D 5FYKL 1X5XA 1Z9LA 3UTSD 2OL3A 1CLCA 5CIPH 3UROR 3MGAA 1F4YH 1UM5L 4OLYH 1F3JA 3QA3A 4UNUA 2A77H 4X4XA 3ZE2F 3WO4C 3V8CA 2VUYA 3SE9L 1MY7A 3QBTB 5C08B 1OTSD 2X4UB 3TPUA 1UKSA 4CU8A 5C0CB 3MRJA 4OBRA 9CGTA 1U8LB 5I6XC 1JGUL 1P9MC 1D9KB 5EU7C 5BV7C 4NQEE 5IIEB 1NDGA 4Z78B 2P5EB 3TT3L 4LSTL 4WUUA 1WIPA 5I18H 1O7SA 3LPFA 5D8JL 1XT5A 4H0GA 1H5BA 1HNGA 2FZ3A 5FYLE 5LWYL 4Y8AA 1WFNA 1KTDA 3SQOH 1I3GH 4DKEH 3MZTA 4UV7H 1NGYB 5CAYB 4CW1B 1IC5H 2ORBL 5I71C 3L5XL 3I6GB 5DJ6B 5L2JB 3IDXH 4YEFA 1IAOA 4X6BA 3HI6H 4IIQB 2F53E 3EYFA 4HHAA 1ZMYA 3EDKA 2BY1A 2JELL 4R6UA 1YN6B 5EU4B 3HRZA 3MX0A 1X5FA 4ZDHA 5I1AA 2NXYC 5E9DE 1CL7L 4M8VA 3V5HB 2H6PB 3O9WC 1XGTB 1JWSB 4NIKB 1QBLH 2C9AA 2K7PA 7FABL 1RU9H 1FJ1B 1MEXH 4PB9H 3RDTA 1ZEAL 4XWGH 2BY2A 2D03L 3I9GL 1P2CA 2QSCL 2B1AL 2C7UB 5HHME 1TDQA 1LMKA 2BNRE 2HTLD 4CMHB 1IAKA 2VDML 3U79A 1FO0H 2H45A 4PRAB 5ANMA 2W0PA 2FYYB 4ZTPH 1GGBH 4JFDB 4P9HH 2IAMB 1F8TL 1AD9B 5CILL 3ES6A 4YDIH 4FXGA 4KVNH 5IW3A 4H20L 3L3DA 3MLYL 4DN3L 3D9AL 4XNUH 4KKBD 2WP3T 1MNUL 4KQ3H 2H26A 2UWEF 2AJVL 4XAWL 4YWGH 3BHBA 3I6LE 4L4VB 1J87A 3TYFB 4JZJA 1RZJC 4I18C 2BVOA 5DS8B 4HH9B 1YPZA 4CMMB 2DQUL 1IM3B 3MLWH 4YNYB 1FE8H 4DUVA 4WV1B 1K6QL 2BVPA 4GAGL 1WV7T 3C8KA 4F7PA 5DMYA 3BIAX 5T3XE 3HKFA 5E94B 5C0GA 3KPLB 4HJGB 4GBXD 4RAHA 2GJZB 4P99A 4CDHA 4R90H 4CADB 3BD5A 1H3VA 2ICCA 3IDYC 4G6AD 4WCYH 4QOKA 5DMKB 1JUFB 3KYKL 3E0GA 4HC1A 3Q6FA 4R7NB 5F71A 3QAZB 4LGSB 2LTQC 1BREA 5KG9A 4YUEL 1E4KC 2CO6B 4M9PA 5I1CL 2AABH 2PXYB 5TF1H 4DJMA 4GW4B 4ODVL 1WZLA 4HUUA 1BD2A 2JTDA 3K74B 1CF8H 1ORSA 3UZVB 1ZHNA 1I85A 4WTXA 2CK0H 2ZG2A 4JRYA 1UA6H 1X7QB 4IRZH 1IGTB 2GCYA 5E7FA 2FEDD 5EO9B 1AP2A 4F7MB 5KZCD 2YPVH 4RCAA 3HLAB 5I1KH 2EE3A 4KUZL 2GSGA 4A6YH 5KSBF 1B0RB 1JGDA 4XXCA 2Z31A 3S5LG 3IFLL 4PJ9A 5DJ0A 1SMAA 3WSQL 4OCWL 1TENA 5D5MB 3W9DA 3T3PE 4LEXH 2ZWLT 3RZCB 1NBYA 4DN4L 4XHQA 2CRZA 4PS4L 2F5AH 2YD7A 3NTCH 1NL0H 1E28A 2MWCA 4ONHA 2I9TA 1XIWC 4G43A 3ULVE 4Z76A 4C57C 3C60D 4FS0A 3H9SB 2NNAA 2H2PD 2BERA 4I3RL 3G5YB 4J1UA 4NRXB 2JB6B 2VABB 3O81A 5F8RC 3UYRH 4DWHA 2AJZB 1HKFA 6CGTA 3W0WB 3T04D 3H7BA 4R4BA 4FOMA 2UYLB 4ONFH 3DX9A 1YNTA 1SJHB 2DWDA 4KJYA 3H0TA 5GGQL 1T21A 1KIRB 4NFDA 3BP4B 4PJIB 1BQLL 2J8UA 1CDBA 1R3HA 3DTXA 5HYFA 1PAMA 3VXMD 4YHOL 2D3VA 1FFPB 3LKNA 4XH2A 4GRMA 3SCMB 3NN8B 3GI9L 5MEOB 1KPVA 4P0DA 4ODXA 3IGAB 5F3BB 1M71B 2EDNA 1N6QH 1A6VL 5GS0H 5A2JH 1R5VA 5JUEH 5HHVH 1ZOXA 1F45A 1P69B 1FG2A 3OG6B 4KKNA 4MDJB 3N1QC 5FHBH 4LDEB 1T22B 5DRNA 4M7JH 4X9HA 4PJCB 3SPVB 3S4SA 4NDMA 1CDUA 2AK4E 1HHHA 3H3PH 1QR4A 3GSQB 4R97C 2EDYA 3BPNB 3OXSB 1WCBA 4X0KB 1YEHL 1E4XL 1MHHB 3F6LA 2XQYK 4GT7A 4RGNB 4JFEB 2EEBA 2VSDA 2XWTA 2ZJSL 3QIUD 3G6AA 1P5UA 3MV8B 5GRYA 4RFEB 4LHQB 4ZXBC 3EDJA 1Z3GH 3T3MF 1RK0B 3TNMB 4LSRL 1WISA 5I16A 2DQCL 1JWMB 5IB4B 3BT2H 4U49A 4OZIA 1QYGH 2QQKL 3GDBA 2ZKHH 2XN9A 3HC3H 1V3JA 2VIRA 3VG0H 4K07A 5DUML 1U3YA 3EOYG 4QYOA 3U9PH 1LEIB 3G5XA 3IXAB 5HYSB 3WN5B 1EHNA 1RULH 5HYJD 1FVEB 5TH2B 3FB8B 4OF5A 5GS2H 3B9AA 1UXWB 4DGVH 3RY6A 3EO9H 1P9MA 1Y6MR 4BELD 2E9BA 5B38B 5DURB 4LVOC 1FZOB 4U6HB 1BF2A 1DSFL 1K5NA 1ZT7B 4N1HB 4GJTB 3KWWB 3T0DA 1Y0LA 5C07A 3L7FB 4NZRH 5EIVA 5TDNB 3QEHA 5ADOL 4HLJA 3O6KH 3QWOA 4KJQD 4WFEE 3ARBA 1N64H 1T7VA 2WUBH 2Y07L 1U8MB 2FH8A 4DW2H 3CSPA 3FT3A 2YD1A 2HTKD 3KAAA 4JM2B 4XAKE 3BVNA 3GM8A 3S97C 4IRSB 1CTOA 1B6DA 1PYWB 5K93A 3VFMB 5C9KA 1WBYA 1OSPH 5I1DB 3OKLA 4XPGH 5CEYB 3WJLC 1T66C 4N90E 1NGZB 1X5ZA 4ZFOL 4JPVL 3SOBL 4M1DL 1HQ4B 1IFHL 3D25A 1IAII 1L7TL 4KQ4L 4U1IB 3VFOB 5D7SL 1P6FA 2H32A 4PGBB 4W4NA 1JK8B 1IM9D 3KDMB 2LVEA 3QO1A 5T3XH 4G8FB 4Q9CA 3OJDA 4MVBD 1BGXH 1UEYA 1TFHA 4M5YH 1KB9K 5EPMB 5IGXH 2O61A 3FB5A 3LB6D 1T89C 4CVXA 3B5GA 2YS4A 4G8EB 1KCSH 1S78C 4RSVA 5I9QB 3MRGB 5L88L 2IPUG 4KKAD 3MV7E 3D1MC 3QIBC 5ALBH 1U58B 3UTSE 3L3KA 5FIEA 4PRHE 3T4YA 4G6KH 1A6PA 3V0VA 3QPXL 5CD5D 4QCIB 4TSBL 3V6ZB 3LDBB 3R1GH 3BKML 4LCWA 4KFZC 2FO1A 1ZVYA 5IG7A 5IT2L 3L6FA 2AJXL 3EFFB 1CD1A 1KELH 4NUGH 5E6ID 4PLNC 3MLZL 1EZVX 1FSKC 3K8MA 3QI9C 1MFAL 2OL3B 1QPXA 1XR9A 4XPBH 4I18A 3C5ZC 3VXNA 1F3JB 3QA3B 3WNKA 3TA3C 3TN0C 3LKPA 4UUJB 2VWEE 4ONGL 4CBPA 5HI4C 4UBDC 4LASL 3TPUB 1A7NL 4NZJA 5EDXA 4FQXD 3MRJB 3O2DA 1AY1L 3AB0C 1NDGB 2X70B 2NXZC 3LD8C 5TE6H 3EFDL 3QULA 4OCLC 4WUUB 3MPCA 5I1IL 3D69A 1CL7I 2B8OT 3ULVH 5F7EL 3V5DB 4XHJC 3MV9A 1NGPH 1VKXB 4MD0A 4XI5C 2AK1L 3MFGB 1E4KA 1H5BB 2EH8H 5DJDB 2FZ3B 1J1XH 1MRFL 1JPTL 4M1CC 5IMOA 1DZBA 1YNLL 1KBGH 1RV6X 5JPMA 2MKWA 2W60B 4J3XA 1T6WA 4NJ9L 4X6BB 3QIWA 3GRWH 3IS1X 1FYTD 3EYFB 4HHAB 5F9OL 2RB8A 2ZZUT 1KN2H 3QUZD 4W81A 3W11C 1CGVA 4P2QA 1BIIA 4ZDHB 1M1SA 3HPJB 5HVWA 5KW9H 3BI9X 3FONA 2YWYA 5I1AB 2Z8RA 4YE4H 1UB6A 2VR4A 1E4JA 5DEGA 5DHVH 5D1ZC 2F19H 4POZD 3KLDA 4NJAH 4X6CA 3HG1D 4URTB 2J5LB 2QKIA 5TPWH 1U3HB 3MLUH 4TULL 3OAUH 4V1DD 3UO1H 3DV6A 1SBSL 4ZSOA 1XIWA 3T0ED 4QRRD 1G9MH 1P2CB 3MGTA 3MLPA 2NY6B 3LQZA 4NNPH 2YD5A 5E2WL 1HYSC 4XP1L 5ANMB 5HYQA 1R3LB 1CFVH 4D2NA 4M7LT 5D2NC 2KZ1B 1UXSB 1C08A 5DXWA 2AJYH 4FXGB 4ZUSA 4P3CH 3P11L 1T2QL 3FFCB 3L3DB 3DSNA 43CAA 1JHKH 3TM6A 4OCXH 5HHXL 2H26B 5E2JA 1DBML 5EU5B 3LHPH 3IETA 3BHBB 4I13B 5IESL 1TVBA 3L7EA 3SJVD 1G7LA 3P30L 4JZJB 3MCLL 2BVOB 4NQCA 4OF3A 4RWYL 1YPZB 3GM0A 4OGYH 5K59F 5EA0H 3TGXA 4UT6L 4BK4A 2UZIL 4XVTL 1AE6L 3FZUD 2BVPB 3SGEH 3C8KB 4KGJA 1QVOA 4F7PB 4M7LL 3WNLA 5E2TL 4GQ9H 1C12A 2V2XA 1IJ9A 4DK3A 2J12B 2ZNXA 3HCVB 4WO4D 3CFCL 1PGRB 1DR9A 1QFUH 5C7XL 3HNVH 4ERSH 1XGYL 3Q6FB 2WP3O 4JKPL 5KG9B 4GMTL 3UYOD 5FGBC 4LHUG 3CSYA 1MRDH 2F8OA 2F74B 4PLOB 1YY8A 4I5BB 1QRNB 1WCQA 1ZVHA 3VXRD 1DN0B 3F12B 1MF2H 2ZUSA 3X12A 1NANI 1L4IA 2X40A 1BD2B 2LU7A 1IKFH 3DXAA 1ORSB 4HUUB 4PJAA 5FDWA 3VGBA 3VD4A 2XTLA 4JRYB 3C8DA 2GCYB 4IS6A 5D72H 4WEUD 2MNUA 4OI7A 2EE6A 2GSGB 4AIOA 4AIZA 1MFBL 4LK4A 5JIPA 4OKDA 2Z31B 1NEUA 1UH3A 2B4CH 3C6SA 2QR0A 3NPSB 2EDDA 4PJ9B 5DJ0B 5EC1B 1RURH 5L9DH 3NCBB 4O2CB 3K2UL 3UAJC 1G0YR 3W9DB 3FQTA 3IKCA 4EDWL 4ELKA 3H9ZA 1G1YA 1FCCA 4N0FA 1KNOA 1NBYB 3PWNA 2PYEA 2D0FA 1LP9A 4HKBB 3AFLA 4BFBD 4I48A 3BYTA 3N1PC 1XF2A 4X6DA 5DJZB 1E28B 4ONHB 1RHHA 2I9TB 4G43B 3MRIB 1FYHB 2ZUWA 1FIGH 4Z76B 2DTML 2E27L 4Q2ZA 4OZGA 2NNAB 3VA2C 1FLRL 3HE6C 2JJVA 3ARDD 1BJ8A 3GSWA 3SDCA 4LHJB 2ERJB 2EO1A 4YXHL 1MPAL 2BRQA 3PP4H 1ZTXH 3WEXA 1FL6B 3DURA 5F9JA 4I1NB 3JBG7 2FB4L 3H7BB 4R4BB 2DOCA 2ENSA 5BJTA 2R8SL 3DX9B 1MY5A 1YNTB 3SKMA 2FX9L 3CSBA 5DMGC 3BZFA 2DWDB 1U42A 1KB5L 3H0TB 5A3IC 1T21B 5C2BL 4NQXB 5L8JB 3GO1L 4YFLF 2J8UB 1HIMH 1R3HB 3DTXB 3ME0A 3FB7A 1E4XI 3J8F7 2Q1EA 3PP3H 2AJSL 1MJUL 3LKNB 4XC1L 4FABH 4XH2B 3AUVA 1A7PH 1KOAA 4FQQA 4KXZH 3DO3A 3GKWH 5DLMH 1KPVB 4ODXB 1OTUD 1R5VB 4R3SA 1FGNH 3IDNA 1E6JL 4OFYA 4PJBF 4YHKL 5CLWA 3JWDL 5JOPE 1FN4A 1FG2B 2ITCA 3DX7A 1EZVY 3CVHL 5J13C 5DRNB 1PZUB 3R8QA 1NMCC 3B2UD 1I1YB 4MA3A 4NN6C 1MI5A 4FA8A 4NDMB 1AGDA 4GRLA 1I8IA 3STLA 1HHHB 5JHDD 5I1HL 1LO3H 3DRQA 2BVUA 2X44D 1YEKH 4RMUA 2QADD 3O11B 1WCBB 3SE8L 1WTGT 4Y89A 2BK8A 4HMEA 3DUSB 4GXUM 1CD8A 4J12A 2EYSA 2XWTB 3S36L 3G6AB 5E2VH 2X4QA 5MENA 3FO0H 3ZE2E 4AQOA 5HYJE 1P4IL 2I07A 4JFZL 5A16A 1A6WH 2BSED 5EUKA 3QI9A 2XY2A 1KENL 4PP2A 2XN9B 3HUJF 2VIRB 1AR1C 4K23H 4QYOB 2DJUA 2OLDA 2NY2D 3VRJB 3WO4B 2HLFC 1CWVA 4P2RB 3G5XB 1QPPA 1JPST 1G84A 1INDH 2DM3A 2R0WH 2ZCKL 4G9FD 1J9CT 4Y5VC 5BV7B 5DVLA 1N26A 4OFKA 4I77H 1A5FH 3T0AA 3IFPB 4DTGL 1K5NB 3S37X 4HPYL 2X4TB 4XT1C 5I76B 1Y0LB 5C07B 4WFFD 3QEHB 1JPFA 2Y25A 1JZ3A 3QWOB 1NCDH 5LAXA 5E8DH 3FT3B 3UBXA 4M43L 3MBXH 4WHCA 3PWPD 3BVNB 4YQXH 5I71B 1JPSL 1WBYB 4ZAKA 4ZOBA 3OKLB 2YUZA 2HFEB 3JWOH 2HT4C 3CFKB 5B8CC 3EKCA 1MCQA 4XB7A 5DT1L 2X41A 4UDTB 1EO8H 5C0FA 1I75A 4LSVH 3D25B 5KVGL 5E70A 2NXYB 4IEFB 2PTTA 2VR5A 4MSWA 3O6LL 1KJVA 3VDBA 5KJRH 3NFSL 5D1ZA 12E8H 1FZKA 3QO1B 3HB3C 4OSUH 3QHFH 1OAYL 1BOGA 1SY6H 3OJDB 5CJOH 3SE3A 2GIYA 3QG7L 2CRIA 1DJSA 4JY5H 2A73A 1HXYA 4ZFFA 2O61B 2A0LC 3FB5B 3UBXI 1A8JH 2GTZA 3SBWA 3BEWA 1PX3A 4LMQI 5HSFA 1OGAE 4KK8D 1B4JH 5TQ2L 1T83C 2UWEE 2X1QA 3L3KB 5D2NA 1XF3A 4KKLD 4C4KT 3V0VB 4FZEL 4AMKH 3GSXB 1U8QB 5HDBF 1CICD 2FWOA 5GISL 4NPYA 4MXVF 5CSBA 4LCWB 1ACYH 5J11C 3RDTD 5FF6A 5IG7B 1L6XA 2HVKA 3L6FB 5I74B 3KS0H 2D7QA 1CD1B 3GK8H 4HKXA 4XCFH 4MXWH 1ZLWK 2R4RL 3OKMA 3U9UB 4BQBA 3RWFB 1XR9B 1KXTB 1C5CH 4I18B 3VXNB 2EKJA 4Q6IA 2Q7NA 4N0CD 3LKPB 3WHE1 1RQ5A 1F4YL 4OLYL 3WFZA 3VFWA 2A77L 1PX4A 3BJLA 3LKQA 4Y4KA 5CJBA 4JN1L 2NY1B 4NQDD 1GXEA 4R4NC 3IDYB 2BNQE 3C2SA 4I0PC 1C5BH 2UUDK 1A7QH 3MV9B 1PG7X 3UTTD 3UJJH 1CXIA 4XBEH 5J3HD 1S9VA 1FYTE 3QDGE 2VERN 5HI5C 2A6IA 1XCTA 3BOVA 5FGBA 4X9GA 5IMOB 3FO2A 4LRIA 1GGUA 2X1XR 4J6RH 1WGOA 3ET9F 2ZG1A 4ZUTB 4X7TA 5KSBE 2W9DH 3KPQA 4LDOB 4X5XB 3FHAA 4DKEL 1I3GL 3UJTH 3ZTJG 5MP6H 3T65B 5E7BA 1HHIA 2PO6C 1JP5A 3RGVC 4UV7L 3OKKA 4I2XA 3QIWB 1IC5L 2QQLH 1AGFA 1MAJA 2XKSA 4TPRH 5EBGA 2AI0H 2R9HD 3IDXL 4XNZC 3QEQB 2R1XA 4P2QB 4K94C 1BIIB 3BP5B 3HI6L 4LLAA 4QOKD 4OCSH 1HCVA 2G75A 1TJGH 1YY9D 4XGZA 3T0EE 4APQD 5ITFB 3RIAK 3MYJA 1QR1A 4HUXA 1CTNA 4YDVB 4X6CB 3LS5H 4KRPD 5EORH 5CEZD 2QKIB 1C16A 1DLFL 3TBVA 5GGVY 1QBLL 3DV6B 1RU9L 1MEXL 2W91A 1QUNA 1XIWB 4XVSH 4ZSOB 4K55A 5HVGB 3O8XC 3OL2A 1JYWA 4JKKA 4ORGA 4XWGL 3F58H 3LQZB 4JPIA 3WIHH 1IQDA 4D9QD 4EOWH 4WI8A 3QUYC 3E3QC 4F7CA 5HYQB 3MROA 2CD0A 3HC4H 3SJVE 2EO9A 1I7ZA 1C08B 1FO0L 4GXVH 5IHZA 4ZUSB 3O3UN 4HW6A 3THML 4ZTPL 4PP1C 2HG5B 3MV11 4RBPK 3BE1H 4P9HL 3TV3H 4YDIL 4KVNL 3I6KA 5GRUL 1BVKA 4IJ3C 4TSAH 5JLZA 3W82A 3IETB 1C5DA 3RVTD 5B39G 3CIQA 1MRCH 1FRGH 3L7EB 3ILQC 4XNUL 3S35H 2HMIC 5KTEH 4KQ3L 4O5LH 2DIBA 2FLBT 2R1WA 1UGNA 4YWGL 2X4OA 1YYML 3DUHA 1CN4A 3PHSA 4KROD 1S3KH 1QVOB 2SEBA 4OLVH 5FAAA 2D7NA 4PRDA 2ATPA 3MLWL 4M4PA 1FE8L 3B9VA 1IAMA 5TE4H 3G6JA 1C12B 3MR9A 5HD8D 3LZFH 2V2XB 3GHEH 4HQQH 3K8LA 3BQUC 4QRSA 1KB5A 1VB9A 4R90L 2MSPA 4WCYL 2R29H 2Y6SD 3QSKB 3GZKA 2J88H 4M8QA 4GG6E 4P5KA 3CSYB 4P23A 4JQXC 1NCWH 2Y4SA 1YY8B 1XGQA 4Y4FA 3LH2H 4D0CA 4ZNEA 3AM8A 3X12B 2AABL 3U7WH 2YA1A 3PABA 4PJAB 5FDWB 3DXAB 1PKQA 4MZ3A 4ZXBB 2NZIA 1XF4B 2AJ3A 4PGJA 2XG5A 3P3YA 4YHIA 4IS6B 1J7VR 1CF8L 1EA9C 2ADFL 4IMKA 1S9XA 4WW1A 4U6TA 3PHQA 3DETD 2CK0L 1UT9A 4AIZB 1UA6L 2EXWC 5DSCA 4OZFA 3C6SB 2QR0B 2YPVL 5I1KL 1T2JA 3C08H 1CFTA 1QO3B 5D9SA 4A6YL 5DD1L 4HUWA 3OF6D 3FQTB 3IKCB 2V2TA 4ELKB 4K94H 3PWNB 2PYEB 2YZ1A 1D5ZA 1LP9B 3RKPA 2VJXA 1VFAA 4I48B 4P4KA 1OQOA 4LVOB 4LEXL 1XF2B 1CLOL 4X6DB 5E24E 4LP4A 1RHHB 5F1OB 3GSOA 5C0BA 4JY4A 2WLZA 3ARRA 4Q2ZB 2F5AL 3NTCL 4AK1A 2XXCB 1N59A 4KK9D 3GSWB 3IDIA 3SDCB 2QBWA 1J1OH 2FJHA 1G6RA 3QO0B 2XZAL 3WEXB 3IDGA 4F58H 1RZIA 4M3JA 3DURB 3KPMB 3LKOB 4WHYG 5F9JB 5ICZA 3UYRL 3O41A 5BJTB 5GRZA 4PRPD 3SKMB 3STZA 4Y2DC 3P2TA 3BZFB 3WUWG 3JSSA 2JJSA 3QQ9D 4ONFL 2PN5A 4EN3D 5JDJA 4PJ8C 5B22A 4DGIH 1GHFH 2WBJC 4LF3B 3FB7B 3GKZA 4BSVA 5GSRA 3ULUF 4UDUA 2OP4H 3MZGB 4FQQB 5I0DA 2HFFA 5ID0A 6FABH 5JHDE 1YYLH 3ARBD 4GLRI 4LNRA 2ADJA 4R3SB 3IDNB 3TPKA 5I30H 2DLIA 2HKHH 3S3SA 2DQEL 1FN4B 2ITCB 3RVWC 3VWJC 1N6QL 4NO0A 5GS0L 2CUIA 4HWUA 1C1EH 3DX7B 5JUEL 5HHVL 3HS0A 4RAUA 5KBNC 2GJ6E 3MRDB 5ERWA 1KTRL 4MA3B 1FQ9C 1MI5B 5GGRA 4KV5F 1NFIA 1AGDB 1QKZH 4GRLB 1I8IB 3STLB 1PLGH 5FHBL 1J0HA 1I7RA 4LSPH 4M7JL 3LRSA 2P48B 3H2WA 4CU6A 5D96B 1LE9B 4HEME 3H3PL 4RNRA 1XGUA 2DAVA 1T1XA 3G08A 2VLRA 2X4QB 4YFDB 4AM0A 4KKCD 2KL6A 2VZUA 2I07B 5EBWA 5A16B 4QNPF 1P4LA 5EUKB 2ZSWA 3C6LD 1FSKB 1Z3GL 3QI9B 2VRAA 2R39A 4PP2B 3EOBA 1MAKA 2ITDA 2HJKA 3QHZH 3NZ8A 4ETYA 4EBQH 3BT2L 4X7DC 5DO2D 1QYGL 4NO2A 2ZKHL 3HA0A 4EI5D 3HC3L 4H5SA 2JB5H 4KMTH 1Q8MA 2L7JA 3ARXA 2CIKA 3U9PL 1SBBA 2VLKB 2VXQH 5HDLA 1RULL 4LGPB 2YZ8A 1I9JH 3AAZA 3A6BL 3LD8B 4I0PA 4DGVL 2ARJA 5C6WH 3EO9L 3SE4C 4OF0A 3EW3B 4MWFA 1MFNA 2AXJA 4BSJA 1JPFB 3IDUA 3SN6N 3HR5A 5LAXB 1DVFA 4PFEA 4WEMB 4XVJH 1M6OB 3UBXB 3O6KL 1N64L 1JI1A 5CIPA 1ZA6A 1P7QD 2WUBL 4DW2L 2PO6A 5LKNA 3SEPA 4ZAKB 4IDJH 1L7IH 4E41A 1YA5A 1Q1JH 3DBXA 3U0WH 5HI3D 4D3CH 1OSPL 3JVGC 1LGVA 4XPGL 1A6TA 4HS8H 5C0FB 5L2KD 1OT1A 5H94A 4BM7A 3FQRA 4JEGB 4EUPH 3FQUB 3TO2A 2FLRT 2PTTB 4MSWB 5B4MD 1D5MA 3SO3C 1PY4A 1VCAA 4K3EH 2HFTA 2V6HA 5D1ZB 3LRHA 3AMKA 4GMSH 1FZKB 1J8HA 5DK0A 5AG9A 4Y1AE 3BMWA 3VDCA 4XVUC 1BOGB 1INQA 3PDOA 3TEUA 1WBXA 2BOBA 2A73B 2RIKA 3A0OA 4FXLA 4IDLA 4JHWH 5T3XL 1FPTH 5F93C 1PKOA 4ZUVA 3WFEH 3SDDD 3RUGB 1Z5LA 1BGXL 2GTZB 4Y5XC 3TIDA 3VRIB 4M5YL 3BEWB 2YA0A 5D4QA 1U8PA 5F7MC 1S7TA 4WFGE 5IGXL 1XR8A 1ZLSH 5SX4H 4YBLB 4BFIA 4Y5YA 5D5MF 1UADC 5CP3A 3RL1A 5D2NB 5F3HA 1XF3B 4CJ0A 3RVXC 5D6DC 2VITB 2GJJA 1U8HB 2FWOB 5ALBL 4NPYB 1E6OH 4G6KL 5K59E 2R0KL 4JRWA 5FF6B 2YC1A 1IGCH 1MFCH 5J9PA 1JMXA 4ODBD 4HKXB 1NGXA 3R1GL 5IOPB 5T1KA 3AY4C 5GPRA 1T0MA 2FBOJ 4L4TD 3WE6A 2Q3AA 3GJFA 4P2CG 4NHCL 3DOSA 1KELL 4NUGL 4Q6IB 3CLFH 3MJ9A 3V6FB 2UZXB 1KIUA 3I75A 5DEZA 2X89D 4NWTH 4PB0H 4UU9B 4XPBL 3GMOA 2YPLE 2D7OA 3VFWB 1U41A 3LKQB 2NY3C 4Y4KB 5I73C 4MDIA 1ETZA 5CGYC 5E00B 1U92B 3UPCA 3TJHC 5KAQF 3BJ91 1S7QB 4PJ7B 3DNKA 4TQEH 2XXMB 4PJIF 3PNWA 4HWNA 4FG6D 4EEEA 4Z7WE 4UAOB 1S7UA 3WS6C 2WBWB 1XMWA 2VQUA 3CDFA 5TE6L 3QEUA 1IC7H 1S9VB 1J1PH 3BD4A 4BA8A 2A6IB 2WIIA 1HINH 3ULVL 3ESUF 1TVHA 1NGPL 3FO2B 3V6BR 2QHRL 4NQCD 2W0KA 4X7TB 5L0QC 1J1XL 2IGFH 5C0JA 5C9JA 1A14H 1MFDH 4M61A 1KLGA 4DAGH 1HHIB 1I3RA 3OKKB 5CHNA 3SGDI 3IVKA 1K3ZA 1KBGL 4OLUH 3WYRA 3QXVA 4GW1A 2AP2A 1AGFB 5CEZE 5CP7A 3DMMD 2YHGA 2O26U 1DQQA 2R1XB 1AO7D 1A3LH 2EDBA 4Q74A 3GRWL 2VMFA 4LHUD 2G75B 4XGZB 1KN2L 2ZUTA 4LCCC 1CE1H 4LLVB 2A74A 4AEHH 4LCYA 3MYJB 3NA4A 2JIXA 1QR1B 2EDFA 5KW9L 4ZODA 4HUXB 4D9QE 2IANE 1CVSC 1PQZB 3DRTA 4YE4L 1C16B 4ODUA 1I1AA 3TBVB 1AGEA 1BF8A 2XTJD 5SWZA 3QXWA 2E9IA 3Q2CA 5TPWL 4KRLB 3BRGC 3MLUL 3KPPA 1WIOA 4GUPA 4ORGB 3TFKC 3UO1L 5EO0A 4WHDA 4JPIB 5FYJD 1MLCA 4ZO7A 1IQDB 4MLIA 3SKNA 1G9ML 1PD6A 4FTVD 3VFTA 4F7CB 4NNPL 3MROB 1N5YH 5J6HA 4U33A 4A6YA 4F7TA 1I7ZB 1NDMA 2HRPL 1JNJA 5IHZB 4XMPH 4TUOA 4Y0GA 1CFVL 3JTTA 3KPRA 4HIIA 4BUGA 2DF3A 1UJ3A 2VDOH 2DD8H