4NFRA

Human brain aspartoacylase mutant e285a complex with intermediate analog (n-phosphonomethyl-l-aspartate)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
301
structure length
301
Chain Sequence
HIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNAAAYYEKKEAFAKTTKLTLNAKSIRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Aspartoacylase catalytic deficiency as the cause of canavan disease: a structural perspective.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Aspartoacylase
total genus 93
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2013-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4nfrA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4nfrA01
1IGBA 1XMBA 4MHZA 1TXRA 4OIWA 3FX6A 5F09A 3PEIA 2ZOFA 2WZNA 2AFSA 3VATA 4NGSA 3VARA 1ZLIA 3PB4X 2C6PA 5LYLA 2XEJA 4NJQA 1M4LA 3IC1A 4FWUA 4UEEA 1F2OA 3ISZA 3MN8A 2CTCA 4F8ZA 1Q7LA 2AFWA 1Z2LA 2PIZA 4UF4A 3MRUA 1CP7A 4NFRA 4A38A 2IMOA 2PJCA 3NA6A 1BPNA 5ELYA 2JEWA 4P4JA 5HVFA 5K8NA 2PJ3A 1ZG7A 2PJ0A 3IIBA 4P4EA 4TWEA 1TF9A 3KL9A 2QJ8A 3S9NA 4GM5A 4W9YA 5HVGA 2EWBA 4IHMA 5I4MA 3KI9A 3H8GA 1Z8LA 5K8OA 5LYFA 3S9LA 1Y0YA 3BHXA 1VHEA 4OC4A 4PXEA 3JRUA 1QQ9A 5THWA 1RTQA 2ZEEA 4A39A 4NGMA 1DE4C 4PXCA 1LFWA 3WC7A 2OR4A 2HC9A 3FJUA 2JBJA 4RUHA 2O4HA 2BO9A 4OC2A 4MXUA 8CPAA 2I3CA 3KZWA 2C6CA 3D7FA 3PB8X 3B2YA 3DGVA 2Q43A 5K8MA 2AFXA 2PJAA 3S9MA 3PB6X 2CIJA 3B3SA 4IK2A 2IQ6A 3D4UA 3PB7X 4PXDA 3PBEA 4G1PA 2GREA 3SI2A 4JZ0A 3FMCA 3KR4A 4P45A 4NGNA 5LYIA 1VHOA 3D7DA 2CTBA 1HDUA 3CDXA 1ARMA 2ANPA 4P10A 1HEEA 1TF8A 3B35A 2QYVA 2PRQA 3B7IA 3VH9A 1YLOA 4EWTA 1CPXA 2XEFA 3IO1A 1XRYA 3LWUA 4NJRA 4JYWA 1ZG8A 2Q4ZA 4FAIA 3CT9A 1FT7A 1CPSA 3KQXA 4A94A 1EE3P 1DTDA 3FF3A 4NGQA 2PJ7A 2NSMA 1YW4A 4Z65A 2RFHA 4ZYQA 3B3WA 3SI0A 4ZY0A 3V38A 4OC3A 3PBBA 2PJ8A 1FNOA 3FEDA 1UWYA 1ELMP 4OC5A 2PJ2A 2XEIA 3I1UA 2ZEHA 4H2KA 1BLLE 1YSJA 4YWYA 4MCQA 4BD9A 5LRKA 1GYTA 3IEHA 2ZEPA 2PJ9A 3DLJA 3HLPA 4UEFA 2HB6A 2IJZA 3KHXA 1Z5RA 4FUUA 3B3VA 3B3TA 4B6ZA 5D29A 3KQZA 4PPZA 3CPXA 2V8VA 2ZELA 3PB9X 1ZG9A 4DYOA 2PVWA 2FVGA 3KASA 4P4FA 3HUVA 4IAVA 5DS0A 3TC8A 3WABA 3RBUA 5LYDA 4AXVA 4ZY1A 4X8IA 1LAMA 1IY7A 5J1QA 4R8FA 2ZOGA 3FEEA 3V7ZA 4A37A 4DJLA 1CG2A 4WJBA 2F8HA 2PE3A 4ONWA 3QNVA 3SJXA 2JBKA 3NH4A 1R43A 4MMOA 2PJBA 4EMEA 1HDQA 2NYQA 1CX8A 2AFMA 3K9TA 4PQAA 3BI0A 2V8HA 4FBEA 1LAPA 1YW6A 2POKA 4K3NA 2DEAA 4MHYA 5K8PA 2PJ5A 1LCPA 4TNUA 3PRTA 4MCSA 4EFDA 2PVVA 1TKFA 2RB7A 5HXDA 1ZLHA 2F7VA 3SJEA 1KWMA 3IFEA 4MCPA 4KSIA 2AFOA 5CPAA 4OC0A 2PCUA 3D7HA 2J9AA 1XJOA 3NFZA 4OKOA 2ZEOA 2ZEMA 3LMSA 4NGPA 2PJ4A 4O23A 5JGFA 4F9VA 4OP4A 3SI1A 2PJ6A 2GLFA 1VGYA 3L2NA 4UEZA 1Y7EA 4MCRA 4NGRA 4X3RA 4YU9A 3WT4A 2ZEDA 4MHNA 2O53A 4P4IA 1AYEA 2V77A 1NSAA 7CPAA 2AFUA 3IJ3A 3KHZA 1CP6A 3NH8A 1YMEA 3T8WA 1F57A 2G9DA 3WC5A 4F9UA 2AFZA 3BXMA 4P44A 4ZX8A 4R76A 2EK8A 3SJGA 4MHPA 3FVLA 1PYTB 2V8DA 2ZENA 3NH5A 1Y0RA 5D8NA 4CPAA 4X2TA 1CBXA 1XFOA 2BOAA 3D68A 4P6YA 1BPMA 4ZX9A 1ARLA 2ABZA 4P4DA 2WYRA 3GUXA 3GLJA 4OIDA 5JH9A 3N5FA 1AMPA 3KGQA 1VIXA 3GB0A 3FH4A 3FECA 1LOKA 1LANA 3SJFA 3K2KA 2GLJA 2XEGA 4ZY2A 2VL1A 4P4BA 2CF4A 5LRJA 4ZI6A 2C1CA 2QVPA 3D67A 3RZAA 5HVHA 3D7GA 1BAVA 2ZEGA 3PFOA 4WWVA 1XBUA 1F2PA 4R7MA 1R3NA 3KR5A 3H8FA 1TKJA 3PFEA 4PXBA 4Q7AA 1PCAA 3H8EA 3IWWA 5CBMA 4LQGA 4MRIA 3D66A 2OOTA 1TKHA 3B3CA 3WC6A 4R6TA 4DUKA 3TX8A 1ELLP 6CPAA 1H8LA 3ISXA 5LRGA 2Q51A 3CPAA 5JM6A 2C6GA 2V8GA 4UIAA 2PIYA 3BI1A 2ZEFA 4NGTA 2GU2A 2BCOA 1QMUA 2EK9A 4UIBA 1JQGA 3RAMA 4OMEA 4OC1A 5IB9A 1OBRA 2PJ1A
chains in the Genus database with same CATH superfamily
1V0CA 1TWCI 3FX6A 3PEIA 4BY1I 3H4QA 1VLAA 2F4OA 4M3SA 2GFQA 3VATA 4NGSA 3CMAZ 1ZLIA 3PB4X 3S6KA 2C6PA 4NJQA 1F2OA 4MONA 3JVNA 4OAEA 4NBCA 4XPDB 1Q7LA 1Z2LA 2PIZA 4UF4A 4XNHC 1BO4A 1MJBA 2PJCA 2PMZA 4R57A 2V45A 1VQN1 4KOSA 2OU2A 2PJ0A 1ZG7A 3IIBA 2RT9A 1FY7A 4NBHA 3TDHB 2QJ8A 4GM5A 2ZXVA 4HKFA 2P6GA 4L89A 3S9LA 3OWCA 2ARHA 1TWHI 1YREA 5F49A 4H89A 4B11A 2JMOA 1A2ZA 1VQM1 3HOUI 4KSFA 3VMGA 1TWFI 1QQ9A 2HUZA 5THWA 1PU9A 4K30A 2G3AA 3GTMI 4M85A 4RS4A 2ZW6A 4A39A 1L0CA 2J8MA 5IX3A 2JEVA 2B5GA 4HH4A 3MONA 4C2YA 1DE4C 4E2YA 2B4DA 4PV6A 2R1IA 1PFTA 2HC9A 4RUHA 2O4HA 1X3ZA 2R8VA 3A9LA 4MXUA 3KZWA 2C6CA 4CAVA 2RBLA 3M4OI 3S9MA 2E2HI 3B3SA 3FBUA 4IK2A 3ZJ0A 3PB7X 4MFLA 3SI2A 3SHPA 3KR4A 5A2Qb 3D7DA 2CTBA 3CDXA 1ARMA 2ANPA 2LIYA 3CMEZ 3HOVI 2JS4A 2EO8A 3B7IA 3VH9A 2J8NA 4CYNA 1CPXA 4EVYA 3KQXA 4A94A 2PJ7A 1WIIA 2IV2X 1YW4A 4CRZB 2OZHA 3B3WA 5J8CA 4ZY0A 4OC3A 5JPHA 1TIQA 2DPSA 1M44A 4RI1A 5IT9b 4A3JI 2OZKA 1K731 1UWYA 4J3GA 4OC5A 2XEIA 3I1UA 2BEIA 3CZXA 1VQ91 3FNCA 3IFUA 2F4MA 1M1K1 2X7BA 5AG6A 3CXPA 2K3RA 1NE9A 2ZEPA 3DLJA 2IJZA 2LEXA 4NB8A 3R9FA 2Q0YA 3CCLZ 3R9GA 2I79A 3CPXA 4PPZA 4DYOA 2PVWA 5KTDA 1XMTA 1KD11 4HNXB 1Y1VI 4KOTA 1Q2YA 2PR1A 3S17I 2R93I 1QYPA 5D1OB 1N8R1 4KS9A 5J1QA 1KD12 4BBSI 3GTOI 2R98A 4A37A 2DE6A 5EC4A 4QC6A 3GTGI 1MJAA 4UWJA 5IP9I 3CD61 4I49A 1Y1VS 3QNVA 3BG0B 2B58A 3PO2I 2PJBA 4EMEA 2E9HA 3D2PA 5DWNA 2G2KA 4CL1A 5K8PA 1I1DA 4K3NA 4L8AA 1LCPA 4KZTA 1I6HI 3T90A 1IOIA 1TKFA 1S721 2F7VA 1KWMA 5EBVA 2JA5I 3NFZA 3LUSA 4C2XA 2PJ4A 1CJWA 3FXTA 2R6MA 5I0CA 2PM9A 4DK1A 1I50I 5A27A 3F5BA 2PDOA 2ZEDA 2O53A 1S7FA 1NSAA 3BLNA 7CPAA 3I9SA 4E33A 4AVCA 3IJ3A 4A3DI 3F8KA 4BBHA 4II9A 4DGLA 3T8WA 1F57A 4JLYA 2AFZA 3CME1 2EK8A 4KORA 2VBQA 3FVLA 1SFOI 4NOZA 3NH5A 2GANA 5D8NA 4Q38A 2HU9A 3IGRA 4KVXA 3D68A 1BPMA 3GYAA 2OTJZ 3R95A 2NMTA 1ARLA 3NDIA 4A33A 4E2ZA 4AB7A 1QXFA 5JH9A 2Q4YA 2O28A 3SJFA 1FDOA 2XEGA 2VL1A 2AYDA 5LRJA 4Y49B 3TO7A 2OOXB 1P0HA 5FVJA 1IB1E 3D67A 3ESWA 3RZAA 4KVME 3D7GA 2J6AA 3T9YA 1WCMI 2CXAA 1YUAA 4UFVA 4R7MA 3PGPA 1R3NA 3H8FA 4E8OA 1YVKA 2WSAA 1M902 3H8EA 4LQGA 4MRIA 4R6TA 1QVGY 3JUWA 3EFAA 1ELLP 1ZB9A 6CPAA 3K9UA 4IUSA 1I21A 2VPWA 3ISXA 2Q51A 2B5GB 3CPAA 1IU8A 5JM6A 4E2WA 4JJXA 3MZLB 2V8GA 2CY2A 2B63I 2ZEFA 4OLLA 4NGTA 1VQ9Z 1VQ6Z 4OMEA 2PJ1A 2YNCA 1VQ71 2M48A 1Q812 2P6EA 3CMA1 3DNSA 1Q821 1VQK1 5F46A 2AFSA 2GTIA 4B13A 4KOVA 3P2HA 4CGLA 3S6FA 2VPXA 1KUYA 4HGYA 1VQ41 4CAWA 3EEDA 1S72Z 2W04A 3ZZIA 1M4LA 4FWUA 4UEEA 1ML8A 2FIAA 2QA4Z 1JWHC 3GTJI 4MJ8A 2JA6I 3GTQI 3IF8A 4NFRA 3I4NI 4A38A 3NA6A 5K8NA 5IT9f 1Y8CA 5AG4A 2CNTA 4KOWA 1XIXA 1TF9A 4TWEA 3QWUA 1YX0A 1ZH1A 1YJN1 1Z8LA 5IV0A 2GTHA 2JA7I 2Z3LA 3S14I 1QF8A 2QRDB 1Y0YA 5KTCA 3BHXA 3S1MI 2Y0SA 1VHEA 1MK4A 4OC4A 1W2BY 3H5ZA 3D9XA 4XX2A 2BUEA 4R9MA 2ZEEA 5C88A 2VUMI 3G3SA 4NGMA 1YHQZ 5FLXf 1QVFZ 4CYOA 4UCNA 2VXKA 1RO4A 4MD9A 3G711 3FJUA 1WJ2A 8CPAA 1VQMZ 2KI7B 5A28A 4GXHA 2YGWA 2Q44A 3RO0A 2WB1A 3DGVA 1JWQA 2QLVB 3PB6X 2FS5A 4PXDA 4G1PA 5AN9F 5AGEA 1YR0A 4P45A 2K5RA 1S60A 1HEEA 3B35A 1KQSZ 2G3TA 2QYVA 1I12A 4KSAA 1KC81 4R3LA 3CCQ1 2F5IA 4EWTA 2PRBA 1XRYA 2Q4VA 4NJRA 1ZG8A 1X12A 4R87A 3IWGA 4LUAA 4S1TA 3FF3A 3DR6A 5EMIA 4NGQA 5FLXb 4F0YA 3IU1A 3OW2Z 4Z65A 4KLVA 4ZYQA 5LL6f 1NJI2 1J4JA 5IB0A 3FEDA 2NVXI 3CPWY 2ZW4A 1ELMP 2PJ2A 4H2KA 1NJI1 3GTKI 2QR1B 1LRZA 1YSJA 2EBJA 3CCM1 2HV2A 1GYTA 3BJ7A 2PJ9A 3HLPA 1MJ9A 2DF5A 3B3TA 4B6ZA 5C3EI 5D29A 3KQZA 3GTPI 2PSWA 1ZG9A 1TFIA 4AVAA 1RNIA 3TFYA 2P6FA 3WABA 5LYDA 3BG1B 3LD2A 1S7MA 1R9TI 2JUBA 4R8FA 3FEEA 4UCMA 1XF8A 4DJLA 1YQEA 3MZKB 2F8HA 3EERA 1BOBA 4FD7A 4Y52I 3FQQA 4NBAA 3H0GI 3S1NI 1HDQA 4XNHB 3G4SZ 1ZO0A 3SXNA 4AG9A 3BI0A 1LAPA 4MHYA 2DEAA 4RV9A 2Y0MA 4TNUA 4X5KA 3KIFA 4EFDA 2PVVA 2RB7A 3KIHA 5C4JI 1QSNA 5HXDA 4NBDA 5T67A 4QUSA 1Z01A 4XPKA 5G22A 1S7NA 2JIPA 3RYOA 4OC0A 2PCUA 3D7HA 2VEZA 1S7LA 3IR7A 3CCE1 1RQFA 4OKOA 1M4GA 2Z3KA 2GE3A 3LMSA 5J8FA 4NGPA 4A31A 1N71A 3CCEZ 2RPRA 1VQ81 4F9VA 4NXYA 3V8IA 2NVYI 2YADA 2PJ6A 4IF5A 2GLFA 3CCQZ 5G20A 4NBEA 4NEXA 4A3KI 1IOFA 4X3RA 3FRMA 3CPWZ 4YU9A 1S7KA 1VQLZ 2D4OA 3MGDA 3VB9A 3KHZA 1CP6A 1YMEA 4QVTA 4HGZA 5FLMI 4NCZA 1UFHA 3DDDA 4DQYB 4ZX8A 4PSXA 1YLEA 4Q36A 4MHPA 4CAEA 2P3YA 3Q87A 2OTJ1 3K7AI 3G71Z 1RLYA 3QAHA 3KKWA 2E7ZA 3NE8A 4CPAA 4X2TA 1CBXA 4XPLA 1Q811 2QRCB 2QREB 3FYNA 2ABZA 4P4DA 1Q2DA 3B8GA 4RVDA 4A32A 3I4MI 4YFJA 2E2II 2YNEA 1VIXA 4QBJA 1Z02A 3FECA 1LOKA 1B87A 1LANA 1M4IA 2B3UA 2CF4A 1M1K2 2C1CA 4A3II 2OH1A 5AG5A 5HVHA 3GIUA 1BAVA 2ZEGA 2JDCA 3W6SA 3JAMb 1L1OC 3G8WA 1VQ8Z 3GY9A 4A3MI 4B14A 4Q7AA 3TO9A 3IWWA 5CBMA 2LFUA 4MY0A 1TKHA 1Z03A 3G6E1 5F47A 5JQ4A 1X10A 3D3SA 3CC21 1NSLA 2B4DB 3CCUZ 4E2XA 4PK3A 3CC2Z 2PIYA 3BI1A 1QMUA 2REEA 4UIBA 3J80b 3J81f 4OC1A 5H86A 4JD6A 1IGBA 1XMBA 4MHZA 1TXRA 4OIWA 4MHDA 4KUAA 2ZOFA 2WZNA 2OZGA 2WUUA 4FD6A 3R9EA 2R92I 1QVFY 3HOYI 5LYLA 2XEJA 3IC1A 1Y1WI 2B4BA 3ISZA 3MN8A 2CTCA 4F8ZA 1YITZ 5T6BA 1CM0A 3NDJA 5C82A 2IMOA 3E0KA 1W2BZ 1ON0A 3GTMS 4LX9A 2GIVA 1BPNA 2ATRA 1VQP1 2JEWA 4P4JA 2NVQI 4PSWA 1QSRA 3FB3A 2PJ3A 4CYPA 1N2FA 3TO6A 2QEX1 4IHMA 5I4MA 3KI9A 3H8GA 4H6ZA 2Z10A 2DE5A 2FSRA 3I561 2QEXZ 1VQ51 4M6IA 1YVOA 2IZ4A 4MFPA 4MFQA 1YGHA 2I00A 3GKQA 2FIWA 4PXCA 3WC7A 4B5PB 4X6AI 2OR4A 4HNWB 4MFKA 3N7ZA 2QIRA 2JBJA 3TOAA 4LQ6A 2H85A 2I3CA 1VKCA 2WPXA 3HOWI 3CCS1 3D7FA 3RNZA 2AFXA 4UA3A 4PK2A 3PBEA 4FD5A 1IYKA 3FMCA 1VHOA 3S15I 3J80f 5HMNA 3S6HA 1QSTA 4P10A 1TF8A 2OOYB 2OTLZ 3G4S1 1Z8XA 3FKII 4AYBA 4C7IA 4JYWA 4FAIA 3CT9A 1FT7A 1CPSA 1K83I 3I07A 3C26A 1VQOZ 1S5KA 4CGPA 1DTDA 1Q7Y1 2NSMA 4BBRI 2RFHA 4F6AA 3SI0A 3V38A 3PBBA 2PJ8A 1FNOA 5D1OA 1WWZA 1B6BA 4RVHA 1M901 1KZFA 4CS0B 1AA6A 2WPWA 4YWYA 4MCQA 4CRYB 2OZUA 5LRKA 3PZJA 5T64A 2EGTA 3H3VJ 3KHXA 4FUUA 3B3VA 2DPTA 2Z3PA 1KUXA 2ZELA 2QMLA 1GHEA 4MD7A 3CCR1 4A2ZA 4P4FA 3HUVA 4IAVA 5DS0A 2V3VA 5C44I 3GKRA 4AXVA 4ZY1A 4H6UA 4X8IA 1LAMA 2Q7BA 3V7ZA 1VQKZ 4GS4A 3VTNA 4A3FI 4A3EI 4WJBA 2V8KA 4CAXA 2CNMA 3SJXA 1PUAA 3U50C 2DXQA 2KPIA 4BY7I 4MMOA 4NF1A 3S1QI 2NYQA 1CX8A 2AFMA 1ZB8A 4PQAA 2V8HA 4JXRA 2PJ5A 1XEBA 1QSOA 4MCSA 4CYQA 4E30A 1ZLHA 2JDDA 3IFEA 4MCPA 2M6NA 4KSIA 3F3PC 4CGNA 5CPAA 3CXCZ 2J9AA 3CCV1 2BL1A 4Y7NI 1M1DA 1XJOA 3PO3I 4A95A 2ZEOA 2JIQA 4O23A 3OW2Y 5JGFA 1Q7Y2 3CCJ1 2KCWA 3L2NA 1VGYA 4UEZA 1Y7EA 3BJ8A 4NGRA 1VQO1 3WT4A 4A3BI 4P4IA 1AYEA 4KOYA 1YI2Z 2V77A 2V8JA 4OADA 2V8IA 3F0AA 3NE7A 1YI21 3CCMZ 3CC4Z 5CNPA 4AG7A 1OZPA 2BSWA 1YJ91 4BINA 3WC5A 4DNCA 3BXMA 4P44A 1Q861 3SJGA 1NP6A 3CCJZ 2HF1A 2P28A 2V8DA 3W91A 1Q862 2P0WA 1WK4A 4B10A 3EY5A 3D8PA 4C2ZA 2FT0A 2EUIA 4NBFA 2WYRA 2RHBA 4OIDA 4MFZA 3N5FA 2H5MA 3FH4A 3R1KA 4Y49C 3EXNA 3S2HI 3CD6Z 3K2KA 4MI4A 4BXXI 3F3FC 4ZY2A 3I3GA 2B3VA 2QVPA 1FDIA 2QA41 4E31A 4E2AA 4C7HA 4WWVA 3WR7A 1XBUA 1VQ5Z 2EVNA 3KR5A 3IWEA 4BMHA 3M3YI 3LACA 2FCKA 1TKJA 1VQ7Z 3PFEA 2AJ6A 3D66A 2OOTA 4NB9A 4B5OA 3WC6A 2VQYA 1YJ9Z 4DUKA 2BJOA 3CCRZ 1Q2CA 3VWEA 3GCFA 2PQ8A 3VMHA 1H8LA 2ZW7A 1YHQ1 1NMTA 4KOUA 5LRGA 2ZAEB 4B5PA 1RXTA 2C6GA 2K5TA 4UIAA 3HOXI 3RAMA 3S16I 3TE4A 1VHSA 2PK7A 2JIMA 5F09A 5CM2M 4A30A 1YJWZ 4UFWA 3HOZI 1Z8TA 4MBUA 1Q822 4UFXA 1YK3A 3VARA 3CQZI 4QTTA 4CGOA 3I55Z 4M6GA 4U9YA 3TCVA 3CC41 2AFWA 2AKLA 3MRUA 1VQPZ 1CP7A 4AVBA 3DR8A 3IU2A 2Z11A 5ELYA 1M4DA 5DWMA 5HVFA 2Q7SA 5KTAA 4P4EA 4CGMA 3KL9A 2DE7A 2AE6A 3S9NA 4W9YA 5HVGA 2EWBA 3HKZA 5K8OA 5LYFA 1Y9WA 4EWCA 1YIJZ 1XE4A 3CCVZ 2QKDA 2Z3OA 3LODA 4PXEA 2JIOA 3JRUA 4NH1C 1YIJ1 4ONUA 1K8A1 3UY5A 1RTQA 3D2MA 4U5YA 5ISVA 4MY3A 2RIQA 1LFWA 3EO4A 2R7ZI 3T4NB 1Z4RA 1I3QI 1VQ4Z 2BO9A 4OC2A 4E32A 2OB0A 4CAFA 1QSMA 3PB8X 4QTUA 3B2YA 3FQMA 1Z9UA 2Q43A 5K8MA 1SIWA 2PJAA 2CIJA 2IQ6A 3D4UA 4ORFA 2GREA 4JZ0A 4NGNA 3J7A4 5LYIA 1RO0A 2VPYA 1K9M2 1VQ61 1HDUA 4NBGA 4C68A 3SXOA 1X3WA 2PC1A 2VZYA 2PRQA 5AG7A 2WAQA 1YLOA 2C27A 4M6HA 1KC82 2RC4A 2OTL1 2XEFA 3IO1A 3LWUA 2Z3NA 2E2JI 3S2DI 2PR8A 2Q4ZA 3VWDA 1EE3P 3CXCY 1VQL1 1YJNZ 1JJ2Y 1Z4EA 4UBRA 1DL6A 4ZGYB 4RVGA 1P9NA 3CXSA 5E96A 2ZEHA 3CCL1 1BLLE 2NVTI 2VUGA 4YRHA 4BD9A 1VQNZ 4KUBA 3IEHA 1X0TA 1SQHA 4UEFA 3W6XA 2HB6A 2VI7A 4MH4A 1TWGI 1Z5RA 1JJ2Z 5D1PA 1K8A2 1KUVA 4MFJA 2V8VA 3PB9X 2JIRA 5C4XI 2FVGA 3G6EZ 3KASA 2JNYA 2JLMA 4B12A 3P2FA 1KQSY 3TC8A 3RBUA 3I551 1IY7A 1YUKA 2ZOGA 3CCSZ 1IYLA 2VPZA 1Y7RA 4FD4A 1CG2A 1KRLA 1USPB 2HQYA 2Z3MA 2VZZA 3P5JB 2PE3A 4ONWA 2JBKA 3NH4A 3S6GA 4RN7A 1R43A 4F0XA 2FL4A 2CNSA 1Y9KA 1YIT1 2J8RA 3K9TA 3QB8A 2FXFA 2YU9I 4FBEA 1YW6A 2POKA 4XPDC 5G21A 2ZPAA 4YGOA 1WZNA 3PRTA 5H84A 2IZ3A 5IP7I 1USPA 3SJEA 5HH1A 2AFOA 1K732 3JAMf 4QB9A 3PO3S 2A4NA 2ZW5A 1IICA 3TTHA 5GCNA 3S1RI 2ZEMA 2JR6A 1RO2A 4OP4A 3SI1A 3PP9A 3J81b 2Z0ZA 4MCRA 3CC7Z 4MHNA 1NUIA 2QECA 3TT2A 3EC4A 4E0AA 3CC71 1WW9A 4HNYB 2AFUA 1TWAI 4HPSA 1RO5A 4KLWA 3NH8A 5F48A 3D6WA 2NAPA 2G9DA 4F9UA 2YNCC 1QVGZ 1N8R2 4R76A 2IL4A 1K9M1 4JWPA 1PYTB 2ZENA 1Y0RA 1R57A 4MD8A 1XFOA 2BOAA 4A93I 4KOXA 4P6YA 4ZX9A 3VMIA 1LQLA 2JA8I 2W03A 3TE5B 3JTKA 3GUXA 3GLJA 2REFA 4A3LI 1K4JA 1AMPA 2ODFA 1IIDA 3KGQA 3GB0A 4RS2A 4U9ZA 2GLJA 2VF1A 4P4BA 4ZI6A 4KVOE 5BWAB 1Q16A 4JXQA 3PFOA 3IX0A 1U6MA 1P4NA 3I56Z 1F2PA 5G1ZA 3CXQA 4UWIA 3DSBA 1S3ZA 3D2LA 2Q04A 1AUGA 4ZBGA 4PXBA 2G0BA 1PCAA 3TOBA 3B3CA 3TX8A 4RVFA 3RZOI 2YNDA 1XOVA 3RZDI 3QAYA 4UCPA 2D4PA 3FIXA 2R7HA 4NBBA 2FE7A 3GTLI 2GU2A 4A3GI 4A3CI 1Z8WA 2BCOA 2EK9A 4NSQA 1JQGA 5A2Qf 3CCU1 1YJW1 4R3KA 5IB9A 1OBRA 3R96A
chains in the Genus database with same CATH topology
1IGBA 1TWCI 2PK7A 1VQ71 2M48A 1XMBA 4MHZA 1TXRA 1Q812 4OIWA 3FX6A 5F09A 5CM2M 3CMA1 4BY1I 3PEIA 1VLAA 2F4OA 2ZOFA 1YJWZ 2WZNA 1Q821 1VQK1 2AFSA 3HOZI 2GTIA 1Q822 3VATA 2R92I 4NGSA 3CMAZ 4HGYA 1VQ41 1ZLIA 3PB4X 3VARA 3EEDA 1QVFY 3HOYI 3CQZI 1S72Z 2C6PA 4QTTA 5LYLA 3I55Z 2XEJA 2W04A 4NJQA 1M4LA 3IC1A 4FWUA 4UEEA 1F2OA 1Y1WI 4MONA 1ML8A 2QA4Z 1JWHC 3GTJI 3CC41 3ISZA 3MN8A 4NBCA 2CTCA 4F8ZA 1Q7LA 2JA6I 2AFWA 1Z2LA 2PIZA 1YITZ 5T6BA 4UF4A 2AKLA 3NDJA 3MRUA 1VQPZ 1CP7A 3GTQI 3IF8A 4NFRA 3I4NI 4A38A 2IMOA 2PJCA 1W2BZ 3GTMS 2PMZA 3NA6A 1BPNA 5ELYA 1VQP1 2JEWA 4P4JA 5HVFA 2NVQI 5K8NA 1VQN1 5IT9f 2PJ3A 1ZG7A 2PJ0A 3IIBA 2RT9A 4P4EA 4TWEA 1N2FA 1TF9A 4NBHA 3QWUA 2QEX1 3TDHB 3KL9A 2DE7A 2QJ8A 3S9NA 4GM5A 4W9YA 5HVGA 2EWBA 4IHMA 3HKZA 5I4MA 1ZH1A 3KI9A 3H8GA 1YJN1 1Z8LA 5K8OA 5LYFA 2DE5A 3S9LA 2GTHA 4EWCA 1YIJZ 2JA7I 3S14I 1TWHI 3CCVZ 1QF8A 3I561 2QKDA 2QRDB 2QEXZ 1Y0YA 1VQ51 2JMOA 1VQM1 3HOUI 3BHXA 3S1MI 2Y0SA 1VHEA 3VMGA 1TWFI 4OC4A 1W2BY 4PXEA 2IZ4A 3JRUA 3D9XA 4NH1C 4XX2A 1QQ9A 5THWA 1YIJ1 1K8A1 1RTQA 3GTMI 2ZEEA 4RS4A 2VUMI 4A39A 3GKQA 4NGMA 1YHQZ 4HH4A 3MONA 1DE4C 4PXCA 5FLXf 1QVFZ 2RIQA 1LFWA 3WC7A 4E2YA 1RO4A 2R7ZI 4X6AI 2OR4A 1PFTA 4MD9A 3T4NB 2HC9A 3G711 3FJUA 2JBJA 4RUHA 2O4HA 1I3QI 1X3ZA 1VQ4Z 2BO9A 4OC2A 4MXUA 2H85A 4E32A 8CPAA 2I3CA 1VQMZ 2KI7B 3KZWA 2C6CA 3HOWI 3CCS1 2RBLA 3M4OI 3D7FA 3PB8X 4QTUA 3B2YA 2WB1A 3FQMA 2Q43A 3DGVA 5K8MA 2QLVB 2AFXA 2PJAA 3S9MA 3PB6X 2CIJA 2E2HI 3B3SA 4IK2A 2IQ6A 3D4UA 3PB7X 4PXDA 3PBEA 4G1PA 5AN9F 2GREA 3SI2A 4JZ0A 3FMCA 3KR4A 4P45A 4NGNA 3J7A4 2K5RA 5LYIA 1VHOA 1RO0A 3S15I 5A2Qb 3J80f 1K9M2 3D7DA 1VQ61 2CTBA 1HDUA 3CDXA 1ARMA 2ANPA 4P10A 2LIYA 4NBGA 1HEEA 3CMEZ 1KQSZ 1TF8A 3HOVI 2JS4A 2OOYB 2QYVA 3B35A 2OTLZ 1X3WA 3G4S1 2PRQA 1KC81 3B7IA 3VH9A 2WAQA 3CCQ1 1YLOA 3FKII 4AYBA 1KC82 4EWTA 2OTL1 1CPXA 2XEFA 3IO1A 1XRYA 3LWUA 2E2JI 3S2DI 4NJRA 4JYWA 1ZG8A 2Q4ZA 4FAIA 3CT9A 1FT7A 1CPSA 1K83I 3I07A 3KQXA 4A94A 1EE3P 1VQOZ 3CXCY 4S1TA 1DTDA 3FF3A 4NGQA 1VQL1 1Q7Y1 1YJNZ 5FLXb 2PJ7A 2NSMA 1WIIA 4BBRI 1YW4A 1JJ2Y 3OW2Z 4Z65A 2RFHA 4ZYQA 5LL6f 1DL6A 3B3WA 3SI0A 1NJI2 4ZY0A 3V38A 4OC3A 3PBBA 2PJ8A 1FNOA 5D1OA 4RVGA 1P9NA 3FEDA 2NVXI 3CPWY 5IT9b 4A3JI 2OZKA 1K731 4RVHA 1UWYA 1ELMP 1M901 4OC5A 2PJ2A 2XEIA 3I1UA 2ZEHA 3CCL1 4H2KA 1BLLE 1NJI1 3GTKI 2QR1B 1VQ91 2NVTI 2VUGA 1YSJA 4YWYA 4MCQA 3IFUA 3CCM1 2F4MA 4BD9A 1M1K1 1VQNZ 5LRKA 2K3RA 1GYTA 3IEHA 1X0TA 2ZEPA 2PJ9A 3DLJA 3HLPA 4UEFA 5T64A 2HB6A 2IJZA 4NB8A 2EGTA 3H3VJ 3KHXA 4MH4A 1TWGI 1Z5RA 4FUUA 3B3VA 3CCLZ 3B3TA 4B6ZA 1JJ2Z 5C3EI 5D1PA 1K8A2 5D29A 3KQZA 4PPZA 3CPXA 2V8VA 2ZELA 3GTPI 3PB9X 1ZG9A 1TFIA 2PVWA 4DYOA 2FVGA 5C4XI 4MD7A 3CCR1 3G6EZ 1KD11 3KASA 1RNIA 4P4FA 2JNYA 1KQSY 3HUVA 4IAVA 5DS0A 3TC8A 1Y1VI 3WABA 3RBUA 5LYDA 5C44I 3BG1B 3S17I 1QYPA 2R93I 5D1OB 4AXVA 4X8IA 4ZY1A 1LAMA 1S7MA 3I551 1N8R1 1IY7A 5J1QA 1KD12 4BBSI 1R9TI 2JUBA 3GTOI 4R8FA 1YUKA 2ZOGA 3FEEA 3CCSZ 3V7ZA 1VQKZ 4A37A 3VTNA 4A3FI 4A3EI 2DE6A 4DJLA 3GTGI 3MZKB 1CG2A 4WJBA 5IP9I 1KRLA 1USPB 2V8KA 2F8HA 3EERA 3CD61 1Y1VS 3P5JB 2PE3A 4ONWA 3QNVA 3SJXA 2JBKA 3NH4A 1R43A 3BG0B 3U50C 4Y52I 2KPIA 4BY7I 3PO2I 4MMOA 2PJBA 3FQQA 4NBAA 3H0GI 4EMEA 3S1NI 1HDQA 3S1QI 2E9HA 2NYQA 1YIT1 1CX8A 2AFMA 1ZB8A 3G4SZ 3K9TA 4PQAA 2G2KA 2YU9I 3BI0A 4CL1A 2V8HA 1LAPA 1YW6A 2POKA 4K3NA 2DEAA 4MHYA 4FBEA 5K8PA 2PJ5A 4RV9A 1LCPA 4TNUA 1I6HI 3PRTA 4MCSA 3KIFA 4EFDA 2IZ3A 1TKFA 1S721 2PVVA 3KIHA 5C4JI 2RB7A 5HXDA 4E30A 1ZLHA 2F7VA 5IP7I 1USPA 4NBDA 3SJEA 1KWMA 3IFEA 5T67A 4MCPA 2M6NA 4KSIA 1Z01A 3F3PC 2AFOA 1K732 3JAMf 5CPAA 4OC0A 3PO3S 2PCUA 3CXCZ 3D7HA 2JA5I 3CCV1 2J9AA 4Y7NI 3CCE1 1XJOA 1RQFA 3NFZA 3PO3I 4OKOA 3S1RI 2ZEOA 3LUSA 2ZEMA 3LMSA 4NGPA 2PJ4A 4O23A 3OW2Y 3CCEZ 2RPRA 5JGFA 2JR6A 2R6MA 1VQ81 4F9VA 1Q7Y2 1RO2A 2PM9A 4OP4A 3CCJ1 3SI1A 4DK1A 2NVYI 2YADA 2PJ6A 1I50I 2GLFA 1VGYA 3J81b 3L2NA 4UEZA 1Y7EA 3CCQZ 4MCRA 4NBEA 3CC7Z 4A3KI 4NGRA 4X3RA 1VQO1 3CPWZ 4YU9A 3WT4A 2ZEDA 4MHNA 1NUIA 4A3BI 2O53A 4P4IA 1AYEA 1VQLZ 1YI2Z 2V77A 2V8JA 3CC71 1WW9A 1NSAA 2V8IA 7CPAA 4E33A 2AFUA 1TWAI 3VB9A 1YI21 3IJ3A 3KHZA 3CCMZ 3CC4Z 1CP6A 3NH8A 4A3DI 1YMEA 1YJ91 3D6WA 4HGZA 5FLMI 4DGLA 3T8WA 1F57A 2G9DA 3WC5A 4F9UA 2AFZA 4DQYB 3BXMA 3CME1 4P44A 4ZX8A 1QVGZ 1Q861 1N8R2 4R76A 2EK8A 3SJGA 1NP6A 3CCJZ 4MHPA 3FVLA 2P3YA 3Q87A 1K9M1 2HF1A 3K7AI 2P28A 2OTJ1 1PYTB 2V8DA 2ZENA 3G71Z 1RLYA 1SFOI 4NOZA 3NH5A 1Y0RA 5D8NA 4CPAA 4MD8A 1Q862 2HU9A 4X2TA 1CBXA 1XFOA 2BOAA 1Q811 4A93I 3D68A 4P6YA 1BPMA 4ZX9A 2QRCB 2OTJZ 2QREB 1LQLA 3VMIA 3NDIA 1ARLA 2ABZA 4P4DA 2JA8I 4NBFA 4RVDA 2W03A 3TE5B 2WYRA 3GUXA 2RHBA 3GLJA 4E2ZA 4OIDA 5JH9A 3I4MI 4A3LI 1AMPA 3N5FA 2E2II 3KGQA 1VIXA 3GB0A 3FH4A 1Z02A 3FECA 1LOKA 3S2HI 1LANA 3SJFA 3CD6Z 3K2KA 2GLJA 2VF1A 4BXXI 2XEGA 3F3FC 4ZY2A 2VL1A 4P4BA 2CF4A 5LRJA 1M1K2 4ZI6A 2C1CA 2OOXB 4A3II 2QVPA 3D67A 3ESWA 2QA41 3RZAA 5HVHA 4E31A 3D7GA 1BAVA 2ZEGA 3PFOA 2J6AA 3IX0A 1WCMI 1YUAA 3JAMb 1L1OC 4WWVA 3I56Z 1VQ8Z 1XBUA 1F2PA 4R7MA 1R3NA 1VQ5Z 3KR5A 3H8FA 3M3YI 1M902 4A3MI 1TKJA 1VQ7Z 3PFEA 4PXBA 4Q7AA 1PCAA 3H8EA 3IWWA 5CBMA 2LFUA 4LQGA 4MRIA 3D66A 2OOTA 4NB9A 1TKHA 3B3CA 3WC6A 4R6TA 1QVGY 1YJ9Z 4DUKA 2BJOA 3TX8A 1Z03A 4RVFA 3G6E1 3CCRZ 1ELLP 3GCFA 1ZB9A 3VMHA 3RZOI 6CPAA 1H8LA 3RZDI 1YHQ1 3CC21 3ISXA 5LRGA 2Q51A 3CPAA 2ZAEB 5JM6A 4E2WA 3MZLB 3CCUZ 4NBBA 3GTLI 2C6GA 4E2XA 2V8GA 4UIAA 3CC2Z 3HOXI 2PIYA 3BI1A 2B63I 2ZEFA 2GU2A 1VQ9Z 4A3CI 4A3GI 1QMUA 2BCOA 2EK9A 1VQ6Z 4NGTA 4UIBA 1JQGA 3J80b 3J81f 3RAMA 5A2Qf 3CCU1 3S16I 4OMEA 1YJW1 4OC1A 5IB9A 1OBRA 2PJ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IGB A;  1XMB A;  4MHZ A;  1TXR A;  4OIW A;  3FX6 A;  5F09 A;  3PEI A;  2ZOF A;  2WZN A;  2AFS A;  3VAT A;  4NGS A;  3VAR A;  1ZLI A;  3PB4 X;  2C6P A;  5LYL A;  2XEJ A;  4NJQ A;  1M4L A;  3IC1 A;  4FWU A;  4UEE A;  1F2O A;  3ISZ A;  3MN8 A;  2CTC A;  4F8Z A;  1Q7L A;  2AFW A;  1Z2L A;  2PIZ A;  4UF4 A;  3MRU A;  1CP7 A;  4NFR A;  4A38 A;  2IMO A;  2PJC A;  3NA6 A;  1BPN A;  5ELY A;  2JEW A;  4P4J A;  5HVF A;  5K8N A;  2PJ3 A;  1ZG7 A;  2PJ0 A;  3IIB A;  4P4E A;  4TWE A;  1TF9 A;  3KL9 A;  2QJ8 A;  3S9N A;  4GM5 A;  4W9Y A;  5HVG A;  2EWB A;  4IHM A;  5I4M A;  3KI9 A;  3H8G A;  1Z8L A;  5K8O A;  5LYF A;  3S9L A;  1Y0Y A;  3BHX A;  1VHE A;  4OC4 A;  4PXE A;  3JRU A;  1QQ9 A;  5THW A;  1RTQ A;  2ZEE A;  4A39 A;  4NGM A;  1DE4 C;  4PXC A;  1LFW A;  3WC7 A;  2OR4 A;  2HC9 A;  3FJU A;  2JBJ A;  4RUH A;  2O4H A;  2BO9 A;  4OC2 A;  4MXU A;  8CPA A;  2I3C A;  3KZW A;  2C6C A;  3D7F A;  3PB8 X;  3B2Y A;  3DGV A;  2Q43 A;  5K8M A;  2AFX A;  2PJA A;  3S9M A;  3PB6 X;  2CIJ A;  3B3S A;  4IK2 A;  2IQ6 A;  3D4U A;  3PB7 X;  4PXD A;  3PBE A;  4G1P A;  2GRE A;  3SI2 A;  4JZ0 A;  3FMC A;  3KR4 A;  4P45 A;  4NGN A;  5LYI A;  1VHO A;  3D7D A;  2CTB A;  1HDU A;  3CDX A;  1ARM A;  2ANP A;  4P10 A;  1HEE A;  1TF8 A;  3B35 A;  2QYV A;  2PRQ A;  3B7I A;  3VH9 A;  1YLO A;  4EWT A;  1CPX A;  2XEF A;  3IO1 A;  1XRY A;  3LWU A;  4NJR A;  4JYW A;  1ZG8 A;  2Q4Z A;  4FAI A;  3CT9 A;  1FT7 A;  1CPS A;  3KQX A;  4A94 A;  1EE3 P;  1DTD A;  3FF3 A;  4NGQ A;  2PJ7 A;  2NSM A;  1YW4 A;  4Z65 A;  2RFH A;  4ZYQ A;  3B3W A;  3SI0 A;  4ZY0 A;  3V38 A;  4OC3 A;  3PBB A;  2PJ8 A;  1FNO A;  3FED A;  1UWY A;  1ELM P;  4OC5 A;  2PJ2 A;  2XEI A;  3I1U A;  2ZEH A;  4H2K A;  1BLL E;  1YSJ A;  4YWY A;  4MCQ A;  4BD9 A;  5LRK A;  1GYT A;  3IEH A;  2ZEP A;  2PJ9 A;  3DLJ A;  3HLP A;  4UEF A;  2HB6 A;  2IJZ A;  3KHX A;  1Z5R A;  4FUU A;  3B3V A;  3B3T A;  4B6Z A;  5D29 A;  3KQZ A;  4PPZ A;  3CPX A;  2V8V A;  2ZEL A;  3PB9 X;  1ZG9 A;  4DYO A;  2PVW A;  2FVG A;  3KAS A;  4P4F A;  3HUV A;  4IAV A;  5DS0 A;  3TC8 A;  3WAB A;  3RBU A;  5LYD A;  4AXV A;  4ZY1 A;  4X8I A;  1LAM A;  1IY7 A;  5J1Q A;  4R8F A;  2ZOG A;  3FEE A;  3V7Z A;  4A37 A;  4DJL A;  1CG2 A;  4WJB A;  2F8H A;  2PE3 A;  4ONW A;  3QNV A;  3SJX A;  2JBK A;  3NH4 A;  1R43 A;  4MMO A;  2PJB A;  4EME A;  1HDQ A;  2NYQ A;  1CX8 A;  2AFM A;  3K9T A;  4PQA A;  3BI0 A;  2V8H A;  4FBE A;  1LAP A;  1YW6 A;  2POK A;  4K3N A;  2DEA A;  4MHY A;  5K8P A;  2PJ5 A;  1LCP A;  4TNU A;  3PRT A;  4MCS A;  4EFD A;  2PVV A;  1TKF A;  2RB7 A;  5HXD A;  1ZLH A;  2F7V A;  3SJE A;  1KWM A;  3IFE A;  4MCP A;  4KSI A;  2AFO A;  5CPA A;  4OC0 A;  2PCU A;  3D7H A;  2J9A A;  1XJO A;  3NFZ A;  4OKO A;  2ZEO A;  2ZEM A;  3LMS A;  4NGP A;  2PJ4 A;  4O23 A;  5JGF A;  4F9V A;  4OP4 A;  3SI1 A;  2PJ6 A;  2GLF A;  1VGY A;  3L2N A;  4UEZ A;  1Y7E A;  4MCR A;  4NGR A;  4X3R A;  4YU9 A;  3WT4 A;  2ZED A;  4MHN A;  2O53 A;  4P4I A;  1AYE A;  2V77 A;  1NSA A;  7CPA A;  2AFU A;  3IJ3 A;  3KHZ A;  1CP6 A;  3NH8 A;  1YME A;  3T8W A;  1F57 A;  2G9D A;  3WC5 A;  4F9U A;  2AFZ A;  3BXM A;  4P44 A;  4ZX8 A;  4R76 A;  2EK8 A;  3SJG A;  4MHP A;  3FVL A;  1PYT B;  2V8D A;  2ZEN A;  3NH5 A;  1Y0R A;  5D8N A;  4CPA A;  4X2T A;  1CBX A;  1XFO A;  2BOA A;  3D68 A;  4P6Y A;  1BPM A;  4ZX9 A;  1ARL A;  2ABZ A;  4P4D A;  2WYR A;  3GUX A;  3GLJ A;  4OID A;  5JH9 A;  3N5F A;  1AMP A;  3KGQ A;  1VIX A;  3GB0 A;  3FH4 A;  3FEC A;  1LOK A;  1LAN A;  3SJF A;  3K2K A;  2GLJ A;  2XEG A;  4ZY2 A;  2VL1 A;  4P4B A;  2CF4 A;  5LRJ A;  4ZI6 A;  2C1C A;  2QVP A;  3D67 A;  3RZA A;  5HVH A;  3D7G A;  1BAV A;  2ZEG A;  3PFO A;  4WWV A;  1XBU A;  1F2P A;  4R7M A;  1R3N A;  3KR5 A;  3H8F A;  1TKJ A;  3PFE A;  4PXB A;  4Q7A A;  1PCA A;  3H8E A;  3IWW A;  5CBM A;  4LQG A;  4MRI A;  3D66 A;  2OOT A;  1TKH A;  3B3C A;  3WC6 A;  4R6T A;  4DUK A;  3TX8 A;  1ELL P;  6CPA A;  1H8L A;  3ISX A;  5LRG A;  2Q51 A;  3CPA A;  5JM6 A;  2C6G A;  2V8G A;  4UIA A;  2PIY A;  3BI1 A;  2ZEF A;  4NGT A;  2GU2 A;  2BCO A;  1QMU A;  2EK9 A;  4UIB A;  1JQG A;  3RAM A;  4OME A;  4OC1 A;  5IB9 A;  1OBR A;  2PJ1 A; 
#chains in the Genus database with same CATH topology
 1V0C A;  1TWC I;  3FX6 A;  3PEI A;  4BY1 I;  3H4Q A;  1VLA A;  2F4O A;  4M3S A;  2GFQ A;  3VAT A;  4NGS A;  3CMA Z;  1ZLI A;  3PB4 X;  3S6K A;  2C6P A;  4NJQ A;  1F2O A;  4MON A;  3JVN A;  4OAE A;  4NBC A;  4XPD B;  1Q7L A;  1Z2L A;  2PIZ A;  4UF4 A;  4XNH C;  1BO4 A;  1MJB A;  2PJC A;  2PMZ A;  4R57 A;  2V45 A;  1VQN 1;  4KOS A;  2OU2 A;  2PJ0 A;  1ZG7 A;  3IIB A;  2RT9 A;  1FY7 A;  4NBH A;  3TDH B;  2QJ8 A;  4GM5 A;  2ZXV A;  4HKF A;  2P6G A;  4L89 A;  3S9L A;  3OWC A;  2ARH A;  1TWH I;  1YRE A;  5F49 A;  4H89 A;  4B11 A;  2JMO A;  1A2Z A;  1VQM 1;  3HOU I;  4KSF A;  3VMG A;  1TWF I;  1QQ9 A;  2HUZ A;  5THW A;  1PU9 A;  4K30 A;  2G3A A;  3GTM I;  4M85 A;  4RS4 A;  2ZW6 A;  4A39 A;  1L0C A;  2J8M A;  5IX3 A;  2JEV A;  2B5G A;  4HH4 A;  3MON A;  4C2Y A;  1DE4 C;  4E2Y A;  2B4D A;  4PV6 A;  2R1I A;  1PFT A;  2HC9 A;  4RUH A;  2O4H A;  1X3Z A;  2R8V A;  3A9L A;  4MXU A;  3KZW A;  2C6C A;  4CAV A;  2RBL A;  3M4O I;  3S9M A;  2E2H I;  3B3S A;  3FBU A;  4IK2 A;  3ZJ0 A;  3PB7 X;  4MFL A;  3SI2 A;  3SHP A;  3KR4 A;  5A2Q b;  3D7D A;  2CTB A;  3CDX A;  1ARM A;  2ANP A;  2LIY A;  3CME Z;  3HOV I;  2JS4 A;  2EO8 A;  3B7I A;  3VH9 A;  2J8N A;  4CYN A;  1CPX A;  4EVY A;  3KQX A;  4A94 A;  2PJ7 A;  1WII A;  2IV2 X;  1YW4 A;  4CRZ B;  2OZH A;  3B3W A;  5J8C A;  4ZY0 A;  4OC3 A;  5JPH A;  1TIQ A;  2DPS A;  1M44 A;  4RI1 A;  5IT9 b;  4A3J I;  2OZK A;  1K73 1;  1UWY A;  4J3G A;  4OC5 A;  2XEI A;  3I1U A;  2BEI A;  3CZX A;  1VQ9 1;  3FNC A;  3IFU A;  2F4M A;  1M1K 1;  2X7B A;  5AG6 A;  3CXP A;  2K3R A;  1NE9 A;  2ZEP A;  3DLJ A;  2IJZ A;  2LEX A;  4NB8 A;  3R9F A;  2Q0Y A;  3CCL Z;  3R9G A;  2I79 A;  3CPX A;  4PPZ A;  4DYO A;  2PVW A;  5KTD A;  1XMT A;  1KD1 1;  4HNX B;  1Y1V I;  4KOT A;  1Q2Y A;  2PR1 A;  3S17 I;  2R93 I;  1QYP A;  5D1O B;  1N8R 1;  4KS9 A;  5J1Q A;  1KD1 2;  4BBS I;  3GTO I;  2R98 A;  4A37 A;  2DE6 A;  5EC4 A;  4QC6 A;  3GTG I;  1MJA A;  4UWJ A;  5IP9 I;  3CD6 1;  4I49 A;  1Y1V S;  3QNV A;  3BG0 B;  2B58 A;  3PO2 I;  2PJB A;  4EME A;  2E9H A;  3D2P A;  5DWN A;  2G2K A;  4CL1 A;  5K8P A;  1I1D A;  4K3N A;  4L8A A;  1LCP A;  4KZT A;  1I6H I;  3T90 A;  1IOI A;  1TKF A;  1S72 1;  2F7V A;  1KWM A;  5EBV A;  2JA5 I;  3NFZ A;  3LUS A;  4C2X A;  2PJ4 A;  1CJW A;  3FXT A;  2R6M A;  5I0C A;  2PM9 A;  4DK1 A;  1I50 I;  5A27 A;  3F5B A;  2PDO A;  2ZED A;  2O53 A;  1S7F A;  1NSA A;  3BLN A;  7CPA A;  3I9S A;  4E33 A;  4AVC A;  3IJ3 A;  4A3D I;  3F8K A;  4BBH A;  4II9 A;  4DGL A;  3T8W A;  1F57 A;  4JLY A;  2AFZ A;  3CME 1;  2EK8 A;  4KOR A;  2VBQ A;  3FVL A;  1SFO I;  4NOZ A;  3NH5 A;  2GAN A;  5D8N A;  4Q38 A;  2HU9 A;  3IGR A;  4KVX A;  3D68 A;  1BPM A;  3GYA A;  2OTJ Z;  3R95 A;  2NMT A;  1ARL A;  3NDI A;  4A33 A;  4E2Z A;  4AB7 A;  1QXF A;  5JH9 A;  2Q4Y A;  2O28 A;  3SJF A;  1FDO A;  2XEG A;  2VL1 A;  2AYD A;  5LRJ A;  4Y49 B;  3TO7 A;  2OOX B;  1P0H A;  5FVJ A;  1IB1 E;  3D67 A;  3ESW A;  3RZA A;  4KVM E;  3D7G A;  2J6A A;  3T9Y A;  1WCM I;  2CXA A;  1YUA A;  4UFV A;  4R7M A;  3PGP A;  1R3N A;  3H8F A;  4E8O A;  1YVK A;  2WSA A;  1M90 2;  3H8E A;  4LQG A;  4MRI A;  4R6T A;  1QVG Y;  3JUW A;  3EFA A;  1ELL P;  1ZB9 A;  6CPA A;  3K9U A;  4IUS A;  1I21 A;  2VPW A;  3ISX A;  2Q51 A;  2B5G B;  3CPA A;  1IU8 A;  5JM6 A;  4E2W A;  4JJX A;  3MZL B;  2V8G A;  2CY2 A;  2B63 I;  2ZEF A;  4OLL A;  4NGT A;  1VQ9 Z;  1VQ6 Z;  4OME A;  2PJ1 A;  2YNC A;  1VQ7 1;  2M48 A;  1Q81 2;  2P6E A;  3CMA 1;  3DNS A;  1Q82 1;  1VQK 1;  5F46 A;  2AFS A;  2GTI A;  4B13 A;  4KOV A;  3P2H A;  4CGL A;  3S6F A;  2VPX A;  1KUY A;  4HGY A;  1VQ4 1;  4CAW A;  3EED A;  1S72 Z;  2W04 A;  3ZZI A;  1M4L A;  4FWU A;  4UEE A;  1ML8 A;  2FIA A;  2QA4 Z;  1JWH C;  3GTJ I;  4MJ8 A;  2JA6 I;  3GTQ I;  3IF8 A;  4NFR A;  3I4N I;  4A38 A;  3NA6 A;  5K8N A;  5IT9 f;  1Y8C A;  5AG4 A;  2CNT A;  4KOW A;  1XIX A;  1TF9 A;  4TWE A;  3QWU A;  1YX0 A;  1ZH1 A;  1YJN 1;  1Z8L A;  5IV0 A;  2GTH A;  2JA7 I;  2Z3L A;  3S14 I;  1QF8 A;  2QRD B;  1Y0Y A;  5KTC A;  3BHX A;  3S1M I;  2Y0S A;  1VHE A;  1MK4 A;  4OC4 A;  1W2B Y;  3H5Z A;  3D9X A;  4XX2 A;  2BUE A;  4R9M A;  2ZEE A;  5C88 A;  2VUM I;  3G3S A;  4NGM A;  1YHQ Z;  5FLX f;  1QVF Z;  4CYO A;  4UCN A;  2VXK A;  1RO4 A;  4MD9 A;  3G71 1;  3FJU A;  1WJ2 A;  8CPA A;  1VQM Z;  2KI7 B;  5A28 A;  4GXH A;  2YGW A;  2Q44 A;  3RO0 A;  2WB1 A;  3DGV A;  1JWQ A;  2QLV B;  3PB6 X;  2FS5 A;  4PXD A;  4G1P A;  5AN9 F;  5AGE A;  1YR0 A;  4P45 A;  2K5R A;  1S60 A;  1HEE A;  3B35 A;  1KQS Z;  2G3T A;  2QYV A;  1I12 A;  4KSA A;  1KC8 1;  4R3L A;  3CCQ 1;  2F5I A;  4EWT A;  2PRB A;  1XRY A;  2Q4V A;  4NJR A;  1ZG8 A;  1X12 A;  4R87 A;  3IWG A;  4LUA A;  4S1T A;  3FF3 A;  3DR6 A;  5EMI A;  4NGQ A;  5FLX b;  4F0Y A;  3IU1 A;  3OW2 Z;  4Z65 A;  4KLV A;  4ZYQ A;  5LL6 f;  1NJI 2;  1J4J A;  5IB0 A;  3FED A;  2NVX I;  3CPW Y;  2ZW4 A;  1ELM P;  2PJ2 A;  4H2K A;  1NJI 1;  3GTK I;  2QR1 B;  1LRZ A;  1YSJ A;  2EBJ A;  3CCM 1;  2HV2 A;  1GYT A;  3BJ7 A;  2PJ9 A;  3HLP A;  1MJ9 A;  2DF5 A;  3B3T A;  4B6Z A;  5C3E I;  5D29 A;  3KQZ A;  3GTP I;  2PSW A;  1ZG9 A;  1TFI A;  4AVA A;  1RNI A;  3TFY A;  2P6F A;  3WAB A;  5LYD A;  3BG1 B;  3LD2 A;  1S7M A;  1R9T I;  2JUB A;  4R8F A;  3FEE A;  4UCM A;  1XF8 A;  4DJL A;  1YQE A;  3MZK B;  2F8H A;  3EER A;  1BOB A;  4FD7 A;  4Y52 I;  3FQQ A;  4NBA A;  3H0G I;  3S1N I;  1HDQ A;  4XNH B;  3G4S Z;  1ZO0 A;  3SXN A;  4AG9 A;  3BI0 A;  1LAP A;  4MHY A;  2DEA A;  4RV9 A;  2Y0M A;  4TNU A;  4X5K A;  3KIF A;  4EFD A;  2PVV A;  2RB7 A;  3KIH A;  5C4J I;  1QSN A;  5HXD A;  4NBD A;  5T67 A;  4QUS A;  1Z01 A;  4XPK A;  5G22 A;  1S7N A;  2JIP A;  3RYO A;  4OC0 A;  2PCU A;  3D7H A;  2VEZ A;  1S7L A;  3IR7 A;  3CCE 1;  1RQF A;  4OKO A;  1M4G A;  2Z3K A;  2GE3 A;  3LMS A;  5J8F A;  4NGP A;  4A31 A;  1N71 A;  3CCE Z;  2RPR A;  1VQ8 1;  4F9V A;  4NXY A;  3V8I A;  2NVY I;  2YAD A;  2PJ6 A;  4IF5 A;  2GLF A;  3CCQ Z;  5G20 A;  4NBE A;  4NEX A;  4A3K I;  1IOF A;  4X3R A;  3FRM A;  3CPW Z;  4YU9 A;  1S7K A;  1VQL Z;  2D4O A;  3MGD A;  3VB9 A;  3KHZ A;  1CP6 A;  1YME A;  4QVT A;  4HGZ A;  5FLM I;  4NCZ A;  1UFH A;  3DDD A;  4DQY B;  4ZX8 A;  4PSX A;  1YLE A;  4Q36 A;  4MHP A;  4CAE A;  2P3Y A;  3Q87 A;  2OTJ 1;  3K7A I;  3G71 Z;  1RLY A;  3QAH A;  3KKW A;  2E7Z A;  3NE8 A;  4CPA A;  4X2T A;  1CBX A;  4XPL A;  1Q81 1;  2QRC B;  2QRE B;  3FYN A;  2ABZ A;  4P4D A;  1Q2D A;  3B8G A;  4RVD A;  4A32 A;  3I4M I;  4YFJ A;  2E2I I;  2YNE A;  1VIX A;  4QBJ A;  1Z02 A;  3FEC A;  1LOK A;  1B87 A;  1LAN A;  1M4I A;  2B3U A;  2CF4 A;  1M1K 2;  2C1C A;  4A3I I;  2OH1 A;  5AG5 A;  5HVH A;  3GIU A;  1BAV A;  2ZEG A;  2JDC A;  3W6S A;  3JAM b;  1L1O C;  3G8W A;  1VQ8 Z;  3GY9 A;  4A3M I;  4B14 A;  4Q7A A;  3TO9 A;  3IWW A;  5CBM A;  2LFU A;  4MY0 A;  1TKH A;  1Z03 A;  3G6E 1;  5F47 A;  5JQ4 A;  1X10 A;  3D3S A;  3CC2 1;  1NSL A;  2B4D B;  3CCU Z;  4E2X A;  4PK3 A;  3CC2 Z;  2PIY A;  3BI1 A;  1QMU A;  2REE A;  4UIB A;  3J80 b;  3J81 f;  4OC1 A;  5H86 A;  4JD6 A;  1IGB A;  1XMB A;  4MHZ A;  1TXR A;  4OIW A;  4MHD A;  4KUA A;  2ZOF A;  2WZN A;  2OZG A;  2WUU A;  4FD6 A;  3R9E A;  2R92 I;  1QVF Y;  3HOY I;  5LYL A;  2XEJ A;  3IC1 A;  1Y1W I;  2B4B A;  3ISZ A;  3MN8 A;  2CTC A;  4F8Z A;  1YIT Z;  5T6B A;  1CM0 A;  3NDJ A;  5C82 A;  2IMO A;  3E0K A;  1W2B Z;  1ON0 A;  3GTM S;  4LX9 A;  2GIV A;  1BPN A;  2ATR A;  1VQP 1;  2JEW A;  4P4J A;  2NVQ I;  4PSW A;  1QSR A;  3FB3 A;  2PJ3 A;  4CYP A;  1N2F A;  3TO6 A;  2QEX 1;  4IHM A;  5I4M A;  3KI9 A;  3H8G A;  4H6Z A;  2Z10 A;  2DE5 A;  2FSR A;  3I56 1;  2QEX Z;  1VQ5 1;  4M6I A;  1YVO A;  2IZ4 A;  4MFP A;  4MFQ A;  1YGH A;  2I00 A;  3GKQ A;  2FIW A;  4PXC A;  3WC7 A;  4B5P B;  4X6A I;  2OR4 A;  4HNW B;  4MFK A;  3N7Z A;  2QIR A;  2JBJ A;  3TOA A;  4LQ6 A;  2H85 A;  2I3C A;  1VKC A;  2WPX A;  3HOW I;  3CCS 1;  3D7F A;  3RNZ A;  2AFX A;  4UA3 A;  4PK2 A;  3PBE A;  4FD5 A;  1IYK A;  3FMC A;  1VHO A;  3S15 I;  3J80 f;  5HMN A;  3S6H A;  1QST A;  4P10 A;  1TF8 A;  2OOY B;  2OTL Z;  3G4S 1;  1Z8X A;  3FKI I;  4AYB A;  4C7I A;  4JYW A;  4FAI A;  3CT9 A;  1FT7 A;  1CPS A;  1K83 I;  3I07 A;  3C26 A;  1VQO Z;  1S5K A;  4CGP A;  1DTD A;  1Q7Y 1;  2NSM A;  4BBR I;  2RFH A;  4F6A A;  3SI0 A;  3V38 A;  3PBB A;  2PJ8 A;  1FNO A;  5D1O A;  1WWZ A;  1B6B A;  4RVH A;  1M90 1;  1KZF A;  4CS0 B;  1AA6 A;  2WPW A;  4YWY A;  4MCQ A;  4CRY B;  2OZU A;  5LRK A;  3PZJ A;  5T64 A;  2EGT A;  3H3V J;  3KHX A;  4FUU A;  3B3V A;  2DPT A;  2Z3P A;  1KUX A;  2ZEL A;  2QML A;  1GHE A;  4MD7 A;  3CCR 1;  4A2Z A;  4P4F A;  3HUV A;  4IAV A;  5DS0 A;  2V3V A;  5C44 I;  3GKR A;  4AXV A;  4ZY1 A;  4H6U A;  4X8I A;  1LAM A;  2Q7B A;  3V7Z A;  1VQK Z;  4GS4 A;  3VTN A;  4A3F I;  4A3E I;  4WJB A;  2V8K A;  4CAX A;  2CNM A;  3SJX A;  1PUA A;  3U50 C;  2DXQ A;  2KPI A;  4BY7 I;  4MMO A;  4NF1 A;  3S1Q I;  2NYQ A;  1CX8 A;  2AFM A;  1ZB8 A;  4PQA A;  2V8H A;  4JXR A;  2PJ5 A;  1XEB A;  1QSO A;  4MCS A;  4CYQ A;  4E30 A;  1ZLH A;  2JDD A;  3IFE A;  4MCP A;  2M6N A;  4KSI A;  3F3P C;  4CGN A;  5CPA A;  3CXC Z;  2J9A A;  3CCV 1;  2BL1 A;  4Y7N I;  1M1D A;  1XJO A;  3PO3 I;  4A95 A;  2ZEO A;  2JIQ A;  4O23 A;  3OW2 Y;  5JGF A;  1Q7Y 2;  3CCJ 1;  2KCW A;  3L2N A;  1VGY A;  4UEZ A;  1Y7E A;  3BJ8 A;  4NGR A;  1VQO 1;  3WT4 A;  4A3B I;  4P4I A;  1AYE A;  4KOY A;  1YI2 Z;  2V77 A;  2V8J A;  4OAD A;  2V8I A;  3F0A A;  3NE7 A;  1YI2 1;  3CCM Z;  3CC4 Z;  5CNP A;  4AG7 A;  1OZP A;  2BSW A;  1YJ9 1;  4BIN A;  3WC5 A;  4DNC A;  3BXM A;  4P44 A;  1Q86 1;  3SJG A;  1NP6 A;  3CCJ Z;  2HF1 A;  2P28 A;  2V8D A;  3W91 A;  1Q86 2;  2P0W A;  1WK4 A;  4B10 A;  3EY5 A;  3D8P A;  4C2Z A;  2FT0 A;  2EUI A;  4NBF A;  2WYR A;  2RHB A;  4OID A;  4MFZ A;  3N5F A;  2H5M A;  3FH4 A;  3R1K A;  4Y49 C;  3EXN A;  3S2H I;  3CD6 Z;  3K2K A;  4MI4 A;  4BXX I;  3F3F C;  4ZY2 A;  3I3G A;  2B3V A;  2QVP A;  1FDI A;  2QA4 1;  4E31 A;  4E2A A;  4C7H A;  4WWV A;  3WR7 A;  1XBU A;  1VQ5 Z;  2EVN A;  3KR5 A;  3IWE A;  4BMH A;  3M3Y I;  3LAC A;  2FCK A;  1TKJ A;  1VQ7 Z;  3PFE A;  2AJ6 A;  3D66 A;  2OOT A;  4NB9 A;  4B5O A;  3WC6 A;  2VQY A;  1YJ9 Z;  4DUK A;  2BJO A;  3CCR Z;  1Q2C A;  3VWE A;  3GCF A;  2PQ8 A;  3VMH A;  1H8L A;  2ZW7 A;  1YHQ 1;  1NMT A;  4KOU A;  5LRG A;  2ZAE B;  4B5P A;  1RXT A;  2C6G A;  2K5T A;  4UIA A;  3HOX I;  3RAM A;  3S16 I;  3TE4 A;  1VHS A;  2PK7 A;  2JIM A;  5F09 A;  5CM2 M;  4A30 A;  1YJW Z;  4UFW A;  3HOZ I;  1Z8T A;  4MBU A;  1Q82 2;  4UFX A;  1YK3 A;  3VAR A;  3CQZ I;  4QTT A;  4CGO A;  3I55 Z;  4M6G A;  4U9Y A;  3TCV A;  3CC4 1;  2AFW A;  2AKL A;  3MRU A;  1VQP Z;  1CP7 A;  4AVB A;  3DR8 A;  3IU2 A;  2Z11 A;  5ELY A;  1M4D A;  5DWM A;  5HVF A;  2Q7S A;  5KTA A;  4P4E A;  4CGM A;  3KL9 A;  2DE7 A;  2AE6 A;  3S9N A;  4W9Y A;  5HVG A;  2EWB A;  3HKZ A;  5K8O A;  5LYF A;  1Y9W A;  4EWC A;  1YIJ Z;  1XE4 A;  3CCV Z;  2QKD A;  2Z3O A;  3LOD A;  4PXE A;  2JIO A;  3JRU A;  4NH1 C;  1YIJ 1;  4ONU A;  1K8A 1;  3UY5 A;  1RTQ A;  3D2M A;  4U5Y A;  5ISV A;  4MY3 A;  2RIQ A;  1LFW A;  3EO4 A;  2R7Z I;  3T4N B;  1Z4R A;  1I3Q I;  1VQ4 Z;  2BO9 A;  4OC2 A;  4E32 A;  2OB0 A;  4CAF A;  1QSM A;  3PB8 X;  4QTU A;  3B2Y A;  3FQM A;  1Z9U A;  2Q43 A;  5K8M A;  1SIW A;  2PJA A;  2CIJ A;  2IQ6 A;  3D4U A;  4ORF A;  2GRE A;  4JZ0 A;  4NGN A;  3J7A 4;  5LYI A;  1RO0 A;  2VPY A;  1K9M 2;  1VQ6 1;  1HDU A;  4NBG A;  4C68 A;  3SXO A;  1X3W A;  2PC1 A;  2VZY A;  2PRQ A;  5AG7 A;  2WAQ A;  1YLO A;  2C27 A;  4M6H A;  1KC8 2;  2RC4 A;  2OTL 1;  2XEF A;  3IO1 A;  3LWU A;  2Z3N A;  2E2J I;  3S2D I;  2PR8 A;  2Q4Z A;  3VWD A;  1EE3 P;  3CXC Y;  1VQL 1;  1YJN Z;  1JJ2 Y;  1Z4E A;  4UBR A;  1DL6 A;  4ZGY B;  4RVG A;  1P9N A;  3CXS A;  5E96 A;  2ZEH A;  3CCL 1;  1BLL E;  2NVT I;  2VUG A;  4YRH A;  4BD9 A;  1VQN Z;  4KUB A;  3IEH A;  1X0T A;  1SQH A;  4UEF A;  3W6X A;  2HB6 A;  2VI7 A;  4MH4 A;  1TWG I;  1Z5R A;  1JJ2 Z;  5D1P A;  1K8A 2;  1KUV A;  4MFJ A;  2V8V A;  3PB9 X;  2JIR A;  5C4X I;  2FVG A;  3G6E Z;  3KAS A;  2JNY A;  2JLM A;  4B12 A;  3P2F A;  1KQS Y;  3TC8 A;  3RBU A;  3I55 1;  1IY7 A;  1YUK A;  2ZOG A;  3CCS Z;  1IYL A;  2VPZ A;  1Y7R A;  4FD4 A;  1CG2 A;  1KRL A;  1USP B;  2HQY A;  2Z3M A;  2VZZ A;  3P5J B;  2PE3 A;  4ONW A;  2JBK A;  3NH4 A;  3S6G A;  4RN7 A;  1R43 A;  4F0X A;  2FL4 A;  2CNS A;  1Y9K A;  1YIT 1;  2J8R A;  3K9T A;  3QB8 A;  2FXF A;  2YU9 I;  4FBE A;  1YW6 A;  2POK A;  4XPD C;  5G21 A;  2ZPA A;  4YGO A;  1WZN A;  3PRT A;  5H84 A;  2IZ3 A;  5IP7 I;  1USP A;  3SJE A;  5HH1 A;  2AFO A;  1K73 2;  3JAM f;  4QB9 A;  3PO3 S;  2A4N A;  2ZW5 A;  1IIC A;  3TTH A;  5GCN A;  3S1R I;  2ZEM A;  2JR6 A;  1RO2 A;  4OP4 A;  3SI1 A;  3PP9 A;  3J81 b;  2Z0Z A;  4MCR A;  3CC7 Z;  4MHN A;  1NUI A;  2QEC A;  3TT2 A;  3EC4 A;  4E0A A;  3CC7 1;  1WW9 A;  4HNY B;  2AFU A;  1TWA I;  4HPS A;  1RO5 A;  4KLW A;  3NH8 A;  5F48 A;  3D6W A;  2NAP A;  2G9D A;  4F9U A;  2YNC C;  1QVG Z;  1N8R 2;  4R76 A;  2IL4 A;  1K9M 1;  4JWP A;  1PYT B;  2ZEN A;  1Y0R A;  1R57 A;  4MD8 A;  1XFO A;  2BOA A;  4A93 I;  4KOX A;  4P6Y A;  4ZX9 A;  3VMI A;  1LQL A;  2JA8 I;  2W03 A;  3TE5 B;  3JTK A;  3GUX A;  3GLJ A;  2REF A;  4A3L I;  1K4J A;  1AMP A;  2ODF A;  1IID A;  3KGQ A;  3GB0 A;  4RS2 A;  4U9Z A;  2GLJ A;  2VF1 A;  4P4B A;  4ZI6 A;  4KVO E;  5BWA B;  1Q16 A;  4JXQ A;  3PFO A;  3IX0 A;  1U6M A;  1P4N A;  3I56 Z;  1F2P A;  5G1Z A;  3CXQ A;  4UWI A;  3DSB A;  1S3Z A;  3D2L A;  2Q04 A;  1AUG A;  4ZBG A;  4PXB A;  2G0B A;  1PCA A;  3TOB A;  3B3C A;  3TX8 A;  4RVF A;  3RZO I;  2YND A;  1XOV A;  3RZD I;  3QAY A;  4UCP A;  2D4P A;  3FIX A;  2R7H A;  4NBB A;  2FE7 A;  3GTL I;  2GU2 A;  4A3G I;  4A3C I;  1Z8W A;  2BCO A;  2EK9 A;  4NSQ A;  1JQG A;  5A2Q f;  3CCU 1;  1YJW 1;  4R3K A;  5IB9 A;  1OBR A;  3R96 A; 
#chains in the Genus database with same CATH homology
 1IGB A;  1TWC I;  2PK7 A;  1VQ7 1;  2M48 A;  1XMB A;  4MHZ A;  1TXR A;  1Q81 2;  4OIW A;  3FX6 A;  5F09 A;  5CM2 M;  3CMA 1;  4BY1 I;  3PEI A;  1VLA A;  2F4O A;  2ZOF A;  1YJW Z;  2WZN A;  1Q82 1;  1VQK 1;  2AFS A;  3HOZ I;  2GTI A;  1Q82 2;  3VAT A;  2R92 I;  4NGS A;  3CMA Z;  4HGY A;  1VQ4 1;  1ZLI A;  3PB4 X;  3VAR A;  3EED A;  1QVF Y;  3HOY I;  3CQZ I;  1S72 Z;  2C6P A;  4QTT A;  5LYL A;  3I55 Z;  2XEJ A;  2W04 A;  4NJQ A;  1M4L A;  3IC1 A;  4FWU A;  4UEE A;  1F2O A;  1Y1W I;  4MON A;  1ML8 A;  2QA4 Z;  1JWH C;  3GTJ I;  3CC4 1;  3ISZ A;  3MN8 A;  4NBC A;  2CTC A;  4F8Z A;  1Q7L A;  2JA6 I;  2AFW A;  1Z2L A;  2PIZ A;  1YIT Z;  5T6B A;  4UF4 A;  2AKL A;  3NDJ A;  3MRU A;  1VQP Z;  1CP7 A;  3GTQ I;  3IF8 A;  4NFR A;  3I4N I;  4A38 A;  2IMO A;  2PJC A;  1W2B Z;  3GTM S;  2PMZ A;  3NA6 A;  1BPN A;  5ELY A;  1VQP 1;  2JEW A;  4P4J A;  5HVF A;  2NVQ I;  5K8N A;  1VQN 1;  5IT9 f;  2PJ3 A;  1ZG7 A;  2PJ0 A;  3IIB A;  2RT9 A;  4P4E A;  4TWE A;  1N2F A;  1TF9 A;  4NBH A;  3QWU A;  2QEX 1;  3TDH B;  3KL9 A;  2DE7 A;  2QJ8 A;  3S9N A;  4GM5 A;  4W9Y A;  5HVG A;  2EWB A;  4IHM A;  3HKZ A;  5I4M A;  1ZH1 A;  3KI9 A;  3H8G A;  1YJN 1;  1Z8L A;  5K8O A;  5LYF A;  2DE5 A;  3S9L A;  2GTH A;  4EWC A;  1YIJ Z;  2JA7 I;  3S14 I;  1TWH I;  3CCV Z;  1QF8 A;  3I56 1;  2QKD A;  2QRD B;  2QEX Z;  1Y0Y A;  1VQ5 1;  2JMO A;  1VQM 1;  3HOU I;  3BHX A;  3S1M I;  2Y0S A;  1VHE A;  3VMG A;  1TWF I;  4OC4 A;  1W2B Y;  4PXE A;  2IZ4 A;  3JRU A;  3D9X A;  4NH1 C;  4XX2 A;  1QQ9 A;  5THW A;  1YIJ 1;  1K8A 1;  1RTQ A;  3GTM I;  2ZEE A;  4RS4 A;  2VUM I;  4A39 A;  3GKQ A;  4NGM A;  1YHQ Z;  4HH4 A;  3MON A;  1DE4 C;  4PXC A;  5FLX f;  1QVF Z;  2RIQ A;  1LFW A;  3WC7 A;  4E2Y A;  1RO4 A;  2R7Z I;  4X6A I;  2OR4 A;  1PFT A;  4MD9 A;  3T4N B;  2HC9 A;  3G71 1;  3FJU A;  2JBJ A;  4RUH A;  2O4H A;  1I3Q I;  1X3Z A;  1VQ4 Z;  2BO9 A;  4OC2 A;  4MXU A;  2H85 A;  4E32 A;  8CPA A;  2I3C A;  1VQM Z;  2KI7 B;  3KZW A;  2C6C A;  3HOW I;  3CCS 1;  2RBL A;  3M4O I;  3D7F A;  3PB8 X;  4QTU A;  3B2Y A;  2WB1 A;  3FQM A;  2Q43 A;  3DGV A;  5K8M A;  2QLV B;  2AFX A;  2PJA A;  3S9M A;  3PB6 X;  2CIJ A;  2E2H I;  3B3S A;  4IK2 A;  2IQ6 A;  3D4U A;  3PB7 X;  4PXD A;  3PBE A;  4G1P A;  5AN9 F;  2GRE A;  3SI2 A;  4JZ0 A;  3FMC A;  3KR4 A;  4P45 A;  4NGN A;  3J7A 4;  2K5R A;  5LYI A;  1VHO A;  1RO0 A;  3S15 I;  5A2Q b;  3J80 f;  1K9M 2;  3D7D A;  1VQ6 1;  2CTB A;  1HDU A;  3CDX A;  1ARM A;  2ANP A;  4P10 A;  2LIY A;  4NBG A;  1HEE A;  3CME Z;  1KQS Z;  1TF8 A;  3HOV I;  2JS4 A;  2OOY B;  2QYV A;  3B35 A;  2OTL Z;  1X3W A;  3G4S 1;  2PRQ A;  1KC8 1;  3B7I A;  3VH9 A;  2WAQ A;  3CCQ 1;  1YLO A;  3FKI I;  4AYB A;  1KC8 2;  4EWT A;  2OTL 1;  1CPX A;  2XEF A;  3IO1 A;  1XRY A;  3LWU A;  2E2J I;  3S2D I;  4NJR A;  4JYW A;  1ZG8 A;  2Q4Z A;  4FAI A;  3CT9 A;  1FT7 A;  1CPS A;  1K83 I;  3I07 A;  3KQX A;  4A94 A;  1EE3 P;  1VQO Z;  3CXC Y;  4S1T A;  1DTD A;  3FF3 A;  4NGQ A;  1VQL 1;  1Q7Y 1;  1YJN Z;  5FLX b;  2PJ7 A;  2NSM A;  1WII A;  4BBR I;  1YW4 A;  1JJ2 Y;  3OW2 Z;  4Z65 A;  2RFH A;  4ZYQ A;  5LL6 f;  1DL6 A;  3B3W A;  3SI0 A;  1NJI 2;  4ZY0 A;  3V38 A;  4OC3 A;  3PBB A;  2PJ8 A;  1FNO A;  5D1O A;  4RVG A;  1P9N A;  3FED A;  2NVX I;  3CPW Y;  5IT9 b;  4A3J I;  2OZK A;  1K73 1;  4RVH A;  1UWY A;  1ELM P;  1M90 1;  4OC5 A;  2PJ2 A;  2XEI A;  3I1U A;  2ZEH A;  3CCL 1;  4H2K A;  1BLL E;  1NJI 1;  3GTK I;  2QR1 B;  1VQ9 1;  2NVT I;  2VUG A;  1YSJ A;  4YWY A;  4MCQ A;  3IFU A;  3CCM 1;  2F4M A;  4BD9 A;  1M1K 1;  1VQN Z;  5LRK A;  2K3R A;  1GYT A;  3IEH A;  1X0T A;  2ZEP A;  2PJ9 A;  3DLJ A;  3HLP A;  4UEF A;  5T64 A;  2HB6 A;  2IJZ A;  4NB8 A;  2EGT A;  3H3V J;  3KHX A;  4MH4 A;  1TWG I;  1Z5R A;  4FUU A;  3B3V A;  3CCL Z;  3B3T A;  4B6Z A;  1JJ2 Z;  5C3E I;  5D1P A;  1K8A 2;  5D29 A;  3KQZ A;  4PPZ A;  3CPX A;  2V8V A;  2ZEL A;  3GTP I;  3PB9 X;  1ZG9 A;  1TFI A;  2PVW A;  4DYO A;  2FVG A;  5C4X I;  4MD7 A;  3CCR 1;  3G6E Z;  1KD1 1;  3KAS A;  1RNI A;  4P4F A;  2JNY A;  1KQS Y;  3HUV A;  4IAV A;  5DS0 A;  3TC8 A;  1Y1V I;  3WAB A;  3RBU A;  5LYD A;  5C44 I;  3BG1 B;  3S17 I;  1QYP A;  2R93 I;  5D1O B;  4AXV A;  4X8I A;  4ZY1 A;  1LAM A;  1S7M A;  3I55 1;  1N8R 1;  1IY7 A;  5J1Q A;  1KD1 2;  4BBS I;  1R9T I;  2JUB A;  3GTO I;  4R8F A;  1YUK A;  2ZOG A;  3FEE A;  3CCS Z;  3V7Z A;  1VQK Z;  4A37 A;  3VTN A;  4A3F I;  4A3E I;  2DE6 A;  4DJL A;  3GTG I;  3MZK B;  1CG2 A;  4WJB A;  5IP9 I;  1KRL A;  1USP B;  2V8K A;  2F8H A;  3EER A;  3CD6 1;  1Y1V S;  3P5J B;  2PE3 A;  4ONW A;  3QNV A;  3SJX A;  2JBK A;  3NH4 A;  1R43 A;  3BG0 B;  3U50 C;  4Y52 I;  2KPI A;  4BY7 I;  3PO2 I;  4MMO A;  2PJB A;  3FQQ A;  4NBA A;  3H0G I;  4EME A;  3S1N I;  1HDQ A;  3S1Q I;  2E9H A;  2NYQ A;  1YIT 1;  1CX8 A;  2AFM A;  1ZB8 A;  3G4S Z;  3K9T A;  4PQA A;  2G2K A;  2YU9 I;  3BI0 A;  4CL1 A;  2V8H A;  1LAP A;  1YW6 A;  2POK A;  4K3N A;  2DEA A;  4MHY A;  4FBE A;  5K8P A;  2PJ5 A;  4RV9 A;  1LCP A;  4TNU A;  1I6H I;  3PRT A;  4MCS A;  3KIF A;  4EFD A;  2IZ3 A;  1TKF A;  1S72 1;  2PVV A;  3KIH A;  5C4J I;  2RB7 A;  5HXD A;  4E30 A;  1ZLH A;  2F7V A;  5IP7 I;  1USP A;  4NBD A;  3SJE A;  1KWM A;  3IFE A;  5T67 A;  4MCP A;  2M6N A;  4KSI A;  1Z01 A;  3F3P C;  2AFO A;  1K73 2;  3JAM f;  5CPA A;  4OC0 A;  3PO3 S;  2PCU A;  3CXC Z;  3D7H A;  2JA5 I;  3CCV 1;  2J9A A;  4Y7N I;  3CCE 1;  1XJO A;  1RQF A;  3NFZ A;  3PO3 I;  4OKO A;  3S1R I;  2ZEO A;  3LUS A;  2ZEM A;  3LMS A;  4NGP A;  2PJ4 A;  4O23 A;  3OW2 Y;  3CCE Z;  2RPR A;  5JGF A;  2JR6 A;  2R6M A;  1VQ8 1;  4F9V A;  1Q7Y 2;  1RO2 A;  2PM9 A;  4OP4 A;  3CCJ 1;  3SI1 A;  4DK1 A;  2NVY I;  2YAD A;  2PJ6 A;  1I50 I;  2GLF A;  1VGY A;  3J81 b;  3L2N A;  4UEZ A;  1Y7E A;  3CCQ Z;  4MCR A;  4NBE A;  3CC7 Z;  4A3K I;  4NGR A;  4X3R A;  1VQO 1;  3CPW Z;  4YU9 A;  3WT4 A;  2ZED A;  4MHN A;  1NUI A;  4A3B I;  2O53 A;  4P4I A;  1AYE A;  1VQL Z;  1YI2 Z;  2V77 A;  2V8J A;  3CC7 1;  1WW9 A;  1NSA A;  2V8I A;  7CPA A;  4E33 A;  2AFU A;  1TWA I;  3VB9 A;  1YI2 1;  3IJ3 A;  3KHZ A;  3CCM Z;  3CC4 Z;  1CP6 A;  3NH8 A;  4A3D I;  1YME A;  1YJ9 1;  3D6W A;  4HGZ A;  5FLM I;  4DGL A;  3T8W A;  1F57 A;  2G9D A;  3WC5 A;  4F9U A;  2AFZ A;  4DQY B;  3BXM A;  3CME 1;  4P44 A;  4ZX8 A;  1QVG Z;  1Q86 1;  1N8R 2;  4R76 A;  2EK8 A;  3SJG A;  1NP6 A;  3CCJ Z;  4MHP A;  3FVL A;  2P3Y A;  3Q87 A;  1K9M 1;  2HF1 A;  3K7A I;  2P28 A;  2OTJ 1;  1PYT B;  2V8D A;  2ZEN A;  3G71 Z;  1RLY A;  1SFO I;  4NOZ A;  3NH5 A;  1Y0R A;  5D8N A;  4CPA A;  4MD8 A;  1Q86 2;  2HU9 A;  4X2T A;  1CBX A;  1XFO A;  2BOA A;  1Q81 1;  4A93 I;  3D68 A;  4P6Y A;  1BPM A;  4ZX9 A;  2QRC B;  2OTJ Z;  2QRE B;  1LQL A;  3VMI A;  3NDI A;  1ARL A;  2ABZ A;  4P4D A;  2JA8 I;  4NBF A;  4RVD A;  2W03 A;  3TE5 B;  2WYR A;  3GUX A;  2RHB A;  3GLJ A;  4E2Z A;  4OID A;  5JH9 A;  3I4M I;  4A3L I;  1AMP A;  3N5F A;  2E2I I;  3KGQ A;  1VIX A;  3GB0 A;  3FH4 A;  1Z02 A;  3FEC A;  1LOK A;  3S2H I;  1LAN A;  3SJF A;  3CD6 Z;  3K2K A;  2GLJ A;  2VF1 A;  4BXX I;  2XEG A;  3F3F C;  4ZY2 A;  2VL1 A;  4P4B A;  2CF4 A;  5LRJ A;  1M1K 2;  4ZI6 A;  2C1C A;  2OOX B;  4A3I I;  2QVP A;  3D67 A;  3ESW A;  2QA4 1;  3RZA A;  5HVH A;  4E31 A;  3D7G A;  1BAV A;  2ZEG A;  3PFO A;  2J6A A;  3IX0 A;  1WCM I;  1YUA A;  3JAM b;  1L1O C;  4WWV A;  3I56 Z;  1VQ8 Z;  1XBU A;  1F2P A;  4R7M A;  1R3N A;  1VQ5 Z;  3KR5 A;  3H8F A;  3M3Y I;  1M90 2;  4A3M I;  1TKJ A;  1VQ7 Z;  3PFE A;  4PXB A;  4Q7A A;  1PCA A;  3H8E A;  3IWW A;  5CBM A;  2LFU A;  4LQG A;  4MRI A;  3D66 A;  2OOT A;  4NB9 A;  1TKH A;  3B3C A;  3WC6 A;  4R6T A;  1QVG Y;  1YJ9 Z;  4DUK A;  2BJO A;  3TX8 A;  1Z03 A;  4RVF A;  3G6E 1;  3CCR Z;  1ELL P;  3GCF A;  1ZB9 A;  3VMH A;  3RZO I;  6CPA A;  1H8L A;  3RZD I;  1YHQ 1;  3CC2 1;  3ISX A;  5LRG A;  2Q51 A;  3CPA A;  2ZAE B;  5JM6 A;  4E2W A;  3MZL B;  3CCU Z;  4NBB A;  3GTL I;  2C6G A;  4E2X A;  2V8G A;  4UIA A;  3CC2 Z;  3HOX I;  2PIY A;  3BI1 A;  2B63 I;  2ZEF A;  2GU2 A;  1VQ9 Z;  4A3C I;  4A3G I;  1QMU A;  2BCO A;  2EK9 A;  1VQ6 Z;  4NGT A;  4UIB A;  1JQG A;  3J80 b;  3J81 f;  3RAM A;  5A2Q f;  3CCU 1;  3S16 I;  4OME A;  1YJW 1;  4OC1 A;  5IB9 A;  1OBR A;  2PJ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...