4NFRA

Human brain aspartoacylase mutant e285a complex with intermediate analog (n-phosphonomethyl-l-aspartate)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
301
structure length
301
Chain Sequence
HIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNAAAYYEKKEAFAKTTKLTLNAKSIRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartoacylase
publication title Aspartoacylase catalytic deficiency as the cause of canavan disease: a structural perspective.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 93
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2013-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4nfrA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4nfrA01
4FBEA 7CPAA 1R43A 4ZY1A 3PRTA 2C6GA 3K2KA 4KSIA 1VHOA 1DTDA 2CIJA 3FX6A 3K9TA 4X2TA 4K3NA 3PB7X 3D68A 1M4LA 1LCPA 3KL9A 3KQXA 3IFEA 4F9UA 3LWUA 3N5FA 2O53A 2F7VA 4PXCA 1YMEA 2XEIA 1FNOA 3JRUA 2CF4A 2GLJA 4NGQA 2PJ4A 1GYTA 2XEGA 2ZOFA 3H8FA 4UEFA 2RB7A 3NH4A 2XEFA 3B3SA 1FT7A 3PBBA 5JM6A 1TKJA 4JZ0A 2PJ8A 2C6CA 4A94A 2PJ9A 1ZG7A 4EWTA 1ZLHA 2C6PA 5DS0A 2ZEMA 5K8MA 1IGBA 1ARMA 1LFWA 3RZAA 4ZX9A 3RAMA 5I4MA 1VGYA 2CTBA 5K8OA 1HEEA 3ISXA 5K8PA 2PE3A 1UWYA 3D7HA 2PRQA 3S9LA 3KR4A 3QNVA 4R7MA 4ZYQA 5HXDA 4X8IA 2WYRA 3B3VA 4OIDA 3MRUA 2PJCA 3IC1A 2PJBA 5THWA 3PBEA 2ZEDA 2GREA 4P4EA 1IY7A 2QVPA 4WJBA 3B35A 2HB6A 3S9MA 1KWMA 1NSAA 1ELLP 3B3CA 4OC5A 3KI9A 1F2PA 5J1QA 3KQZA 5LRGA 2PIZA 2ZOGA 3IIBA 3B7IA 4P4IA 3V38A 2PIYA 1LOKA 1HDQA 4OC0A 1OBRA 3KGQA 4UIBA 2PVVA 3PB6X 1XFOA 1XRYA 2EWBA 3CPAA 2BCOA 2F8HA 3NA6A 3CDXA 2GU2A 4NGMA 5LYDA 4MRIA 1CP7A 4UEZA 2CTCA 1XBUA 2PJ6A 4UEEA 3B3WA 3FH4A 1Y7EA 2IQ6A 4MHYA 3FEEA 2PJ1A 4ZY2A 4F9VA 4G1PA 3IWWA 4F8ZA 2AFUA 3BHXA 1RTQA 4OMEA 5ELYA 3DLJA 2DEAA 4OP4A 1Z2LA 3S9NA 3KHZA 3VH9A 4AXVA 2BO9A 2JBKA 4MHNA 4MHPA 4R8FA 2O4HA 2ZEEA 3PB8X 4P45A 2ABZA 2WZNA 4PXBA 4B6ZA 4NGRA 2HC9A 3WT4A 3LMSA 4P4FA 1YLOA 3IJ3A 3TX8A 3VARA 3IO1A 4PQAA 2GLFA 4OC1A 1ZG8A 1ARLA 5CBMA 2OR4A 3HLPA 4A39A 4DJLA 1Z5RA 2JEWA 2ANPA 4PXEA 4UIAA 4BD9A 4R6TA 3D7GA 1QQ9A 4MXUA 4ZX8A 1CP6A 2PJ7A 2RFHA 2AFXA 3WC6A 2ZEPA 4TNUA 3PFEA 3FEDA 4A37A 1BPNA 3B2YA 4NGNA 3D66A 3V7ZA 2AFSA 4YU9A 4GM5A 1AYEA 5JGFA 2AFOA 4IAVA 2EK8A 4MMOA 3KHXA 4OC3A 1VIXA 3FF3A 2Q43A 2ZEHA 1Y0RA 3RBUA 4YWYA 4RUHA 3WC5A 5LYIA 3FJUA 4Q7AA 3GLJA 3PB9X 8CPAA 2QJ8A 2PVWA 2PCUA 3SJEA 1VHEA 1ZLIA 3T8WA 4H2KA 4MCSA 2AFWA 2ZELA 2PJAA 3PEIA 4FAIA 2AFZA 4NJRA 1YW6A 3B3TA 2PJ2A 1YSJA 3KZWA 5HVHA 4P6YA 4MHZA 1CBXA 4O23A 5HVFA 2EK9A 5D29A 2V8HA 2ZEOA 4DYOA 2ZENA 4P4JA 5LYFA 3DGVA 3SJGA 4FUUA 1BAVA 3MN8A 2IJZA 2V8DA 4DUKA 3BI1A 1F57A 1ELMP 2VL1A 1F2OA 4NFRA 3BI0A 3H8EA 4IK2A 4LQGA 4PPZA 5CPAA 3HUVA 4X3RA 1EE3P 3CT9A 3BXMA 1Y0YA 4Z65A 4P4BA 1PCAA 4NJQA 4ONWA 2IMOA 2PJ5A 2ZEFA 3ISZA 4JYWA 3SI0A 2V8VA 3I1UA 1Z8LA 1JQGA 3NH5A 2NSMA 3D7DA 2AFMA 4MCRA 4PXDA 5LRJA 5LYLA 3SI1A 2ZEGA 1R3NA 1HDUA 1DE4C 3GB0A 4UF4A 1CG2A 1TKFA 6CPAA 3WC7A 5JH9A 4FWUA 1TF8A 1LAPA 1AMPA 3KASA 1CPSA 3PFOA 4ZY0A 3D7FA 3FECA 4R76A 3NFZA 3L2NA 1Q7LA 2NYQA 4TWEA 4W9YA 4CPAA 3D67A 3GUXA 2PJ0A 2J9AA 2JBJA 3CPXA 4WWVA 1PYTB 4NGSA 4OKOA 3VATA 4P4DA 1TF9A 3WABA 4OC2A 1H8LA 1TKHA 1QMUA 4MCPA 1LANA 3SI2A 1BPMA 4IHMA 3SJFA 4A38A 2Q4ZA 4P44A 3FVLA 3PB4X 3KR5A 1CPXA 4EMEA 5LRKA 1CX8A 4ZI6A 1TXRA 3TC8A 1XJOA 3NH8A 2G9DA 1LAMA 4P10A 2C1CA 2FVGA 1ZG9A 3FMCA 2V8GA 4EFDA 5D8NA 2PJ3A 3IEHA 2POKA 3D4UA 3H8GA 2OOTA 2BOAA 4OIWA 5HVGA 4NGPA 5IB9A 1BLLE 2Q51A 3SJXA 2I3CA 4NGTA 5F09A 2XEJA 5K8NA 1YW4A 2QYVA 4MCQA 1XMBA 4OC4A 2V77A
chains in the Genus database with same CATH superfamily
4F0XA 1J4JA 2VZYA 3K2KA 1VHOA 2PK7A 5FLXf 3TE4A 4NBFA 3FX6A 2A4NA 4KVOE 3CMAZ 3TDHB 4A95A 3KL9A 3IFEA 3FQMA 3LWUA 3VMHA 2Z0ZA 2VPWA 4NBEA 2QA4Z 4HH4A 1FNOA 1S7NA 3JRUA 3QAYA 4E2XA 3CD61 3HOXI 2R1IA 1N71A 4UFXA 2XEGA 4MD9A 2ZOFA 4M6IA 4UEFA 4H6UA 1Z9UA 1PU9A 1FT7A 5JM6A 4M6HA 2C6CA 3LD2A 2V3VA 2NVQI 4EWTA 2WAQA 4LUAA 2ZAEB 2JA5I 3EXNA 1X12A 4FD5A 1P0HA 3F3FC 2D4OA 1ARMA 3FNCA 1RLYA 1VQ81 1K8A1 3FIXA 2QR1B 4NBAA 2B3VA 1VQNZ 5KTAA 4RVDA 1UWYA 2GTHA 2PRQA 4R7MA 3IC1A 1XF8A 2PC1A 2ZEDA 3BLNA 2YGWA 1U6MA 2B5GB 1VQP1 3B3CA 4OC5A 3KI9A 3S1MI 1F2PA 5LRGA 3GTJI 1PFTA 2VQYA 4BY1I 2PIYA 1HDQA 1OBRA 4UIBA 4QTUA 2PVVA 2OTJZ 4U9YA 2JA7I 3CXPA 2Q4VA 3NA6A 3CXQA 3OW2Z 5G20A 3W6SA 2PJ6A 2Z3LA 4S1TA 5CNPA 2OOXB 3CCEZ 4ZBGA 3CCLZ 1CJWA 4F8ZA 2PR1A 5C3EI 2F4OA 1VQ91 2QLVB 2V8KA 4UFWA 1I50I 4KOUA 2BEIA 4B11A 2IZ3A 1M44A 1IOIA 3CC2Z 4CAWA 4RV9A 2JBKA 2OTLZ 2ZEEA 3QAHA 2WZNA 4PXBA 3GY9A 1S72Z 2X7BA 2R92I 4DNCA 4E30A 4C2XA 4P4FA 1YLOA 3IJ3A 4MI4A 4RN7A 2KPIA 4OAEA 1AUGA 4HGYA 4MJ8A 4MH4A 3CCUZ 3B8GA 1ZG8A 1N8R2 3HLPA 4A39A 1Z5RA 4XX2A 3KKWA 4F6AA 1IB1E 4AB7A 1ZO0A 3HOUI 1VQOZ 4BINA 2FCKA 2PJ7A 3WC6A 2JIQA 1S7FA 3PFEA 2VF1A 3B2YA 4CYPA 3SHPA 4YU9A 4GM5A 1AYEA 1GHEA 3I55Z 4IAVA 4MMOA 5AN9F 1VLAA 2J8NA 3KHXA 1VIXA 3FF3A 2E7ZA 1LRZA 2ZXVA 4ORFA 4YWYA 1Z8XA 3WC5A 2B58A 1L0CA 4KLWA 3SXNA 2PVWA 1VHEA 2H85A 3T8WA 4H2KA 4RS4A 4PK3A 3BG0B 2BSWA 3IU1A 4CGOA 2K3RA 1YUAA 5AG5A 2PJ2A 2G0BA 1CM0A 1Q862 4MHZA 2PDOA 1CBXA 2ZW5A 3I4MI 2V8HA 1ON0A 4DYOA 3JUWA 2OOYB 3MN8A 2IJZA 1IIDA 1YIJZ 2R7HA 2VL1A 2OTJ1 3BI0A 4PPZA 4X3RA 3BXMA 1Y0YA 4B14A 4CAXA 1Z03A 4MFJA 3BJ8A 2IMOA 4ONWA 3ISZA 4MFPA 3CCE1 4I49A 3I1UA 1Z8LA 3CCL1 4MCRA 5LRJA 3GYAA 2JS4A 3F3PC 1KZFA 3GKRA 1DE4C 2PQ8A 3GB0A 4UF4A 2JMOA 1CG2A 6CPAA 1Q861 5JH9A 1TWFI 1CPSA 2Y0SA 5I0CA 2IV2X 1S721 1QF8A 3PO3S 3CCJ1 2G3TA 2V45A 3L2NA 3J81f 1DL6A 1VQ7Z 3S16I 3GTGI 4TWEA 3D67A 3CPXA 2O28A 1VQL1 4C68A 5IV0A 4QUSA 3VATA 1Q822 4Y52I 5T67A 1TWCI 3T90A 3SJFA 1Q812 4NBCA 4BBSI 3FVLA 5LRKA 5C88A 3TC8A 4UCNA 4HNWB 2G9DA 1TWAI 4B13A 4CAVA 3DR8A 2C1CA 3FMCA 3CD6Z 2V8GA 4EFDA 2GFQA 5D8NA 2PJ3A 5AGEA 2BOAA 4OIWA 3CME1 3CPWY 3VWDA 3SJXA 2I3CA 5JQ4A 4Y49B 4RI1A 4CL1A 1R43A 4ZY1A 4GS4A 2C6GA 1DTDA 2JEVA 1X10A 1TWHI 3PZJA 4K3NA 2P6FA 1Q821 3S17I 2QMLA 4KOYA 3IWGA 2O53A 4AG7A 1VQ8Z 2F7VA 1YMEA 4A3KI 2XEIA 3P2FA 5EBVA 1Q811 2P6GA 2Z3KA 1QSOA 4NGQA 4PK2A 1KUXA 2QIRA 2B3UA 2RB7A 3NH4A 2XEFA 2NVXI 3T9YA 3R9GA 1S3ZA 1VQM1 4JZ0A 4II9A 3CXSA 4M3SA 4A94A 3J80b 2Z3PA 2LEXA 5DS0A 5C82A 5K8MA 4E2ZA 2YNEA 4KLVA 1VQPZ 2BUEA 4CGPA 3RAMA 3CQZI 3TFYA 4E0AA 4KSFA 5K8OA 3ISXA 5ISVA 4BY7I 1P9NA 2OZUA 2Z11A 1JJ2Y 4JXRA 4A30A 2E9HA 2QREB 4A3BI 3QNVA 3IU2A 4ZYQA 1FDIA 5HXDA 4X8IA 2WYRA 3PBEA 2GREA 3H4QA 3TOBA 2AYDA 4KZTA 2FE7A 4DGLA 2HB6A 1FY7A 1XEBA 5IX3A 2WB1A 2ARHA 5KTCA 4CAEA 5D1OB 3G8WA 1RQFA 3KQZA 1WCMI 2PIZA 1VQ51 1VQ9Z 2I79A 3G4S1 3MZKB 1QVFY 4Q38A 3WR7A 3D8PA 1VQ71 3V38A 2FSRA 2AE6A 4A93I 2JIPA 3HOYI 2EWBA 3CPAA 2HU9A 1OZPA 1YR0A 5LYDA 1Q2CA 1S7MA 1Z01A 1KD12 2JNYA 1N2FA 1Y7EA 3CXCY 3FXTA 2PJ1A 3GTKI 2B5GA 4F9VA 1USPB 3IFUA 4G1PA 2J8RA 1B87A 4RS2A 2AFUA 3LUSA 4OMEA 2BL1A 3TO9A 4CGNA 3W6XA 3DLJA 3A9LA 1Z2LA 4OP4A 3S9NA 4MBUA 2R8VA 4R3LA 2CNTA 2P28A 3M3YI 3S14I 4AXVA 2BO9A 4MHNA 1W2BY 4BXXI 4B6ZA 1Y9WA 2HC9A 3WT4A 1Y1VS 3LMSA 2NAPA 3TX8A 1YJNZ 4JD6A 2AJ6A 4MY3A 5C4JI 2RC4A 1XE4A 1ARLA 4AVAA 2VUGA 1KD11 4A33A 3J80f 5T64A 2JEWA 4U5YA 4PXEA 4UBRA 2E2HI 1Q7Y2 1QVGZ 4MXUA 3PO2I 1VQK1 2ATRA 4BMHA 4CGLA 4A37A 5G21A 1BPNA 4NGNA 3D66A 1YX0A 4PSWA 4XNHB 3RYOA 3NE7A 2AFSA 1RNIA 5JGFA 4C7IA 2FXFA 4IF5A 1Y0RA 2REEA 3C26A 2NVTI 3IWEA 4Q7AA 5CM2M 3PB9X 2QJ8A 1S5KA 2GANA 3SJEA 3IF8A 1K9M2 4HNXB 4MCSA 3I07A 2ZELA 4MFLA 2PJAA 3PEIA 3ZJ0A 4X5KA 1XIXA 4NJRA 1SIWA 1S7KA 4UCPA 3HOWI 3B3TA 1YSJA 3KZWA 4KOTA 5HVHA 4P6YA 1QYPA 2EGTA 1Q7Y1 1KC82 4UWJA 5HVFA 2ZENA 2PMZA 4P4JA 1X3WA 3DGVA 3SJGA 4FUUA 3HKZA 4L8AA 2NMTA 2VBQA 2V8DA 4U9ZA 1NUIA 5T6BA 4LQGA 1FDOA 4NBBA 5CPAA 3HUVA 3CT9A 5KTDA 2OZHA 1S60A 4Z65A 4NF1A 2HQYA 2Q04A 4P4BA 1P4NA 1Q2DA 3CCJZ 2D4PA 1PCAA 1ZB8A 3CCSZ 1VQLZ 1JQGA 4NBDA 3G6E1 2R98A 4JWPA 2PR8A 1K9M1 4KSAA 2AFMA 2H5MA 5EMIA 3J81b 1R3NA 3R9FA 2RBLA 1TKFA 3D3SA 1TIQA 2JA6I 3CCM1 3V8IA 1KC81 3KASA 4XPLA 3S6GA 2AKLA 2Q44A 2Q7SA 1Q7LA 4FD4A 2RPRA 5G22A 2PJ0A 2J9AA 2JBJA 1YJN1 2G3AA 1WK4A 4RVFA 3CMEZ 3GKQA 4B5OA 3SI2A 3R95A 4LX9A 1NE9A 2DPTA 2KI7B 2Q4ZA 1RXTA 4KVXA 3GCFA 1K732 3FBUA 1K4JA 5G1ZA 3R96A 1CX8A 4ZI6A 3NH8A 1N8R1 1VHSA 2M6NA 4JXQA 4CS0B 3VMGA 2WUUA 5DWMA 2F5IA 3OW2Y 5JPHA 4OADA 1ZG9A 4M6GA 3M4OI 5F48A 4AVCA 2QECA 4M85A 4E33A 2NVYI 3H8GA 2OOTA 5HVGA 1VQMZ 1XMBA 4CGMA 1JWQA 2BJOA 3QB8A 2V77A 3LODA 7CPAA 3R9EA 3PRTA 3CPWZ 5IT9f 4B12A 2HF1A 2OZKA 3D68A 1LCPA 3EC4A 3MONA 1R57A 2FS5A 5D1PA 3N5FA 3EEDA 4B5PB 3J7A4 1JWHC 1Z8WA 3FRMA 4PXCA 5IP9I 2R7ZI 2GLJA 4XPDB 4B10A 1GYTA 2DE5A 1K731 5DWNA 3PBBA 1RO5A 4MY0A 1TKJA 3KIFA 4A3DI 3I56Z 1KUVA 4KOXA 2ZEMA 3EERA 1ZH1A 1IGBA 1TWGI 2JA8I 3S1NI 4ZX9A 4A3JI 1M902 5I4MA 4MONA 1VQ5Z 1VGYA 4JJXA 4NB8A 3G4SZ 4KOWA 2DF5A 1HEEA 5F47A 2FIAA 3CCS1 3IR7A 1SQHA 1M1K2 3PGPA 2VXKA 4A32A 3KR4A 4C2YA 4OIDA 2PJCA 5THWA 4RVGA 1JJ2Z 2JDDA 2Y0MA 4CRYB 4KOVA 3PP9A 4WJBA 2P3YA 1VQ61 3B35A 1NSLA 4NOZA 3ZZIA 3Q87A 4A3CI 3CCV1 1NSAA 2CY2A 3G71Z 4C2ZA 3VMIA 5J1QA 1KUYA 2VPZA 2EUIA 2JDCA 2V8IA 5J8FA 1S7LA 4BBHA 2ZOGA 3IIBA 4P4IA 2W03A 1L1OC 4GXHA 3BG1B 3KGQA 1KQSY 1Y9KA 5BWAB 1XRYA 1QSRA 1QVFZ 4HGZA 3CDXA 3UY5A 4NGMA 2FIWA 4Y7NI 4MRIA 1CP7A 4UEZA 1XBUA 3EY5A 3D6WA 1Z4EA 4MHYA 2K5RA 1M1K1 2M48A 5FVJA 5D1OA 3IWWA 3CXCZ 1YLEA 3BHXA 5J8CA 3CC41 3TCVA 5HH1A 2Z10A 3KHZA 1R9TI 4IUSA 3H0GI 2JLMA 3TO7A 5A27A 4R8FA 4MHPA 2P6EA 2LFUA 2O4HA 3PB8X 2ABZA 1WIIA 1VQKZ 4L89A 4PSXA 1MK4A 4NGRA 3TE5B 1M4GA 1B6BA 2ZW6A 3VARA 4CRZB 1USPA 1QSMA 3IO1A 4OC1A 3S1RI 1M1DA 1WW9A 1M4DA 1AA6A 5CBMA 2VPXA 2QEX1 4DJLA 2ANPA 3N7ZA 4BD9A 5F46A 1QQ9A 1XMTA 4ZX8A 2YNCA 2RFHA 3QWUA 2WPWA 4C7HA 2ZEPA 3I561 1KRLA 4CAFA 3FEDA 4XNHC 3TTHA 2B4DB 3IGRA 4CYOA 4UCMA 2VUMI 3P5JB 1UFHA 1Z02A 2EK8A 2Q43A 2ZEHA 2PSWA 2ZW4A 3RBUA 4RUHA 5LYIA 3FJUA 3RZOI 2B63I 1YUKA 3TO6A 3GTMI 5FLMI 4EVYA 2PCUA 4F0YA 3S6KA 3CCQ1 2AFWA 5IP7I 4FAIA 2W04A 2AFZA 1Q2YA 4DQYB 1MJ9A 2G2KA 1Y8CA 2REFA 4O23A 1A2ZA 2ZEOA 3G6EZ 3G711 4E32A 4YRHA 5LYFA 1BAVA 2KCWA 2OZGA 3BI1A 1F57A 2CXAA 3CC71 1F2OA 3H8EA 4IK2A 3CCMZ 3D2LA 4E2WA 2CNMA 4NJQA 4A2ZA 2ZW7A 3GTQI 2PJ5A 4CYQA 4JYWA 4A3MI 4K30A 1WZNA 4MFKA 5AG4A 2C27A 4LQ6A 4MHDA 4ZGYB 5LYLA 5C4XI 5F49A 3VWEA 3I4NI 3RNZA 2YU9I 3H3VJ 1I12A 1TF8A 3I3GA 3S2HI 3PFOA 3EO4A 5C44I 3D7FA 4YFJA 2F4MA 2NYQA 3JAMb 3GUXA 1VQ4Z 4HNYB 2J8MA 3NDJA 3F5BA 4P4DA 3WABA 4OC2A 2LIYA 1H8LA 5H86A 2RIQA 1YJW1 4IHMA 1YIT1 2K5TA 4A38A 3T4NB 2FT0A 4P44A 3EFAA 3KR5A 1CPXA 5A28A 1TXRA 1XJOA 1YI21 1LQLA 2EO8A 4JLYA 4MFZA 1Y1WI 1I21A 2FVGA 5IT9b 1NMTA 1YHQ1 3K9UA 2DPSA 4NGPA 1BLLE 1IYKA 1QXFA 4NGTA 4Q36A 2XEJA 5K8NA 1YJ91 4FD6A 3S6FA 5GCNA 3CZXA 4FBEA 2QKDA 4KSIA 2J6AA 2Q7BA 2CIJA 3G3SA 3K9TA 4X2TA 3PB7X 3TOAA 3D2PA 1M4LA 3NDIA 3KQXA 1M4IA 4F9UA 3W91A 4A3FI 1YVOA 4J3GA 1IU8A 1WJ2A 2CF4A 4XPDC 2OU2A 2PJ4A 1Y1VI 3HOVI 1I1DA 3H8FA 3U50C 3JVNA 3B3SA 4R87A 2Q4YA 4MD8A 2PJ8A 2PJ9A 1ZG7A 4MD7A 1ZLHA 2C6PA 3CMA1 1VQ6Z 3CCVZ 2E2II 4E8OA 1LFWA 1YGHA 3RZAA 2QA41 2RHBA 4B5PA 1QVGY 2CTBA 1MJBA 5K8PA 2CNSA 2PE3A 3DDDA 2PRBA 3FB3A 2RT9A 3D7HA 3S9LA 1Z4RA 1K83I 1I3QI 3B3VA 3MRUA 1WWZA 2PJBA 1NP6A 4ONUA 1Q16A 4P4EA 2VEZA 2ZPAA 4R9MA 1IY7A 3GIUA 3JAMf 2QVPA 1YREA 3S9MA 1KWMA 4R57A 1ELLP 1VKCA 4A3EI 2DE7A 2QRCB 3K7AI 4OLLA 4AG9A 3S6HA 3B7IA 2GE3A 3CC4Z 1LOKA 2JIOA 2VPYA 4OC0A 1VQ41 1VQN1 3PB6X 1XFOA 1X0TA 1ZB9A 3D2MA 2BCOA 2F8HA 4E2AA 2GU2A 3RO0A 4Y49C 5H84A 2CTCA 1KQSZ 4UEEA 3JTKA 2PM9A 2YNDA 3B3WA 3FH4A 1PUAA 3I9SA 2FL4A 2IQ6A 3FEEA 4KUAA 5A2Qb 4ZY2A 4DK1A 3DR6A 1NJI2 2GIVA 3GTPI 4QVTA 2R6MA 1X3ZA 1RTQA 5ELYA 2QEXZ 2DEAA 4FD7A 1IYLA 3VH9A 4RVHA 1V0CA 1RO4A 2WSAA 4A31A 1IOFA 2QRDB 4P45A 4QC6A 3HOZI 2Z3OA 2HV2A 4R3KA 3DNSA 3VB9A 4YGOA 1BO4A 3GTLI 3SXOA 3VTNA 4PQAA 2GLFA 1SFOI 2I00A 4KS9A 2OR4A 3MZLB 2VZZA 4A3LI 1RO0A 5HMNA 4UIAA 2DXQA 4NBHA 4NB9A 4R6TA 3D9XA 1BOBA 3D7GA 3CC21 3ESWA 2OTL1 5LL6f 1CP6A 1NJI1 4NBGA 2AFXA 3CCQZ 4HKFA 4TNUA 3CCRZ 3FYNA 4XPKA 3V7ZA 4MFQA 4H89A 4A3GI 3MGDA 2AFOA 3CCU1 1Z8TA 4OC3A 1ML8A 3R1KA 4E31A 5AG7A 4H6ZA 2R93I 3GLJA 4QB9A 3CC7Z 8CPAA 1YQEA 1VQO1 1YVKA 3P2HA 4UFVA 3KIHA 4A3II 3DSBA 1ZLIA 1M901 1YW6A 3GTMS 3GTOI 2B4DA 4QBJA 5FLXb 2IL4A 2VI7A 3OWCA 2Z3NA 4QTTA 2EK9A 5D29A 3RZDI 3I551 2E2JI 2V8JA 2B4BA 4DUKA 5EC4A 4BBRI 4UA3A 3TT2A 2HUZA 1ELMP 4NFRA 2Z3MA 2OH1A 5A2Qf 1EE3P 2YNCC 3NE8A 2IZ4A 4NH1C 3FKII 4KVME 4CYNA 2ODFA 2ZEFA 1IICA 3S2DI 4AYBA 1W2BZ 3SI0A 2JUBA 2V8VA 5E96A 2YADA 3NH5A 2NSMA 3D7DA 4PXDA 4NCZA 4EWCA 1RO2A 2Q0YA 3LACA 1YJWZ 1YIJ1 2JIMA 2ZEGA 3SI1A 2WPXA 3IX0A 1HDUA 3PO3I 3WC7A 4NEXA 1YITZ 1QSTA 4FWUA 3BJ7A 1XOVA 1LAPA 1AMPA 4NXYA 4KOSA 4E2YA 4ZY0A 4AVBA 5IB0A 1YI2Z 3FECA 4HPSA 4R76A 3NFZA 4KUBA 3S1QI 4PV6A 3FQQA 4W9YA 4CPAA 3H5ZA 2GTIA 4WWVA 1PYTB 2P0WA 4NSQA 4NGSA 1YHQZ 4OKOA 5AG6A 1TF9A 1YK3A 1TKHA 1QMUA 4MCPA 1YJ9Z 1LANA 4X6AI 3S15I 1BPMA 2JIRA 2OB0A 3F0AA 4UWIA 3PB4X 4EMEA 2EVNA 2JR6A 4KORA 1QSNA 3F8KA 1LAMA 3E0KA 3CCR1 4P10A 1I6HI 3IEHA 2POKA 3D4UA 1Y7RA 2EBJA 5IB9A 2Q51A 5F09A 1TFIA 1MJAA 1YW4A 2QYVA 4MCQA 1K8A2 2DE6A 4OC4A
chains in the Genus database with same CATH topology
4FBEA 2QKDA 7CPAA 4CL1A 1R43A 4ZY1A 3PRTA 2C6GA 3K2KA 4KSIA 1VHOA 2PK7A 1DTDA 2J6AA 5FLXf 3CPWZ 2CIJA 5IT9f 4NBFA 3FX6A 3CMAZ 1TWHI 3K9TA 4K3NA 4X2TA 3PB7X 2HF1A 2OZKA 3D68A 3TDHB 1M4LA 1LCPA 1Q821 3MONA 3KL9A 3NDIA 3S17I 3IFEA 3KQXA 3FQMA 5D1PA 4F9UA 4A3FI 3LWUA 3VMHA 3N5FA 3EEDA 2O53A 3J7A4 1VQ8Z 4NBEA 2QA4Z 1JWHC 2F7VA 1YMEA 4PXCA 4A3KI 4HH4A 2XEIA 1FNOA 3JRUA 2CF4A 4E2XA 1Q811 5IP9I 3CD61 2R7ZI 2GLJA 4NGQA 3HOXI 2PJ4A 1Y1VI 3HOVI 1GYTA 2XEGA 2DE5A 4MD9A 1K731 2ZOFA 3H8FA 4UEFA 3U50C 2RB7A 3NH4A 2XEFA 3B3SA 1FT7A 2NVXI 3PBBA 5JM6A 1TKJA 1VQM1 4JZ0A 4MD8A 3KIFA 2PJ8A 2C6CA 4A94A 3J80b 2PJ9A 4A3DI 1ZG7A 4MD7A 2NVQI 3I56Z 4EWTA 2WAQA 2ZAEB 1ZLHA 2C6PA 2JA5I 5DS0A 3CMA1 2ZEMA 5K8MA 1VQ6Z 4E2ZA 3EERA 1ZH1A 1IGBA 3CCVZ 1TWGI 1VQPZ 2E2II 2JA8I 3F3FC 1ARMA 1LFWA 3S1NI 3RZAA 4ZX9A 1RLYA 2QA41 4A3JI 1M902 1VQ81 2RHBA 1K8A1 3RAMA 5I4MA 3CQZI 4MONA 1QVGY 2QR1B 1VQ5Z 1VGYA 4NB8A 3G4SZ 2CTBA 5K8OA 1HEEA 3ISXA 5K8PA 2PE3A 4BY7I 1P9NA 3CCS1 4NBAA 1JJ2Y 1VQNZ 1M1K2 4RVDA 1UWYA 2GTHA 2RT9A 3D7HA 2PRQA 3S9LA 2E9HA 1K83I 2QREB 4A3BI 3KR4A 3QNVA 4R7MA 4ZYQA 1I3QI 5HXDA 4X8IA 2WYRA 3B3VA 4OIDA 3MRUA 2PJCA 3IC1A 2PJBA 5THWA 3PBEA 1NP6A 4RVGA 2ZEDA 2GREA 1JJ2Z 4P4EA 1IY7A 3JAMf 2QVPA 4WJBA 2P3YA 4DGLA 1VQ61 2HB6A 4NOZA 3B35A 3S9MA 3Q87A 4A3CI 3CCV1 2WB1A 1KWMA 1NSAA 1ELLP 1VQP1 3B3CA 4OC5A 3KI9A 4A3EI 3S1MI 2DE7A 2QRCB 5D1OB 1F2PA 3G71Z 3VMIA 3K7AI 5J1QA 1RQFA 3KQZA 1WCMI 2V8IA 5LRGA 2PIZA 3GTJI 1PFTA 1VQ51 1VQ9Z 4BY1I 3G4S1 3MZKB 1QVFY 2ZOGA 3IIBA 1VQ71 3B7IA 4P4IA 3V38A 3CC4Z 2PIYA 2W03A 1LOKA 1HDQA 1L1OC 4OC0A 3BG1B 1OBRA 3KGQA 4QTUA 4UIBA 1KQSY 2PVVA 1VQ41 1VQN1 4A93I 2OTJZ 3PB6X 1XFOA 1X0TA 1ZB9A 2JA7I 1XRYA 3HOYI 2EWBA 3CPAA 2BCOA 2F8HA 2HU9A 4HGZA 1QVFZ 3NA6A 3CDXA 2GU2A 4NGMA 3OW2Z 5LYDA 4Y7NI 4MRIA 1CP7A 4UEZA 2CTCA 1XBUA 1KQSZ 2PJ6A 1S7MA 1Z01A 1KD12 4UEEA 2PM9A 4S1TA 2JNYA 3D6WA 3B3WA 1N2FA 3FH4A 1Y7EA 3CXCY 2IQ6A 4MHYA 2K5RA 3FEEA 2OOXB 2PJ1A 3GTKI 5A2Qb 1M1K1 4ZY2A 4DK1A 3CCEZ 4F9VA 1USPB 2M48A 3IFUA 3CCLZ 5D1OA 4G1PA 3IWWA 4F8ZA 5C3EI 1NJI2 2F4OA 3CXCZ 1VQ91 3GTPI 2AFUA 3BHXA 2R6MA 3LUSA 1X3ZA 1RTQA 4OMEA 5ELYA 2QLVB 2QEXZ 2V8KA 3CC41 3DLJA 2DEAA 4OP4A 1Z2LA 3S9NA 3KHZA 3VH9A 4RVHA 1I50I 1R9TI 1RO4A 2IZ3A 2P28A 3H0GI 3M3YI 2QRDB 3S14I 4AXVA 2BO9A 3CC2Z 4RV9A 2JBKA 4MHNA 4MHPA 2OTLZ 4R8FA 2LFUA 2O4HA 2ZEEA 3PB8X 3HOZI 4P45A 1W2BY 2ABZA 2WZNA 4PXBA 1WIIA 1VQKZ 4BXXI 4B6ZA 1S72Z 4NGRA 3VB9A 2R92I 2HC9A 3TE5B 3WT4A 1Y1VS 4E30A 3LMSA 4P4FA 1YLOA 3IJ3A 3GTLI 3TX8A 1YJNZ 3VTNA 3VARA 2KPIA 1USPA 3IO1A 4PQAA 4HGYA 2GLFA 5C4JI 4OC1A 3S1RI 4MH4A 1SFOI 1WW9A 3CCUZ 1ZG8A 1ARLA 1N8R2 5CBMA 2VUGA 2QEX1 1KD11 3J80f 2OR4A 3MZLB 3HLPA 4A39A 4DJLA 4A3LI 5T64A 1Z5RA 4XX2A 2JEWA 1RO0A 2ANPA 4PXEA 4UIAA 4BD9A 4NBHA 4NB9A 4R6TA 2E2HI 3D9XA 3D7GA 1QQ9A 3CC21 1Q7Y2 1QVGZ 4MXUA 3ESWA 2OTL1 1VQOZ 3HOUI 5LL6f 4ZX8A 3PO2I 1CP6A 2PJ7A 1VQK1 2RFHA 3QWUA 1NJI1 4NBGA 2AFXA 3CCQZ 3WC6A 2ZEPA 4TNUA 3PFEA 3I561 1KRLA 3FEDA 3CCRZ 4A37A 1BPNA 2VF1A 3B2YA 4NGNA 3D66A 3V7ZA 4A3GI 2VUMI 2AFSA 3P5JB 4YU9A 4GM5A 1AYEA 1Z02A 1RNIA 5JGFA 3I55Z 2AFOA 4IAVA 3CCU1 2EK8A 4MMOA 5AN9F 1VLAA 3KHXA 4OC3A 1VIXA 3FF3A 2Q43A 1ML8A 4E31A 2ZEHA 1Y0RA 3RBUA 4YWYA 4RUHA 2NVTI 3WC5A 5LYIA 3FJUA 4Q7AA 2R93I 3RZOI 2B63I 3GLJA 1YUKA 3CC7Z 5CM2M 3PB9X 3GTMI 8CPAA 2QJ8A 1VQO1 5FLMI 2PVWA 2PCUA 3KIHA 3IF8A 3SJEA 4A3II 1VHEA 1K9M2 2H85A 1ZLIA 3T8WA 4H2KA 4RS4A 3CCQ1 4MCSA 2AFWA 3I07A 5IP7I 1M901 3BG0B 2PJAA 2ZELA 3PEIA 2W04A 4FAIA 2AFZA 4NJRA 2K3RA 1YUAA 4DQYB 3HOWI 1YW6A 3B3TA 2PJ2A 3GTMS 3GTOI 2G2KA 5FLXb 1YSJA 3KZWA 1Q862 5HVHA 4P6YA 1QYPA 4MHZA 2EGTA 1CBXA 4O23A 3I4MI 1Q7Y1 1KC82 4QTTA 2EK9A 5D29A 2V8HA 5HVFA 2ZEOA 3G6EZ 3RZDI 3I551 3G711 4DYOA 4E32A 2ZENA 2PMZA 4P4JA 2OOYB 1X3WA 5LYFA 3DGVA 2E2JI 3SJGA 4FUUA 1BAVA 2V8JA 3MN8A 3HKZA 2IJZA 2V8DA 4DUKA 1YIJZ 4BBRI 3BI1A 1NUIA 1F57A 1ELMP 2VL1A 5T6BA 3CC71 1F2OA 4NFRA 2OTJ1 3BI0A 3H8EA 4IK2A 3CCMZ 4LQGA 4PPZA 4NBBA 5CPAA 3HUVA 4X3RA 5A2Qf 1EE3P 3CT9A 3BXMA 2IZ4A 1Y0YA 4NH1C 1Z03A 4Z65A 4P4BA 4E2WA 3CCJZ 3FKII 1PCAA 4NJQA 4ONWA 3GTQI 2IMOA 2PJ5A 2ZEFA 1ZB8A 3ISZA 4JYWA 4A3MI 4AYBA 1W2BZ 3S2DI 3SI0A 3CCSZ 3CCE1 2JUBA 2V8VA 3I1UA 1VQLZ 1Z8LA 1JQGA 4NBDA 3G6E1 3CCL1 2YADA 3NH5A 2NSMA 3D7DA 1K9M1 2AFMA 4MCRA 4PXDA 5LRJA 5LYLA 4EWCA 1RO2A 5C4XI 1YJWZ 2JS4A 3F3PC 3J81b 1YIJ1 2ZEGA 3SI1A 3IX0A 1HDUA 1R3NA 1DE4C 3GB0A 3I4NI 4UF4A 2RBLA 2JMOA 1CG2A 1TKFA 6CPAA 2YU9I 3H3VJ 3PO3I 3WC7A 1Q861 2JA6I 1YITZ 1TWFI 3CCM1 5JH9A 4FWUA 1TF8A 1LAPA 1AMPA 1KC81 3KASA 3S2HI 1CPSA 4E2YA 3PFOA 2Y0SA 4ZY0A 5C44I 3D7FA 1YI2Z 1S721 1QF8A 2AKLA 3FECA 4R76A 3PO3S 3NFZA 3CCJ1 3S1QI 3FQQA 3J81f 1DL6A 1Q7LA 2F4MA 3L2NA 2NYQA 1VQ7Z 3S16I 3GTGI 2RPRA 4TWEA 3JAMb 4W9YA 4CPAA 3D67A 3GUXA 2PJ0A 2J9AA 2JBJA 1YJN1 3CPXA 2GTIA 4WWVA 1VQL1 1VQ4Z 1PYTB 4RVFA 4NGSA 1YHQZ 4OKOA 3VATA 3NDJA 1Q822 4P4DA 1TF9A 3CMEZ 3WABA 4Y52I 4OC2A 2LIYA 1H8LA 3GKQA 1TKHA 1QMUA 4MCPA 2RIQA 5T67A 1YJW1 1YJ9Z 1LANA 1TWCI 4X6AI 3SI2A 3S15I 1BPMA 4IHMA 3SJFA 1Q812 1YIT1 4A38A 2KI7B 2Q4ZA 3T4NB 3GCFA 4NBCA 4BBSI 3FVLA 4P44A 3PB4X 3KR5A 1K732 1CPXA 4EMEA 5LRKA 1CX8A 4ZI6A 1TXRA 2JR6A 3TC8A 1XJOA 1YI21 1LQLA 3NH8A 1N8R1 2G9DA 1TWAI 1LAMA 2M6NA 3VMGA 3CCR1 4P10A 1Y1WI 1I6HI 3OW2Y 2C1CA 2FVGA 1ZG9A 3FMCA 3CD6Z 5IT9b 2V8GA 4EFDA 5D8NA 3M4OI 2PJ3A 3IEHA 1YHQ1 2POKA 3D4UA 4E33A 2NVYI 3H8GA 2BOAA 4OIWA 3CME1 2OOTA 5HVGA 3CPWY 4NGPA 5IB9A 1BLLE 2Q51A 3SJXA 2I3CA 4NGTA 1VQMZ 5F09A 2XEJA 5K8NA 1TFIA 1YJ91 1YW4A 2QYVA 4MCQA 1XMBA 1K8A2 2DE6A 4OC4A 2BJOA 2V77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FBE A;  7CPA A;  1R43 A;  4ZY1 A;  3PRT A;  2C6G A;  3K2K A;  4KSI A;  1VHO A;  1DTD A;  2CIJ A;  3FX6 A;  3K9T A;  4X2T A;  4K3N A;  3PB7 X;  3D68 A;  1M4L A;  1LCP A;  3KL9 A;  3KQX A;  3IFE A;  4F9U A;  3LWU A;  3N5F A;  2O53 A;  2F7V A;  4PXC A;  1YME A;  2XEI A;  1FNO A;  3JRU A;  2CF4 A;  2GLJ A;  4NGQ A;  2PJ4 A;  1GYT A;  2XEG A;  2ZOF A;  3H8F A;  4UEF A;  2RB7 A;  3NH4 A;  2XEF A;  3B3S A;  1FT7 A;  3PBB A;  5JM6 A;  1TKJ A;  4JZ0 A;  2PJ8 A;  2C6C A;  4A94 A;  2PJ9 A;  1ZG7 A;  4EWT A;  1ZLH A;  2C6P A;  5DS0 A;  2ZEM A;  5K8M A;  1IGB A;  1ARM A;  1LFW A;  3RZA A;  4ZX9 A;  3RAM A;  5I4M A;  1VGY A;  2CTB A;  5K8O A;  1HEE A;  3ISX A;  5K8P A;  2PE3 A;  1UWY A;  3D7H A;  2PRQ A;  3S9L A;  3KR4 A;  3QNV A;  4R7M A;  4ZYQ A;  5HXD A;  4X8I A;  2WYR A;  3B3V A;  4OID A;  3MRU A;  2PJC A;  3IC1 A;  2PJB A;  5THW A;  3PBE A;  2ZED A;  2GRE A;  4P4E A;  1IY7 A;  2QVP A;  4WJB A;  3B35 A;  2HB6 A;  3S9M A;  1KWM A;  1NSA A;  1ELL P;  3B3C A;  4OC5 A;  3KI9 A;  1F2P A;  5J1Q A;  3KQZ A;  5LRG A;  2PIZ A;  2ZOG A;  3IIB A;  3B7I A;  4P4I A;  3V38 A;  2PIY A;  1LOK A;  1HDQ A;  4OC0 A;  1OBR A;  3KGQ A;  4UIB A;  2PVV A;  3PB6 X;  1XFO A;  1XRY A;  2EWB A;  3CPA A;  2BCO A;  2F8H A;  3NA6 A;  3CDX A;  2GU2 A;  4NGM A;  5LYD A;  4MRI A;  1CP7 A;  4UEZ A;  2CTC A;  1XBU A;  2PJ6 A;  4UEE A;  3B3W A;  3FH4 A;  1Y7E A;  2IQ6 A;  4MHY A;  3FEE A;  2PJ1 A;  4ZY2 A;  4F9V A;  4G1P A;  3IWW A;  4F8Z A;  2AFU A;  3BHX A;  1RTQ A;  4OME A;  5ELY A;  3DLJ A;  2DEA A;  4OP4 A;  1Z2L A;  3S9N A;  3KHZ A;  3VH9 A;  4AXV A;  2BO9 A;  2JBK A;  4MHN A;  4MHP A;  4R8F A;  2O4H A;  2ZEE A;  3PB8 X;  4P45 A;  2ABZ A;  2WZN A;  4PXB A;  4B6Z A;  4NGR A;  2HC9 A;  3WT4 A;  3LMS A;  4P4F A;  1YLO A;  3IJ3 A;  3TX8 A;  3VAR A;  3IO1 A;  4PQA A;  2GLF A;  4OC1 A;  1ZG8 A;  1ARL A;  5CBM A;  2OR4 A;  3HLP A;  4A39 A;  4DJL A;  1Z5R A;  2JEW A;  2ANP A;  4PXE A;  4UIA A;  4BD9 A;  4R6T A;  3D7G A;  1QQ9 A;  4MXU A;  4ZX8 A;  1CP6 A;  2PJ7 A;  2RFH A;  2AFX A;  3WC6 A;  2ZEP A;  4TNU A;  3PFE A;  3FED A;  4A37 A;  1BPN A;  3B2Y A;  4NGN A;  3D66 A;  3V7Z A;  2AFS A;  4YU9 A;  4GM5 A;  1AYE A;  5JGF A;  2AFO A;  4IAV A;  2EK8 A;  4MMO A;  3KHX A;  4OC3 A;  1VIX A;  3FF3 A;  2Q43 A;  2ZEH A;  1Y0R A;  3RBU A;  4YWY A;  4RUH A;  3WC5 A;  5LYI A;  3FJU A;  4Q7A A;  3GLJ A;  3PB9 X;  8CPA A;  2QJ8 A;  2PVW A;  2PCU A;  3SJE A;  1VHE A;  1ZLI A;  3T8W A;  4H2K A;  4MCS A;  2AFW A;  2ZEL A;  2PJA A;  3PEI A;  4FAI A;  2AFZ A;  4NJR A;  1YW6 A;  3B3T A;  2PJ2 A;  1YSJ A;  3KZW A;  5HVH A;  4P6Y A;  4MHZ A;  1CBX A;  4O23 A;  5HVF A;  2EK9 A;  5D29 A;  2V8H A;  2ZEO A;  4DYO A;  2ZEN A;  4P4J A;  5LYF A;  3DGV A;  3SJG A;  4FUU A;  1BAV A;  3MN8 A;  2IJZ A;  2V8D A;  4DUK A;  3BI1 A;  1F57 A;  1ELM P;  2VL1 A;  1F2O A;  4NFR A;  3BI0 A;  3H8E A;  4IK2 A;  4LQG A;  4PPZ A;  5CPA A;  3HUV A;  4X3R A;  1EE3 P;  3CT9 A;  3BXM A;  1Y0Y A;  4Z65 A;  4P4B A;  1PCA A;  4NJQ A;  4ONW A;  2IMO A;  2PJ5 A;  2ZEF A;  3ISZ A;  4JYW A;  3SI0 A;  2V8V A;  3I1U A;  1Z8L A;  1JQG A;  3NH5 A;  2NSM A;  3D7D A;  2AFM A;  4MCR A;  4PXD A;  5LRJ A;  5LYL A;  3SI1 A;  2ZEG A;  1R3N A;  1HDU A;  1DE4 C;  3GB0 A;  4UF4 A;  1CG2 A;  1TKF A;  6CPA A;  3WC7 A;  5JH9 A;  4FWU A;  1TF8 A;  1LAP A;  1AMP A;  3KAS A;  1CPS A;  3PFO A;  4ZY0 A;  3D7F A;  3FEC A;  4R76 A;  3NFZ A;  3L2N A;  1Q7L A;  2NYQ A;  4TWE A;  4W9Y A;  4CPA A;  3D67 A;  3GUX A;  2PJ0 A;  2J9A A;  2JBJ A;  3CPX A;  4WWV A;  1PYT B;  4NGS A;  4OKO A;  3VAT A;  4P4D A;  1TF9 A;  3WAB A;  4OC2 A;  1H8L A;  1TKH A;  1QMU A;  4MCP A;  1LAN A;  3SI2 A;  1BPM A;  4IHM A;  3SJF A;  4A38 A;  2Q4Z A;  4P44 A;  3FVL A;  3PB4 X;  3KR5 A;  1CPX A;  4EME A;  5LRK A;  1CX8 A;  4ZI6 A;  1TXR A;  3TC8 A;  1XJO A;  3NH8 A;  2G9D A;  1LAM A;  4P10 A;  2C1C A;  2FVG A;  1ZG9 A;  3FMC A;  2V8G A;  4EFD A;  5D8N A;  2PJ3 A;  3IEH A;  2POK A;  3D4U A;  3H8G A;  2OOT A;  2BOA A;  4OIW A;  5HVG A;  4NGP A;  5IB9 A;  1BLL E;  2Q51 A;  3SJX A;  2I3C A;  4NGT A;  5F09 A;  2XEJ A;  5K8N A;  1YW4 A;  2QYV A;  4MCQ A;  1XMB A;  4OC4 A;  2V77 A; 
#chains in the Genus database with same CATH topology
 4F0X A;  1J4J A;  2VZY A;  3K2K A;  1VHO A;  2PK7 A;  5FLX f;  3TE4 A;  4NBF A;  3FX6 A;  2A4N A;  4KVO E;  3CMA Z;  3TDH B;  4A95 A;  3KL9 A;  3IFE A;  3FQM A;  3LWU A;  3VMH A;  2Z0Z A;  2VPW A;  4NBE A;  2QA4 Z;  4HH4 A;  1FNO A;  1S7N A;  3JRU A;  3QAY A;  4E2X A;  3CD6 1;  3HOX I;  2R1I A;  1N71 A;  4UFX A;  2XEG A;  4MD9 A;  2ZOF A;  4M6I A;  4UEF A;  4H6U A;  1Z9U A;  1PU9 A;  1FT7 A;  5JM6 A;  4M6H A;  2C6C A;  3LD2 A;  2V3V A;  2NVQ I;  4EWT A;  2WAQ A;  4LUA A;  2ZAE B;  2JA5 I;  3EXN A;  1X12 A;  4FD5 A;  1P0H A;  3F3F C;  2D4O A;  1ARM A;  3FNC A;  1RLY A;  1VQ8 1;  1K8A 1;  3FIX A;  2QR1 B;  4NBA A;  2B3V A;  1VQN Z;  5KTA A;  4RVD A;  1UWY A;  2GTH A;  2PRQ A;  4R7M A;  3IC1 A;  1XF8 A;  2PC1 A;  2ZED A;  3BLN A;  2YGW A;  1U6M A;  2B5G B;  1VQP 1;  3B3C A;  4OC5 A;  3KI9 A;  3S1M I;  1F2P A;  5LRG A;  3GTJ I;  1PFT A;  2VQY A;  4BY1 I;  2PIY A;  1HDQ A;  1OBR A;  4UIB A;  4QTU A;  2PVV A;  2OTJ Z;  4U9Y A;  2JA7 I;  3CXP A;  2Q4V A;  3NA6 A;  3CXQ A;  3OW2 Z;  5G20 A;  3W6S A;  2PJ6 A;  2Z3L A;  4S1T A;  5CNP A;  2OOX B;  3CCE Z;  4ZBG A;  3CCL Z;  1CJW A;  4F8Z A;  2PR1 A;  5C3E I;  2F4O A;  1VQ9 1;  2QLV B;  2V8K A;  4UFW A;  1I50 I;  4KOU A;  2BEI A;  4B11 A;  2IZ3 A;  1M44 A;  1IOI A;  3CC2 Z;  4CAW A;  4RV9 A;  2JBK A;  2OTL Z;  2ZEE A;  3QAH A;  2WZN A;  4PXB A;  3GY9 A;  1S72 Z;  2X7B A;  2R92 I;  4DNC A;  4E30 A;  4C2X A;  4P4F A;  1YLO A;  3IJ3 A;  4MI4 A;  4RN7 A;  2KPI A;  4OAE A;  1AUG A;  4HGY A;  4MJ8 A;  4MH4 A;  3CCU Z;  3B8G A;  1ZG8 A;  1N8R 2;  3HLP A;  4A39 A;  1Z5R A;  4XX2 A;  3KKW A;  4F6A A;  1IB1 E;  4AB7 A;  1ZO0 A;  3HOU I;  1VQO Z;  4BIN A;  2FCK A;  2PJ7 A;  3WC6 A;  2JIQ A;  1S7F A;  3PFE A;  2VF1 A;  3B2Y A;  4CYP A;  3SHP A;  4YU9 A;  4GM5 A;  1AYE A;  1GHE A;  3I55 Z;  4IAV A;  4MMO A;  5AN9 F;  1VLA A;  2J8N A;  3KHX A;  1VIX A;  3FF3 A;  2E7Z A;  1LRZ A;  2ZXV A;  4ORF A;  4YWY A;  1Z8X A;  3WC5 A;  2B58 A;  1L0C A;  4KLW A;  3SXN A;  2PVW A;  1VHE A;  2H85 A;  3T8W A;  4H2K A;  4RS4 A;  4PK3 A;  3BG0 B;  2BSW A;  3IU1 A;  4CGO A;  2K3R A;  1YUA A;  5AG5 A;  2PJ2 A;  2G0B A;  1CM0 A;  1Q86 2;  4MHZ A;  2PDO A;  1CBX A;  2ZW5 A;  3I4M I;  2V8H A;  1ON0 A;  4DYO A;  3JUW A;  2OOY B;  3MN8 A;  2IJZ A;  1IID A;  1YIJ Z;  2R7H A;  2VL1 A;  2OTJ 1;  3BI0 A;  4PPZ A;  4X3R A;  3BXM A;  1Y0Y A;  4B14 A;  4CAX A;  1Z03 A;  4MFJ A;  3BJ8 A;  2IMO A;  4ONW A;  3ISZ A;  4MFP A;  3CCE 1;  4I49 A;  3I1U A;  1Z8L A;  3CCL 1;  4MCR A;  5LRJ A;  3GYA A;  2JS4 A;  3F3P C;  1KZF A;  3GKR A;  1DE4 C;  2PQ8 A;  3GB0 A;  4UF4 A;  2JMO A;  1CG2 A;  6CPA A;  1Q86 1;  5JH9 A;  1TWF I;  1CPS A;  2Y0S A;  5I0C A;  2IV2 X;  1S72 1;  1QF8 A;  3PO3 S;  3CCJ 1;  2G3T A;  2V45 A;  3L2N A;  3J81 f;  1DL6 A;  1VQ7 Z;  3S16 I;  3GTG I;  4TWE A;  3D67 A;  3CPX A;  2O28 A;  1VQL 1;  4C68 A;  5IV0 A;  4QUS A;  3VAT A;  1Q82 2;  4Y52 I;  5T67 A;  1TWC I;  3T90 A;  3SJF A;  1Q81 2;  4NBC A;  4BBS I;  3FVL A;  5LRK A;  5C88 A;  3TC8 A;  4UCN A;  4HNW B;  2G9D A;  1TWA I;  4B13 A;  4CAV A;  3DR8 A;  2C1C A;  3FMC A;  3CD6 Z;  2V8G A;  4EFD A;  2GFQ A;  5D8N A;  2PJ3 A;  5AGE A;  2BOA A;  4OIW A;  3CME 1;  3CPW Y;  3VWD A;  3SJX A;  2I3C A;  5JQ4 A;  4Y49 B;  4RI1 A;  4CL1 A;  1R43 A;  4ZY1 A;  4GS4 A;  2C6G A;  1DTD A;  2JEV A;  1X10 A;  1TWH I;  3PZJ A;  4K3N A;  2P6F A;  1Q82 1;  3S17 I;  2QML A;  4KOY A;  3IWG A;  2O53 A;  4AG7 A;  1VQ8 Z;  2F7V A;  1YME A;  4A3K I;  2XEI A;  3P2F A;  5EBV A;  1Q81 1;  2P6G A;  2Z3K A;  1QSO A;  4NGQ A;  4PK2 A;  1KUX A;  2QIR A;  2B3U A;  2RB7 A;  3NH4 A;  2XEF A;  2NVX I;  3T9Y A;  3R9G A;  1S3Z A;  1VQM 1;  4JZ0 A;  4II9 A;  3CXS A;  4M3S A;  4A94 A;  3J80 b;  2Z3P A;  2LEX A;  5DS0 A;  5C82 A;  5K8M A;  4E2Z A;  2YNE A;  4KLV A;  1VQP Z;  2BUE A;  4CGP A;  3RAM A;  3CQZ I;  3TFY A;  4E0A A;  4KSF A;  5K8O A;  3ISX A;  5ISV A;  4BY7 I;  1P9N A;  2OZU A;  2Z11 A;  1JJ2 Y;  4JXR A;  4A30 A;  2E9H A;  2QRE B;  4A3B I;  3QNV A;  3IU2 A;  4ZYQ A;  1FDI A;  5HXD A;  4X8I A;  2WYR A;  3PBE A;  2GRE A;  3H4Q A;  3TOB A;  2AYD A;  4KZT A;  2FE7 A;  4DGL A;  2HB6 A;  1FY7 A;  1XEB A;  5IX3 A;  2WB1 A;  2ARH A;  5KTC A;  4CAE A;  5D1O B;  3G8W A;  1RQF A;  3KQZ A;  1WCM I;  2PIZ A;  1VQ5 1;  1VQ9 Z;  2I79 A;  3G4S 1;  3MZK B;  1QVF Y;  4Q38 A;  3WR7 A;  3D8P A;  1VQ7 1;  3V38 A;  2FSR A;  2AE6 A;  4A93 I;  2JIP A;  3HOY I;  2EWB A;  3CPA A;  2HU9 A;  1OZP A;  1YR0 A;  5LYD A;  1Q2C A;  1S7M A;  1Z01 A;  1KD1 2;  2JNY A;  1N2F A;  1Y7E A;  3CXC Y;  3FXT A;  2PJ1 A;  3GTK I;  2B5G A;  4F9V A;  1USP B;  3IFU A;  4G1P A;  2J8R A;  1B87 A;  4RS2 A;  2AFU A;  3LUS A;  4OME A;  2BL1 A;  3TO9 A;  4CGN A;  3W6X A;  3DLJ A;  3A9L A;  1Z2L A;  4OP4 A;  3S9N A;  4MBU A;  2R8V A;  4R3L A;  2CNT A;  2P28 A;  3M3Y I;  3S14 I;  4AXV A;  2BO9 A;  4MHN A;  1W2B Y;  4BXX I;  4B6Z A;  1Y9W A;  2HC9 A;  3WT4 A;  1Y1V S;  3LMS A;  2NAP A;  3TX8 A;  1YJN Z;  4JD6 A;  2AJ6 A;  4MY3 A;  5C4J I;  2RC4 A;  1XE4 A;  1ARL A;  4AVA A;  2VUG A;  1KD1 1;  4A33 A;  3J80 f;  5T64 A;  2JEW A;  4U5Y A;  4PXE A;  4UBR A;  2E2H I;  1Q7Y 2;  1QVG Z;  4MXU A;  3PO2 I;  1VQK 1;  2ATR A;  4BMH A;  4CGL A;  4A37 A;  5G21 A;  1BPN A;  4NGN A;  3D66 A;  1YX0 A;  4PSW A;  4XNH B;  3RYO A;  3NE7 A;  2AFS A;  1RNI A;  5JGF A;  4C7I A;  2FXF A;  4IF5 A;  1Y0R A;  2REE A;  3C26 A;  2NVT I;  3IWE A;  4Q7A A;  5CM2 M;  3PB9 X;  2QJ8 A;  1S5K A;  2GAN A;  3SJE A;  3IF8 A;  1K9M 2;  4HNX B;  4MCS A;  3I07 A;  2ZEL A;  4MFL A;  2PJA A;  3PEI A;  3ZJ0 A;  4X5K A;  1XIX A;  4NJR A;  1SIW A;  1S7K A;  4UCP A;  3HOW I;  3B3T A;  1YSJ A;  3KZW A;  4KOT A;  5HVH A;  4P6Y A;  1QYP A;  2EGT A;  1Q7Y 1;  1KC8 2;  4UWJ A;  5HVF A;  2ZEN A;  2PMZ A;  4P4J A;  1X3W A;  3DGV A;  3SJG A;  4FUU A;  3HKZ A;  4L8A A;  2NMT A;  2VBQ A;  2V8D A;  4U9Z A;  1NUI A;  5T6B A;  4LQG A;  1FDO A;  4NBB A;  5CPA A;  3HUV A;  3CT9 A;  5KTD A;  2OZH A;  1S60 A;  4Z65 A;  4NF1 A;  2HQY A;  2Q04 A;  4P4B A;  1P4N A;  1Q2D A;  3CCJ Z;  2D4P A;  1PCA A;  1ZB8 A;  3CCS Z;  1VQL Z;  1JQG A;  4NBD A;  3G6E 1;  2R98 A;  4JWP A;  2PR8 A;  1K9M 1;  4KSA A;  2AFM A;  2H5M A;  5EMI A;  3J81 b;  1R3N A;  3R9F A;  2RBL A;  1TKF A;  3D3S A;  1TIQ A;  2JA6 I;  3CCM 1;  3V8I A;  1KC8 1;  3KAS A;  4XPL A;  3S6G A;  2AKL A;  2Q44 A;  2Q7S A;  1Q7L A;  4FD4 A;  2RPR A;  5G22 A;  2PJ0 A;  2J9A A;  2JBJ A;  1YJN 1;  2G3A A;  1WK4 A;  4RVF A;  3CME Z;  3GKQ A;  4B5O A;  3SI2 A;  3R95 A;  4LX9 A;  1NE9 A;  2DPT A;  2KI7 B;  2Q4Z A;  1RXT A;  4KVX A;  3GCF A;  1K73 2;  3FBU A;  1K4J A;  5G1Z A;  3R96 A;  1CX8 A;  4ZI6 A;  3NH8 A;  1N8R 1;  1VHS A;  2M6N A;  4JXQ A;  4CS0 B;  3VMG A;  2WUU A;  5DWM A;  2F5I A;  3OW2 Y;  5JPH A;  4OAD A;  1ZG9 A;  4M6G A;  3M4O I;  5F48 A;  4AVC A;  2QEC A;  4M85 A;  4E33 A;  2NVY I;  3H8G A;  2OOT A;  5HVG A;  1VQM Z;  1XMB A;  4CGM A;  1JWQ A;  2BJO A;  3QB8 A;  2V77 A;  3LOD A;  7CPA A;  3R9E A;  3PRT A;  3CPW Z;  5IT9 f;  4B12 A;  2HF1 A;  2OZK A;  3D68 A;  1LCP A;  3EC4 A;  3MON A;  1R57 A;  2FS5 A;  5D1P A;  3N5F A;  3EED A;  4B5P B;  3J7A 4;  1JWH C;  1Z8W A;  3FRM A;  4PXC A;  5IP9 I;  2R7Z I;  2GLJ A;  4XPD B;  4B10 A;  1GYT A;  2DE5 A;  1K73 1;  5DWN A;  3PBB A;  1RO5 A;  4MY0 A;  1TKJ A;  3KIF A;  4A3D I;  3I56 Z;  1KUV A;  4KOX A;  2ZEM A;  3EER A;  1ZH1 A;  1IGB A;  1TWG I;  2JA8 I;  3S1N I;  4ZX9 A;  4A3J I;  1M90 2;  5I4M A;  4MON A;  1VQ5 Z;  1VGY A;  4JJX A;  4NB8 A;  3G4S Z;  4KOW A;  2DF5 A;  1HEE A;  5F47 A;  2FIA A;  3CCS 1;  3IR7 A;  1SQH A;  1M1K 2;  3PGP A;  2VXK A;  4A32 A;  3KR4 A;  4C2Y A;  4OID A;  2PJC A;  5THW A;  4RVG A;  1JJ2 Z;  2JDD A;  2Y0M A;  4CRY B;  4KOV A;  3PP9 A;  4WJB A;  2P3Y A;  1VQ6 1;  3B35 A;  1NSL A;  4NOZ A;  3ZZI A;  3Q87 A;  4A3C I;  3CCV 1;  1NSA A;  2CY2 A;  3G71 Z;  4C2Z A;  3VMI A;  5J1Q A;  1KUY A;  2VPZ A;  2EUI A;  2JDC A;  2V8I A;  5J8F A;  1S7L A;  4BBH A;  2ZOG A;  3IIB A;  4P4I A;  2W03 A;  1L1O C;  4GXH A;  3BG1 B;  3KGQ A;  1KQS Y;  1Y9K A;  5BWA B;  1XRY A;  1QSR A;  1QVF Z;  4HGZ A;  3CDX A;  3UY5 A;  4NGM A;  2FIW A;  4Y7N I;  4MRI A;  1CP7 A;  4UEZ A;  1XBU A;  3EY5 A;  3D6W A;  1Z4E A;  4MHY A;  2K5R A;  1M1K 1;  2M48 A;  5FVJ A;  5D1O A;  3IWW A;  3CXC Z;  1YLE A;  3BHX A;  5J8C A;  3CC4 1;  3TCV A;  5HH1 A;  2Z10 A;  3KHZ A;  1R9T I;  4IUS A;  3H0G I;  2JLM A;  3TO7 A;  5A27 A;  4R8F A;  4MHP A;  2P6E A;  2LFU A;  2O4H A;  3PB8 X;  2ABZ A;  1WII A;  1VQK Z;  4L89 A;  4PSX A;  1MK4 A;  4NGR A;  3TE5 B;  1M4G A;  1B6B A;  2ZW6 A;  3VAR A;  4CRZ B;  1USP A;  1QSM A;  3IO1 A;  4OC1 A;  3S1R I;  1M1D A;  1WW9 A;  1M4D A;  1AA6 A;  5CBM A;  2VPX A;  2QEX 1;  4DJL A;  2ANP A;  3N7Z A;  4BD9 A;  5F46 A;  1QQ9 A;  1XMT A;  4ZX8 A;  2YNC A;  2RFH A;  3QWU A;  2WPW A;  4C7H A;  2ZEP A;  3I56 1;  1KRL A;  4CAF A;  3FED A;  4XNH C;  3TTH A;  2B4D B;  3IGR A;  4CYO A;  4UCM A;  2VUM I;  3P5J B;  1UFH A;  1Z02 A;  2EK8 A;  2Q43 A;  2ZEH A;  2PSW A;  2ZW4 A;  3RBU A;  4RUH A;  5LYI A;  3FJU A;  3RZO I;  2B63 I;  1YUK A;  3TO6 A;  3GTM I;  5FLM I;  4EVY A;  2PCU A;  4F0Y A;  3S6K A;  3CCQ 1;  2AFW A;  5IP7 I;  4FAI A;  2W04 A;  2AFZ A;  1Q2Y A;  4DQY B;  1MJ9 A;  2G2K A;  1Y8C A;  2REF A;  4O23 A;  1A2Z A;  2ZEO A;  3G6E Z;  3G71 1;  4E32 A;  4YRH A;  5LYF A;  1BAV A;  2KCW A;  2OZG A;  3BI1 A;  1F57 A;  2CXA A;  3CC7 1;  1F2O A;  3H8E A;  4IK2 A;  3CCM Z;  3D2L A;  4E2W A;  2CNM A;  4NJQ A;  4A2Z A;  2ZW7 A;  3GTQ I;  2PJ5 A;  4CYQ A;  4JYW A;  4A3M I;  4K30 A;  1WZN A;  4MFK A;  5AG4 A;  2C27 A;  4LQ6 A;  4MHD A;  4ZGY B;  5LYL A;  5C4X I;  5F49 A;  3VWE A;  3I4N I;  3RNZ A;  2YU9 I;  3H3V J;  1I12 A;  1TF8 A;  3I3G A;  3S2H I;  3PFO A;  3EO4 A;  5C44 I;  3D7F A;  4YFJ A;  2F4M A;  2NYQ A;  3JAM b;  3GUX A;  1VQ4 Z;  4HNY B;  2J8M A;  3NDJ A;  3F5B A;  4P4D A;  3WAB A;  4OC2 A;  2LIY A;  1H8L A;  5H86 A;  2RIQ A;  1YJW 1;  4IHM A;  1YIT 1;  2K5T A;  4A38 A;  3T4N B;  2FT0 A;  4P44 A;  3EFA A;  3KR5 A;  1CPX A;  5A28 A;  1TXR A;  1XJO A;  1YI2 1;  1LQL A;  2EO8 A;  4JLY A;  4MFZ A;  1Y1W I;  1I21 A;  2FVG A;  5IT9 b;  1NMT A;  1YHQ 1;  3K9U A;  2DPS A;  4NGP A;  1BLL E;  1IYK A;  1QXF A;  4NGT A;  4Q36 A;  2XEJ A;  5K8N A;  1YJ9 1;  4FD6 A;  3S6F A;  5GCN A;  3CZX A;  4FBE A;  2QKD A;  4KSI A;  2J6A A;  2Q7B A;  2CIJ A;  3G3S A;  3K9T A;  4X2T A;  3PB7 X;  3TOA A;  3D2P A;  1M4L A;  3NDI A;  3KQX A;  1M4I A;  4F9U A;  3W91 A;  4A3F I;  1YVO A;  4J3G A;  1IU8 A;  1WJ2 A;  2CF4 A;  4XPD C;  2OU2 A;  2PJ4 A;  1Y1V I;  3HOV I;  1I1D A;  3H8F A;  3U50 C;  3JVN A;  3B3S A;  4R87 A;  2Q4Y A;  4MD8 A;  2PJ8 A;  2PJ9 A;  1ZG7 A;  4MD7 A;  1ZLH A;  2C6P A;  3CMA 1;  1VQ6 Z;  3CCV Z;  2E2I I;  4E8O A;  1LFW A;  1YGH A;  3RZA A;  2QA4 1;  2RHB A;  4B5P A;  1QVG Y;  2CTB A;  1MJB A;  5K8P A;  2CNS A;  2PE3 A;  3DDD A;  2PRB A;  3FB3 A;  2RT9 A;  3D7H A;  3S9L A;  1Z4R A;  1K83 I;  1I3Q I;  3B3V A;  3MRU A;  1WWZ A;  2PJB A;  1NP6 A;  4ONU A;  1Q16 A;  4P4E A;  2VEZ A;  2ZPA A;  4R9M A;  1IY7 A;  3GIU A;  3JAM f;  2QVP A;  1YRE A;  3S9M A;  1KWM A;  4R57 A;  1ELL P;  1VKC A;  4A3E I;  2DE7 A;  2QRC B;  3K7A I;  4OLL A;  4AG9 A;  3S6H A;  3B7I A;  2GE3 A;  3CC4 Z;  1LOK A;  2JIO A;  2VPY A;  4OC0 A;  1VQ4 1;  1VQN 1;  3PB6 X;  1XFO A;  1X0T A;  1ZB9 A;  3D2M A;  2BCO A;  2F8H A;  4E2A A;  2GU2 A;  3RO0 A;  4Y49 C;  5H84 A;  2CTC A;  1KQS Z;  4UEE A;  3JTK A;  2PM9 A;  2YND A;  3B3W A;  3FH4 A;  1PUA A;  3I9S A;  2FL4 A;  2IQ6 A;  3FEE A;  4KUA A;  5A2Q b;  4ZY2 A;  4DK1 A;  3DR6 A;  1NJI 2;  2GIV A;  3GTP I;  4QVT A;  2R6M A;  1X3Z A;  1RTQ A;  5ELY A;  2QEX Z;  2DEA A;  4FD7 A;  1IYL A;  3VH9 A;  4RVH A;  1V0C A;  1RO4 A;  2WSA A;  4A31 A;  1IOF A;  2QRD B;  4P45 A;  4QC6 A;  3HOZ I;  2Z3O A;  2HV2 A;  4R3K A;  3DNS A;  3VB9 A;  4YGO A;  1BO4 A;  3GTL I;  3SXO A;  3VTN A;  4PQA A;  2GLF A;  1SFO I;  2I00 A;  4KS9 A;  2OR4 A;  3MZL B;  2VZZ A;  4A3L I;  1RO0 A;  5HMN A;  4UIA A;  2DXQ A;  4NBH A;  4NB9 A;  4R6T A;  3D9X A;  1BOB A;  3D7G A;  3CC2 1;  3ESW A;  2OTL 1;  5LL6 f;  1CP6 A;  1NJI 1;  4NBG A;  2AFX A;  3CCQ Z;  4HKF A;  4TNU A;  3CCR Z;  3FYN A;  4XPK A;  3V7Z A;  4MFQ A;  4H89 A;  4A3G I;  3MGD A;  2AFO A;  3CCU 1;  1Z8T A;  4OC3 A;  1ML8 A;  3R1K A;  4E31 A;  5AG7 A;  4H6Z A;  2R93 I;  3GLJ A;  4QB9 A;  3CC7 Z;  8CPA A;  1YQE A;  1VQO 1;  1YVK A;  3P2H A;  4UFV A;  3KIH A;  4A3I I;  3DSB A;  1ZLI A;  1M90 1;  1YW6 A;  3GTM S;  3GTO I;  2B4D A;  4QBJ A;  5FLX b;  2IL4 A;  2VI7 A;  3OWC A;  2Z3N A;  4QTT A;  2EK9 A;  5D29 A;  3RZD I;  3I55 1;  2E2J I;  2V8J A;  2B4B A;  4DUK A;  5EC4 A;  4BBR I;  4UA3 A;  3TT2 A;  2HUZ A;  1ELM P;  4NFR A;  2Z3M A;  2OH1 A;  5A2Q f;  1EE3 P;  2YNC C;  3NE8 A;  2IZ4 A;  4NH1 C;  3FKI I;  4KVM E;  4CYN A;  2ODF A;  2ZEF A;  1IIC A;  3S2D I;  4AYB A;  1W2B Z;  3SI0 A;  2JUB A;  2V8V A;  5E96 A;  2YAD A;  3NH5 A;  2NSM A;  3D7D A;  4PXD A;  4NCZ A;  4EWC A;  1RO2 A;  2Q0Y A;  3LAC A;  1YJW Z;  1YIJ 1;  2JIM A;  2ZEG A;  3SI1 A;  2WPX A;  3IX0 A;  1HDU A;  3PO3 I;  3WC7 A;  4NEX A;  1YIT Z;  1QST A;  4FWU A;  3BJ7 A;  1XOV A;  1LAP A;  1AMP A;  4NXY A;  4KOS A;  4E2Y A;  4ZY0 A;  4AVB A;  5IB0 A;  1YI2 Z;  3FEC A;  4HPS A;  4R76 A;  3NFZ A;  4KUB A;  3S1Q I;  4PV6 A;  3FQQ A;  4W9Y A;  4CPA A;  3H5Z A;  2GTI A;  4WWV A;  1PYT B;  2P0W A;  4NSQ A;  4NGS A;  1YHQ Z;  4OKO A;  5AG6 A;  1TF9 A;  1YK3 A;  1TKH A;  1QMU A;  4MCP A;  1YJ9 Z;  1LAN A;  4X6A I;  3S15 I;  1BPM A;  2JIR A;  2OB0 A;  3F0A A;  4UWI A;  3PB4 X;  4EME A;  2EVN A;  2JR6 A;  4KOR A;  1QSN A;  3F8K A;  1LAM A;  3E0K A;  3CCR 1;  4P10 A;  1I6H I;  3IEH A;  2POK A;  3D4U A;  1Y7R A;  2EBJ A;  5IB9 A;  2Q51 A;  5F09 A;  1TFI A;  1MJA A;  1YW4 A;  2QYV A;  4MCQ A;  1K8A 2;  2DE6 A;  4OC4 A; 
#chains in the Genus database with same CATH homology
 4FBE A;  2QKD A;  7CPA A;  4CL1 A;  1R43 A;  4ZY1 A;  3PRT A;  2C6G A;  3K2K A;  4KSI A;  1VHO A;  2PK7 A;  1DTD A;  2J6A A;  5FLX f;  3CPW Z;  2CIJ A;  5IT9 f;  4NBF A;  3FX6 A;  3CMA Z;  1TWH I;  3K9T A;  4K3N A;  4X2T A;  3PB7 X;  2HF1 A;  2OZK A;  3D68 A;  3TDH B;  1M4L A;  1LCP A;  1Q82 1;  3MON A;  3KL9 A;  3NDI A;  3S17 I;  3IFE A;  3KQX A;  3FQM A;  5D1P A;  4F9U A;  4A3F I;  3LWU A;  3VMH A;  3N5F A;  3EED A;  2O53 A;  3J7A 4;  1VQ8 Z;  4NBE A;  2QA4 Z;  1JWH C;  2F7V A;  1YME A;  4PXC A;  4A3K I;  4HH4 A;  2XEI A;  1FNO A;  3JRU A;  2CF4 A;  4E2X A;  1Q81 1;  5IP9 I;  3CD6 1;  2R7Z I;  2GLJ A;  4NGQ A;  3HOX I;  2PJ4 A;  1Y1V I;  3HOV I;  1GYT A;  2XEG A;  2DE5 A;  4MD9 A;  1K73 1;  2ZOF A;  3H8F A;  4UEF A;  3U50 C;  2RB7 A;  3NH4 A;  2XEF A;  3B3S A;  1FT7 A;  2NVX I;  3PBB A;  5JM6 A;  1TKJ A;  1VQM 1;  4JZ0 A;  4MD8 A;  3KIF A;  2PJ8 A;  2C6C A;  4A94 A;  3J80 b;  2PJ9 A;  4A3D I;  1ZG7 A;  4MD7 A;  2NVQ I;  3I56 Z;  4EWT A;  2WAQ A;  2ZAE B;  1ZLH A;  2C6P A;  2JA5 I;  5DS0 A;  3CMA 1;  2ZEM A;  5K8M A;  1VQ6 Z;  4E2Z A;  3EER A;  1ZH1 A;  1IGB A;  3CCV Z;  1TWG I;  1VQP Z;  2E2I I;  2JA8 I;  3F3F C;  1ARM A;  1LFW A;  3S1N I;  3RZA A;  4ZX9 A;  1RLY A;  2QA4 1;  4A3J I;  1M90 2;  1VQ8 1;  2RHB A;  1K8A 1;  3RAM A;  5I4M A;  3CQZ I;  4MON A;  1QVG Y;  2QR1 B;  1VQ5 Z;  1VGY A;  4NB8 A;  3G4S Z;  2CTB A;  5K8O A;  1HEE A;  3ISX A;  5K8P A;  2PE3 A;  4BY7 I;  1P9N A;  3CCS 1;  4NBA A;  1JJ2 Y;  1VQN Z;  1M1K 2;  4RVD A;  1UWY A;  2GTH A;  2RT9 A;  3D7H A;  2PRQ A;  3S9L A;  2E9H A;  1K83 I;  2QRE B;  4A3B I;  3KR4 A;  3QNV A;  4R7M A;  4ZYQ A;  1I3Q I;  5HXD A;  4X8I A;  2WYR A;  3B3V A;  4OID A;  3MRU A;  2PJC A;  3IC1 A;  2PJB A;  5THW A;  3PBE A;  1NP6 A;  4RVG A;  2ZED A;  2GRE A;  1JJ2 Z;  4P4E A;  1IY7 A;  3JAM f;  2QVP A;  4WJB A;  2P3Y A;  4DGL A;  1VQ6 1;  2HB6 A;  4NOZ A;  3B35 A;  3S9M A;  3Q87 A;  4A3C I;  3CCV 1;  2WB1 A;  1KWM A;  1NSA A;  1ELL P;  1VQP 1;  3B3C A;  4OC5 A;  3KI9 A;  4A3E I;  3S1M I;  2DE7 A;  2QRC B;  5D1O B;  1F2P A;  3G71 Z;  3VMI A;  3K7A I;  5J1Q A;  1RQF A;  3KQZ A;  1WCM I;  2V8I A;  5LRG A;  2PIZ A;  3GTJ I;  1PFT A;  1VQ5 1;  1VQ9 Z;  4BY1 I;  3G4S 1;  3MZK B;  1QVF Y;  2ZOG A;  3IIB A;  1VQ7 1;  3B7I A;  4P4I A;  3V38 A;  3CC4 Z;  2PIY A;  2W03 A;  1LOK A;  1HDQ A;  1L1O C;  4OC0 A;  3BG1 B;  1OBR A;  3KGQ A;  4QTU A;  4UIB A;  1KQS Y;  2PVV A;  1VQ4 1;  1VQN 1;  4A93 I;  2OTJ Z;  3PB6 X;  1XFO A;  1X0T A;  1ZB9 A;  2JA7 I;  1XRY A;  3HOY I;  2EWB A;  3CPA A;  2BCO A;  2F8H A;  2HU9 A;  4HGZ A;  1QVF Z;  3NA6 A;  3CDX A;  2GU2 A;  4NGM A;  3OW2 Z;  5LYD A;  4Y7N I;  4MRI A;  1CP7 A;  4UEZ A;  2CTC A;  1XBU A;  1KQS Z;  2PJ6 A;  1S7M A;  1Z01 A;  1KD1 2;  4UEE A;  2PM9 A;  4S1T A;  2JNY A;  3D6W A;  3B3W A;  1N2F A;  3FH4 A;  1Y7E A;  3CXC Y;  2IQ6 A;  4MHY A;  2K5R A;  3FEE A;  2OOX B;  2PJ1 A;  3GTK I;  5A2Q b;  1M1K 1;  4ZY2 A;  4DK1 A;  3CCE Z;  4F9V A;  1USP B;  2M48 A;  3IFU A;  3CCL Z;  5D1O A;  4G1P A;  3IWW A;  4F8Z A;  5C3E I;  1NJI 2;  2F4O A;  3CXC Z;  1VQ9 1;  3GTP I;  2AFU A;  3BHX A;  2R6M A;  3LUS A;  1X3Z A;  1RTQ A;  4OME A;  5ELY A;  2QLV B;  2QEX Z;  2V8K A;  3CC4 1;  3DLJ A;  2DEA A;  4OP4 A;  1Z2L A;  3S9N A;  3KHZ A;  3VH9 A;  4RVH A;  1I50 I;  1R9T I;  1RO4 A;  2IZ3 A;  2P28 A;  3H0G I;  3M3Y I;  2QRD B;  3S14 I;  4AXV A;  2BO9 A;  3CC2 Z;  4RV9 A;  2JBK A;  4MHN A;  4MHP A;  2OTL Z;  4R8F A;  2LFU A;  2O4H A;  2ZEE A;  3PB8 X;  3HOZ I;  4P45 A;  1W2B Y;  2ABZ A;  2WZN A;  4PXB A;  1WII A;  1VQK Z;  4BXX I;  4B6Z A;  1S72 Z;  4NGR A;  3VB9 A;  2R92 I;  2HC9 A;  3TE5 B;  3WT4 A;  1Y1V S;  4E30 A;  3LMS A;  4P4F A;  1YLO A;  3IJ3 A;  3GTL I;  3TX8 A;  1YJN Z;  3VTN A;  3VAR A;  2KPI A;  1USP A;  3IO1 A;  4PQA A;  4HGY A;  2GLF A;  5C4J I;  4OC1 A;  3S1R I;  4MH4 A;  1SFO I;  1WW9 A;  3CCU Z;  1ZG8 A;  1ARL A;  1N8R 2;  5CBM A;  2VUG A;  2QEX 1;  1KD1 1;  3J80 f;  2OR4 A;  3MZL B;  3HLP A;  4A39 A;  4DJL A;  4A3L I;  5T64 A;  1Z5R A;  4XX2 A;  2JEW A;  1RO0 A;  2ANP A;  4PXE A;  4UIA A;  4BD9 A;  4NBH A;  4NB9 A;  4R6T A;  2E2H I;  3D9X A;  3D7G A;  1QQ9 A;  3CC2 1;  1Q7Y 2;  1QVG Z;  4MXU A;  3ESW A;  2OTL 1;  1VQO Z;  3HOU I;  5LL6 f;  4ZX8 A;  3PO2 I;  1CP6 A;  2PJ7 A;  1VQK 1;  2RFH A;  3QWU A;  1NJI 1;  4NBG A;  2AFX A;  3CCQ Z;  3WC6 A;  2ZEP A;  4TNU A;  3PFE A;  3I56 1;  1KRL A;  3FED A;  3CCR Z;  4A37 A;  1BPN A;  2VF1 A;  3B2Y A;  4NGN A;  3D66 A;  3V7Z A;  4A3G I;  2VUM I;  2AFS A;  3P5J B;  4YU9 A;  4GM5 A;  1AYE A;  1Z02 A;  1RNI A;  5JGF A;  3I55 Z;  2AFO A;  4IAV A;  3CCU 1;  2EK8 A;  4MMO A;  5AN9 F;  1VLA A;  3KHX A;  4OC3 A;  1VIX A;  3FF3 A;  2Q43 A;  1ML8 A;  4E31 A;  2ZEH A;  1Y0R A;  3RBU A;  4YWY A;  4RUH A;  2NVT I;  3WC5 A;  5LYI A;  3FJU A;  4Q7A A;  2R93 I;  3RZO I;  2B63 I;  3GLJ A;  1YUK A;  3CC7 Z;  5CM2 M;  3PB9 X;  3GTM I;  8CPA A;  2QJ8 A;  1VQO 1;  5FLM I;  2PVW A;  2PCU A;  3KIH A;  3IF8 A;  3SJE A;  4A3I I;  1VHE A;  1K9M 2;  2H85 A;  1ZLI A;  3T8W A;  4H2K A;  4RS4 A;  3CCQ 1;  4MCS A;  2AFW A;  3I07 A;  5IP7 I;  1M90 1;  3BG0 B;  2PJA A;  2ZEL A;  3PEI A;  2W04 A;  4FAI A;  2AFZ A;  4NJR A;  2K3R A;  1YUA A;  4DQY B;  3HOW I;  1YW6 A;  3B3T A;  2PJ2 A;  3GTM S;  3GTO I;  2G2K A;  5FLX b;  1YSJ A;  3KZW A;  1Q86 2;  5HVH A;  4P6Y A;  1QYP A;  4MHZ A;  2EGT A;  1CBX A;  4O23 A;  3I4M I;  1Q7Y 1;  1KC8 2;  4QTT A;  2EK9 A;  5D29 A;  2V8H A;  5HVF A;  2ZEO A;  3G6E Z;  3RZD I;  3I55 1;  3G71 1;  4DYO A;  4E32 A;  2ZEN A;  2PMZ A;  4P4J A;  2OOY B;  1X3W A;  5LYF A;  3DGV A;  2E2J I;  3SJG A;  4FUU A;  1BAV A;  2V8J A;  3MN8 A;  3HKZ A;  2IJZ A;  2V8D A;  4DUK A;  1YIJ Z;  4BBR I;  3BI1 A;  1NUI A;  1F57 A;  1ELM P;  2VL1 A;  5T6B A;  3CC7 1;  1F2O A;  4NFR A;  2OTJ 1;  3BI0 A;  3H8E A;  4IK2 A;  3CCM Z;  4LQG A;  4PPZ A;  4NBB A;  5CPA A;  3HUV A;  4X3R A;  5A2Q f;  1EE3 P;  3CT9 A;  3BXM A;  2IZ4 A;  1Y0Y A;  4NH1 C;  1Z03 A;  4Z65 A;  4P4B A;  4E2W A;  3CCJ Z;  3FKI I;  1PCA A;  4NJQ A;  4ONW A;  3GTQ I;  2IMO A;  2PJ5 A;  2ZEF A;  1ZB8 A;  3ISZ A;  4JYW A;  4A3M I;  4AYB A;  1W2B Z;  3S2D I;  3SI0 A;  3CCS Z;  3CCE 1;  2JUB A;  2V8V A;  3I1U A;  1VQL Z;  1Z8L A;  1JQG A;  4NBD A;  3G6E 1;  3CCL 1;  2YAD A;  3NH5 A;  2NSM A;  3D7D A;  1K9M 1;  2AFM A;  4MCR A;  4PXD A;  5LRJ A;  5LYL A;  4EWC A;  1RO2 A;  5C4X I;  1YJW Z;  2JS4 A;  3F3P C;  3J81 b;  1YIJ 1;  2ZEG A;  3SI1 A;  3IX0 A;  1HDU A;  1R3N A;  1DE4 C;  3GB0 A;  3I4N I;  4UF4 A;  2RBL A;  2JMO A;  1CG2 A;  1TKF A;  6CPA A;  2YU9 I;  3H3V J;  3PO3 I;  3WC7 A;  1Q86 1;  2JA6 I;  1YIT Z;  1TWF I;  3CCM 1;  5JH9 A;  4FWU A;  1TF8 A;  1LAP A;  1AMP A;  1KC8 1;  3KAS A;  3S2H I;  1CPS A;  4E2Y A;  3PFO A;  2Y0S A;  4ZY0 A;  5C44 I;  3D7F A;  1YI2 Z;  1S72 1;  1QF8 A;  2AKL A;  3FEC A;  4R76 A;  3PO3 S;  3NFZ A;  3CCJ 1;  3S1Q I;  3FQQ A;  3J81 f;  1DL6 A;  1Q7L A;  2F4M A;  3L2N A;  2NYQ A;  1VQ7 Z;  3S16 I;  3GTG I;  2RPR A;  4TWE A;  3JAM b;  4W9Y A;  4CPA A;  3D67 A;  3GUX A;  2PJ0 A;  2J9A A;  2JBJ A;  1YJN 1;  3CPX A;  2GTI A;  4WWV A;  1VQL 1;  1VQ4 Z;  1PYT B;  4RVF A;  4NGS A;  1YHQ Z;  4OKO A;  3VAT A;  3NDJ A;  1Q82 2;  4P4D A;  1TF9 A;  3CME Z;  3WAB A;  4Y52 I;  4OC2 A;  2LIY A;  1H8L A;  3GKQ A;  1TKH A;  1QMU A;  4MCP A;  2RIQ A;  5T67 A;  1YJW 1;  1YJ9 Z;  1LAN A;  1TWC I;  4X6A I;  3SI2 A;  3S15 I;  1BPM A;  4IHM A;  3SJF A;  1Q81 2;  1YIT 1;  4A38 A;  2KI7 B;  2Q4Z A;  3T4N B;  3GCF A;  4NBC A;  4BBS I;  3FVL A;  4P44 A;  3PB4 X;  3KR5 A;  1K73 2;  1CPX A;  4EME A;  5LRK A;  1CX8 A;  4ZI6 A;  1TXR A;  2JR6 A;  3TC8 A;  1XJO A;  1YI2 1;  1LQL A;  3NH8 A;  1N8R 1;  2G9D A;  1TWA I;  1LAM A;  2M6N A;  3VMG A;  3CCR 1;  4P10 A;  1Y1W I;  1I6H I;  3OW2 Y;  2C1C A;  2FVG A;  1ZG9 A;  3FMC A;  3CD6 Z;  5IT9 b;  2V8G A;  4EFD A;  5D8N A;  3M4O I;  2PJ3 A;  3IEH A;  1YHQ 1;  2POK A;  3D4U A;  4E33 A;  2NVY I;  3H8G A;  2BOA A;  4OIW A;  3CME 1;  2OOT A;  5HVG A;  3CPW Y;  4NGP A;  5IB9 A;  1BLL E;  2Q51 A;  3SJX A;  2I3C A;  4NGT A;  1VQM Z;  5F09 A;  2XEJ A;  5K8N A;  1TFI A;  1YJ9 1;  1YW4 A;  2QYV A;  4MCQ A;  1XMB A;  1K8A 2;  2DE6 A;  4OC4 A;  2BJO A;  2V77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...