4NFRA

Human brain aspartoacylase mutant e285a complex with intermediate analog (n-phosphonomethyl-l-aspartate)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
301
structure length
301
Chain Sequence
HIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNAAAYYEKKEAFAKTTKLTLNAKSIRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartoacylase
publication title Aspartoacylase catalytic deficiency as the cause of canavan disease: a structural perspective.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 93
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2013-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4nfrA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4nfrA01
2AFSA 4R8FA 1CX8A 2JEWA 4P4BA 3QNVA 3VH9A 7CPAA 2WZNA 1PCAA 3NA6A 4NFRA 2XEGA 3B3VA 3JRUA 2C6GA 3HUVA 4MHNA 1XRYA 1BPNA 4FWUA 2O53A 3IJ3A 1IGBA 2C1CA 4ZYQA 3D7FA 3NH4A 3B3SA 4UF4A 3WC7A 4MCSA 3PFOA 4DUKA 4P4DA 2FVGA 1Y0RA 2OR4A 4P4IA 1DTDA 2BCOA 4YU9A 1GYTA 1EE3P 2F7VA 4OKOA 3PFEA 2AFMA 2ZEGA 1TF9A 4OC5A 3FVLA 2Q43A 5K8MA 3ISXA 2DEAA 3IO1A 2NSMA 1F57A 3MN8A 2ZEPA 5HVFA 2ZELA 3BHXA 4P44A 4CPAA 4H2KA 1AYEA 4A38A 5HXDA 1ZG8A 2V8GA 2PE3A 3KZWA 1VIXA 2ABZA 2PCUA 3CDXA 4GM5A 3T8WA 4R76A 2AFXA 1XMBA 4NGTA 2ZOFA 1CG2A 1KWMA 3PBEA 3VATA 5K8NA 3BI0A 2BOAA 1YMEA 1XFOA 5THWA 4F9UA 1VGYA 2GLJA 2PVWA 3KL9A 4FUUA 2PJCA 4AXVA 3FF3A 1F2PA 1DE4C 1FT7A 2CTCA 3KI9A 3SI2A 3SI1A 3WC5A 1QQ9A 1LOKA 3PB4X 4P10A 4ZY2A 4NGPA 4P4EA 3S9NA 2AFUA 4O23A 4ZY0A 3GLJA 1M4LA 3FMCA 3CPXA 4EWTA 3B7IA 3FEDA 5IB9A 3SJGA 1H8LA 4OIWA 2ZEDA 1Y0YA 3RBUA 3SI0A 2PJ5A 4IAVA 4W9YA 5J1QA 2VL1A 5D29A 3D7DA 2EWBA 4OC2A 1RTQA 8CPAA 2EK9A 3IWWA 3WT4A 3SJXA 1QMUA 1VHOA 3B3CA 3LMSA 5D8NA 3BXMA 1UWYA 4ZX8A 5LRKA 2PJ8A 3KR5A 1AMPA 3WC6A 3ISZA 3KHXA 1LFWA 2F8HA 5K8OA 4MMOA 1BLLE 3KASA 2C6PA 4NGMA 4PXCA 3S9MA 4OIDA 4WJBA 3CT9A 4JYWA 3DLJA 2ZENA 5DS0A 4G1PA 5LYIA 3I1UA 4UIBA 2Q51A 2PJ9A 3B35A 3RZAA 4EFDA 1TXRA 3NH5A 4NJRA 3D7GA 2ZEOA 2PRQA 5LRGA 4EMEA 4NGRA 3NH8A 1YW6A 2V77A 3V7ZA 4P6YA 4F8ZA 4DYOA 1Z2LA 4ZI6A 3SJEA 1FNOA 4ZX9A 3CPAA 1TF8A 3D7HA 4MHYA 4UIAA 3IFEA 4NJQA 1CBXA 1Z8LA 4IHMA 1F2OA 2ZEMA 3D68A 5CPAA 3FX6A 2PIYA 1HEEA 2J9AA 2JBJA 3D66A 3FEEA 4FAIA 1CP6A 3N5FA 3KGQA 3D4UA 3WABA 3RAMA 3V38A 5LYDA 2QJ8A 3BI1A 4KSIA 4A94A 2PJ2A 4X3RA 4UEZA 4K3NA 5JM6A 1XBUA 2PJ7A 2ZOGA 2V8DA 4OC3A 1ELLP 1ELMP 5JH9A 1ARLA 2OOTA 2ZEEA 3PB9X 3NFZA 5LRJA 1Y7EA 2POKA 2PJ4A 1BAVA 3H8GA 4OC4A 2XEIA 4MHPA 1LANA 2RFHA 1YW4A 1Z5RA 2QVPA 2V8HA 1NSAA 2AFZA 3PEIA 5LYFA 3HLPA 1PYTB 5JGFA 2AFOA 4F9VA 4OC0A 2XEJA 2C6CA 4Z65A 1XJOA 2V8VA 3KQZA 4TNUA 2CIJA 2RB7A 3TX8A 4LQGA 2AFWA 1ZLIA 5K8PA 3K9TA 2PJAA 3PB6X 1LAPA 2GLFA 4NGSA 3S9LA 3B3TA 4P4FA 3LWUA 2EK8A 4PQAA 4MXUA 1R3NA 5F09A 2PJ1A 3PBBA 1YLOA 3DGVA 3FH4A 3IC1A 4PXEA 3KQXA 3PRTA 2CTBA 6CPAA 1CPSA 2ZEHA 4YWYA 1ARMA 3B3WA 3PB7X 2HC9A 4A39A 2ZEFA 4BD9A 3H8FA 2PJ0A 4PPZA 4UEFA 4B6ZA 1IY7A 2ANPA 1CPXA 4PXDA 2PJ3A 1LCPA 1VHEA 4NGQA 3D67A 3GB0A 2G9DA 2IJZA 5LYLA 2O4HA 4TWEA 4OC1A 2QYVA 4R6TA 1Q7LA 2PJ6A 4MRIA 1BPMA 1HDUA 4MCPA 2Q4ZA 4JZ0A 2WYRA 4MCRA 3MRUA 1YSJA 3SJFA 4RUHA 1JQGA 4R7MA 5HVHA 1ZG7A 3IIBA 4PXBA 3VARA 2NYQA 4X2TA 3TC8A 4P4JA 2GREA 4NGNA 3K2KA 2HB6A 2PIZA 4IK2A 4MCQA 4X8IA 5I4MA 1ZLHA 4UEEA 4MHZA 1R43A 2IQ6A 4P45A 4A37A 2JBKA 3KR4A 4ONWA 4DJLA 4OP4A 2PJBA 1CP7A 3PB8X 3FJUA 3H8EA 1OBRA 5CBMA 3GUXA 1TKHA 3KHZA 4WWVA 2CF4A 1LAMA 2IMOA 1HDQA 4ZY1A 4FBEA 5ELYA 3IEHA 2BO9A 2XEFA 2GU2A 4OMEA 2PVVA 3L2NA 5HVGA 2I3CA 1TKFA 1ZG9A 3B2YA 1TKJA 3FECA 4Q7AA
chains in the Genus database with same CATH superfamily
2JMOA 4E33A 3GTLI 2JEWA 3EFAA 4R9MA 4DNCA 3P2FA 1KUXA 1KC82 3JRUA 3DR8A 2AE6A 2CNMA 1IGBA 2C1CA 4ZYQA 4F0XA 5G20A 3NH4A 3B3SA 3CCEZ 2HU9A 1QSTA 1M1DA 1Y0RA 1AUGA 4YU9A 3PGPA 2F7VA 2Q4VA 1YUAA 1VQ41 4NF1A 2VPWA 4Y49B 3IO1A 2PRBA 3ZZIA 4NBGA 2RBLA 3TO9A 2FCKA 2IZ4A 1TFIA 2ZEPA 1VQLZ 2RT9A 4DQYB 1YI2Z 5G22A 2V8GA 2PE3A 1VIXA 2PCUA 4GM5A 3T8WA 3DDDA 2AFXA 2D4PA 1XF8A 2ZOFA 4A3DI 2Q04A 3FIXA 1KWMA 1Q7Y1 1KZFA 3BI0A 1XIXA 1XFOA 3T9YA 5THWA 3FBUA 2PVWA 1VQ61 2PJCA 2KI7B 5IT9b 1I6HI 2LEXA 2CTCA 2ZW7A 1RLYA 1Q821 4ZY2A 1Q811 1Q16A 3S9NA 2AFUA 2B4DA 3GLJA 4GXHA 1M4LA 4A3EI 3W6SA 5IB9A 3GTKI 1WWZA 4OIWA 2J8RA 3OW2Y 1YVKA 2VF1A 4Q38A 4IAVA 4KS9A 2F4OA 4XX2A 2PMZA 2Q0YA 5J1QA 5LL6f 3JAMb 2VL1A 5D29A 3GTQI 3D7DA 2EWBA 2NVXI 1QF8A 1WCMI 3OWCA 2W04A 3IWWA 4KOTA 4AG7A 3WT4A 1M1K2 3SJXA 3GTJI 3G71Z 1K9M2 3LMSA 4ZX8A 2PJ8A 4BBSI 2V3VA 2F8HA 4CYOA 1BLLE 2C6PA 4KZTA 3IU1A 3S9MA 4UFVA 3CT9A 3M4OI 4B13A 3TTHA 3DLJA 1M4DA 2ZENA 5BWAB 4E30A 3RO0A 4KSFA 2DE5A 3RZAA 3TDHB 1VQ91 1Z8XA 2IV2X 4A95A 2ATRA 2AKLA 4JJXA 3NDIA 3BG1B 2A4NA 1TWGI 4ZI6A 3CC71 1KUYA 1LQLA 1VQ5Z 4MHYA 3NE7A 1CBXA 2E2II 4IHMA 5IT9f 4KOWA 4E2ZA 2J9AA 1P4NA 1YJNZ 2JBJA 4A3CI 1QSRA 3N5FA 5H84A 2C27A 4H6ZA 1R57A 2DPTA 2QIRA 2Z10A 2AJ6A 4YFJA 2P28A 4X3RA 2GTHA 4UEZA 3J80b 1XBUA 2ZOGA 4MHDA 2V8DA 4OC3A 3NE8A 1Q861 4OADA 3CCS1 2OOTA 2OTJ1 3JAMf 4KVOE 3SHPA 4RI1A 2FL4A 1Y1WI 3F3FC 4FD7A 1TIQA 2Q7SA 2K5RA 4R87A 4A32A 2RFHA 1Q822 3PO3S 4XPDC 1Z5RA 1USPB 3J81f 2AFZA 3PEIA 2XEJA 4A3MI 1XJOA 5A27A 1YUKA 4CGMA 3KQZA 3MGDA 4XNHB 4OAEA 2ZW5A 1ZH1A 3VMGA 1YJWZ 1UFHA 1ZLIA 5JPHA 1WK4A 3S9LA 1W2BZ 1Z4EA 4P4FA 2KCWA 1VQ4Z 2EK8A 2VEZA 2QR1B 2OH1A 5IX3A 2OOXB 4MXUA 1R3NA 4AVAA 2PJ1A 3PBBA 3DGVA 3P2HA 4KOSA 3ESWA 3KQXA 6CPAA 5AG6A 4YWYA 3B3WA 4A39A 2ZEFA 1VQM1 3H8FA 2Z3KA 4PK2A 4B6ZA 2ANPA 4BY7I 4PXDA 3D67A 2G9DA 2O4HA 4TWEA 5J8CA 1Q7LA 1BPMA 4CAXA 1VQ6Z 5KTDA 3SJFA 2JS4A 3MZKB 1Z9UA 3DNSA 4CGNA 4RVGA 2VUMI 3VARA 5AN9F 2O28A 1S7FA 3HOXI 2ZW4A 4IK2A 2VXKA 4X8IA 2GANA 4UEEA 4L8AA 1R43A 2FT0A 1RO4A 5FLMI 2IQ6A 4P45A 4A37A 4CYPA 2YNCA 2V45A 5D1PA 2PR1A 1KC81 1CP7A 3PB8X 1IYLA 1QVFY 5A28A 3TCVA 4YGOA 1JJ2Z 1VQO1 1S60A 3IEHA 2BO9A 2PVVA 1IOIA 3L2NA 5DWNA 1X10A 4R57A 1L1OC 2YNEA 3B2YA 1NP6A 3FECA 5C4JI 3B8GA 2JEVA 4NXYA 3T90A 1PCAA 4NOZA 4NFRA 3HOVI 4CGLA 1YHQZ 4LX9A 2VZZA 2Z0ZA 3A9LA 4MHNA 1XRYA 4MJ8A 1BPNA 4PSWA 4CRZB 4UFXA 3PFOA 4DUKA 4P4DA 2FVGA 4NB8A 3LUSA 1VQ9Z 1LRZA 5A2Qb 1IU8A 1TWAI 4B12A 2AFMA 1TF9A 4CRYB 4UWJA 2EUIA 2CNTA 2P0WA 2Q43A 2VZYA 5K8MA 2Q7BA 5H86A 2NVYI 1P9NA 3CC7Z 3CXCY 1F57A 5FVJA 4DGLA 5AG7A 2PC1A 4JXRA 4A3KI 2PQ8A 4CAEA 1B87A 2YNDA 4NB9A 4A3FI 3BHXA 2B3VA 4H2KA 1QVGY 4B5PA 1AYEA 2EBJA 4KVME 3CDXA 1Q2CA 3D2MA 1YITZ 4HNWB 1QYPA 2I00A 3VATA 4E8OA 3CCV1 5K8NA 5JQ4A 3CXPA 5CNPA 2GLJA 2QEX1 4FUUA 3FF3A 1FT7A 4NBEA 3KI9A 3SI2A 4RVHA 2VQYA 1S5KA 3PB4X 3CCM1 3CCSZ 1M1K1 5AGEA 3HOUI 4P4EA 1K9M1 4ZY0A 5KTCA 5HH1A 4QTUA 3CPXA 4H6UA 4EWTA 3QWUA 3PO2I 2JDCA 3W6XA 3SI0A 1Z8TA 4W9YA 2R7HA 3QAHA 3F8KA 4E2WA 4CL1A 3I4NI 1RTQA 4KUBA 3TT2A 3KKWA 2OOYB 1YREA 1JWQA 4HH4A 3VTNA 3HOYI 4LQ6A 5D8NA 4U9ZA 2J8MA 3WC6A 3ISZA 2PM9A 2REFA 4L89A 5K8OA 4MMOA 5KTAA 3GTOI 2Q4YA 2FIAA 5A2Qf 4NGMA 4WJBA 2B5GB 4KOYA 2BL1A 2PK7A 1VQMZ 2V8KA 1MK4A 4MFLA 2RPRA 3VB9A 1XOVA 3IX0A 2RC4A 1KQSY 1TWHI 3NH5A 1VQ7Z 3TOAA 4RVFA 2DXQA 3D7GA 2ZEOA 1S3ZA 2JA5I 2V77A 3V7ZA 4F8ZA 3D2PA 3K9UA 2DPSA 2WPWA 4ZX9A 3CPAA 1TF8A 2OU2A 1JWHC 4X6AI 4PV6A 1N71A 2BSWA 3R9GA 3IR7A 3CCU1 4NJQA 4RVDA 1Z8LA 4AB7A 2ZEMA 3S15I 2JA7I 2PIYA 3FX6A 4KOXA 2R1IA 1K4JA 1Y9KA 3WABA 3TO6A 5LYDA 1YGHA 3BI1A 3CXSA 2WPXA 1VQOZ 3K7AI 5JM6A 2G2KA 2PJ7A 5C88A 3FRMA 1ELLP 1ELMP 2WSAA 4PSXA 1X0TA 1IB1E 1KD12 1A2ZA 4E32A 4C2ZA 1YX0A 3PP9A 4FD5A 3OW2Z 3KIFA 2GE3A 3H8GA 4MFKA 4OC4A 4KSAA 4MHPA 4YRHA 4C68A 1YW4A 3LACA 2V8HA 1L0CA 1NSAA 3J81b 2AFOA 4Q36A 4Y49C 2R92I 4Z65A 2V8VA 3F3PC 2Z3OA 3S17I 4TNUA 4JLYA 4A2ZA 4BBRI 1RXTA 4FD6A 2AFWA 3K9TA 4A30A 3CC41 2PJAA 1MJBA 3S2HI 3PZJA 1BOBA 4NGSA 3P5JB 4NSQA 1OZPA 2FSRA 2QLVB 3RZDI 4UCMA 1IICA 4C2YA 1YIJ1 4PXEA 4XPKA 3QAYA 2CTBA 1CPSA 2QREB 3FQQA 3T4NB 2ZEHA 3PB7X 3I561 4BD9A 4QBJA 1IY7A 1CPXA 1LCPA 2FXFA 1ML8A 4NGQA 5AG4A 3CXQA 4NBCA 2DE6A 1CJWA 3J7A4 3GB0A 4BBHA 1QSNA 5AG5A 4OC1A 1J4JA 3CCVZ 2JLMA 4R6TA 2PJ6A 3U50C 4AYBA 4MCPA 2EGTA 4JZ0A 2CNSA 3CMA1 3GTPI 1NE9A 4BXXI 4M3SA 2GFQA 3CCMZ 2NYQA 3IF8A 2GREA 2CXAA 2H85A 4F0YA 3K2KA 2PIZA 4RN7A 2P6EA 4HNXB 2M48A 4ONWA 4NH1C 4OP4A 4MD8A 5IB0A 4RV9A 1P0HA 1VQP1 3GUXA 3KHZA 5F48A 1USPA 2CF4A 1V0CA 2LFUA 4FBEA 2LIYA 2XEFA 3H3VJ 4Q7AA 4KUAA 4P4BA 3IWEA 1SIWA 2JR6A 3VH9A 7CPAA 3NA6A 1S7MA 3G6E1 2IZ3A 1YR0A 3R95A 4A33A 1SQHA 2G3AA 3IJ3A 4M6IA 4MCSA 4U9YA 3TOBA 2JIOA 2OR4A 4QVTA 2E2HI 4GS4A 2FE7A 1EE3P 4OKOA 2BJOA 4BMHA 3S6HA 2ODFA 2HQYA 3ISXA 2DEAA 4U5YA 2Q44A 2V8IA 5DWMA 1Z4RA 4QC6A 2PDOA 3S2DI 3MN8A 4ORFA 3EERA 2ZELA 3CCUZ 2JA6I 4CPAA 4KOUA 4A38A 5HXDA 1ZG8A 3IWGA 1QSMA 2VPYA 3FB3A 4NGTA 3DR6A 4CS0B 4X5KA 3PBEA 1R9TI 3CPWY 4CGOA 2B4BA 2BOAA 4HKFA 4F9UA 2E9HA 5E96A 1VGYA 3DSBA 3KL9A 3R9EA 2F5IA 3W91A 1QQ9A 1LOKA 4CAFA 2X7BA 4P10A 4NGPA 4K30A 4KVXA 3LODA 3D9XA 4O23A 2D4OA 2P3YA 4XNHC 3BLNA 1PFTA 2JNYA 1VQ81 2JUBA 1QVFZ 3FEDA 3SJGA 1H8LA 2WUUA 1B6BA 3FYNA 3RBUA 3GTMS 4MD7A 2PJ5A 2KPIA 2ARHA 2EK9A 3I551 5C82A 4Y7NI 1VLAA 2REEA 1ZO0A 3CC4Z 2NVQI 3B3CA 3BXMA 3CCJ1 2R93I 1K8A2 3D6WA 2E7ZA 1Y1VI 1AMPA 4AG9A 3KHXA 3M3YI 1LFWA 5FLXb 3G3SA 4HGYA 4PXCA 3H5ZA 4OIDA 4IUSA 1ZB8A 3CME1 4JYWA 3I07A 2JIPA 1I1DA 4S1TA 1FY7A 5DS0A 3I1UA 3FNCA 1N8R2 2Q51A 4NCZA 1S7LA 1Q2DA 2DE7A 4EFDA 2BUEA 1TXRA 4IF5A 3CXCZ 2QKDA 2WB1A 4KOVA 1WJ2A 3GTGI 4EMEA 4NGRA 3NH8A 5C3EI 1YW6A 4P6YA 3S1RI 4CAWA 1QVGZ 2K3RA 4DYOA 2I79A 3SJEA 1FNOA 4UA3A 4NEXA 2YNCC 1YJ91 4AVBA 5ISVA 1KD11 4UIAA 1NSLA 4II9A 2OTL1 3S6GA 1F2OA 1X3ZA 3D68A 5IV0A 2R8VA 3G4S1 4B11A 2JIQA 3FEEA 1SFOI 4FAIA 3CQZI 1M902 5C4XI 1CP6A 4UFWA 3GKRA 2YU9I 1VQPZ 1S721 2OTJZ 3RAMA 2QJ8A 1X12A 2YADA 4LUAA 5D1OB 2PJ2A 2IL4A 1VHSA 4A31A 2K5TA 4QUSA 5T6BA 1YJN1 4A3II 3GTMI 2B3UA 5JH9A 1ARLA 2ZEEA 3PB9X 4A3JI 2G3TA 1Y7EA 2POKA 4C2XA 3BJ7A 3TO7A 3UY5A 1BAVA 3C26A 2XEIA 1LANA 4A3LI 4CAVA 1NJI1 3EEDA 2EO8A 1TWCI 3S1MI 1VQN1 2B5GA 3RYOA 4NBBA 2QRDB 1Z01A 5FLXf 2OZGA 5T67A 5K8PA 4XPLA 2GLFA 1CM0A 1RNIA 4A3BI 4NBAA 4E2XA 2QA41 4MONA 3TE4A 1YLOA 3FH4A 3PRTA 1YJW1 3I3GA 2JIRA 1KQSZ 4Y52I 2HC9A 4E0AA 2HV2A 3CD61 4UEFA 4MBUA 4KORA 2ZXVA 1TWFI 1GHEA 2PJ3A 1VHEA 1K83I 3LD2A 3S1NI 3NDJA 1XE4A 1MJ9A 4MRIA 2B58A 1HDUA 2Q4ZA 2WYRA 4MCRA 3MRUA 1YSJA 2FIWA 1JQGA 4R7MA 2VI7A 4PXBA 1I21A 3JTKA 4X2TA 4MI4A 4M6GA 1ZB9A 1VQK1 3TFYA 2RIQA 4M85A 4JXQA 1K732 1QSOA 4E2AA 1VQ8Z 4UCNA 1Z02A 4DJLA 2PJBA 5F49A 3CCR1 3FJUA 4M6HA 1XEBA 3H8EA 4OLLA 5CBMA 1TKHA 5CM2M 4UCPA 2OB0A 1LAMA 2IMOA 4B14A 3MZLB 3I55Z 1X3WA 3GY9A 1ON0A 3S1QI 2B4DB 1I12A 1TKFA 1ZG9A 3V8IA 2AFSA 4R8FA 1CX8A 3CCJZ 2VPZA 2OZKA 3SXNA 3QNVA 2WZNA 4CYNA 4BY1I 2F4MA 3R96A 2XEGA 4MFQA 3B3VA 2C6GA 3HUVA 1YQEA 2NAPA 1I3QI 3MONA 3CMEZ 4FWUA 2O53A 1NMTA 1AA6A 3D7FA 4UF4A 3WC7A 1NJI2 3CCQ1 3N7ZA 1YHQ1 3IU2A 4P4IA 2JDDA 1DTDA 2BCOA 3I9SA 3H4QA 1GYTA 4I49A 1FDIA 4XPDB 1KRLA 3PFEA 2ZEGA 4OC5A 3FVLA 4ZBGA 1WIIA 4KLVA 4RS2A 2NSMA 1YJ9Z 2B63I 2QMLA 4B5OA 4R3LA 2Z3PA 2OTLZ 5HVFA 2VBQA 3JUWA 4P44A 2QEXZ 4CGPA 4MY0A 3FQMA 3KZWA 3CC21 3G4SZ 2ABZA 4R76A 1XMBA 4HPSA 2Y0SA 3RZOI 1CG2A 3GIUA 4HGZA 1M4IA 2Z3NA 1S72Z 2R7ZI 2ZAEB 2PR8A 1YMEA 2Z3LA 2Z3MA 4AXVA 1F2PA 1DE4C 4JWPA 3SI1A 3CCL1 4F6AA 3IFUA 3WC5A 4B10A 1YIT1 2VUGA 2OZHA 2ZPAA 4NBDA 1RO0A 3TE5B 1N2FA 1K8A1 1Z8WA 1IIDA 3HOZI 3D3SA 3FMCA 1M44A 3B7IA 4KLWA 2G0BA 3GKQA 5EC4A 2ZEDA 1Y0YA 1S7NA 4MFZA 1Q7Y2 4H89A 3KIHA 1YLEA 3H0GI 1WZNA 2GTIA 5GCNA 1VQNZ 3VWDA 4EVYA 2HUZA 3F0AA 4OC2A 1YVOA 5G1ZA 8CPAA 2GIVA 1RO2A 1N8R1 2PSWA 2W03A 2R98A 2EVNA 4MH4A 5F46A 1Q812 1U6MA 2V8JA 4MD9A 3FXTA 1QMUA 1VHOA 3D2LA 2R6MA 1UWYA 5LRKA 3EXNA 4E31A 3KR5A 1Y1VS 2QA4Z 2J8NA 1VKCA 3EO4A 2RHBA 3KASA 2QECA 2HF1A 1W2BY 2DF5A 3QB8A 1XMTA 1IOFA 4R3KA 4MFPA 4NBFA 3CD6Z 2VPXA 5IP7I 2BEIA 4G1PA 5LYIA 4UBRA 4UIBA 3CCE1 4C7IA 1DL6A 2PJ9A 3B35A 4FD4A 1NUIA 3I4MI 5EBVA 1M901 4NJRA 1PU9A 4UWIA 2PRQA 5LRGA 1BO4A 3F5BA 4C7HA 2OZUA 1Z2LA 1Z03A 4MFJA 5T64A 1VQ71 3D7HA 3E0KA 1VQKZ 3JVNA 1VQL1 3IFEA 1YI21 3CPWZ 5CPAA 4E2YA 3ZJ0A 5HMNA 2WAQA 1HEEA 4HNYB 3D66A 3FKII 1S7KA 3R9FA 3CCRZ 3S6KA 3KGQA 3D4UA 3V38A 4KSIA 4A94A 2QRCB 3J80f 1Y7RA 2M6NA 5I0CA 4K3NA 3HOWI 3RNZA 3G8WA 3NFZA 5LRJA 1JJ2Y 1Y9WA 3HKZA 2PJ4A 3CZXA 2NMTA 3S16I 4BINA 3PO3I 1PUAA 3GYAA 2E2JI 1KUVA 1Y8CA 2QVPA 1M4GA 5LYFA 3HLPA 1PYTB 3VMIA 5JGFA 2AYDA 5G21A 4F9VA 4OC0A 2C6CA 5IP9I 3WR7A 2CIJA 2RB7A 2YGWA 1YIJZ 3CCQZ 3TX8A 1Q862 4LQGA 3PB6X 1LAPA 3G711 1MJAA 3B3TA 2P6GA 4DK1A 3LWUA 3I56Z 4PQAA 2JA8I 3EY5A 1RQFA 5F09A 2Y0MA 2H5MA 3IC1A 3R1KA 3Q87A 2CY2A 3VWEA 3BG0B 1YK3A 1ARMA 4ONUA 2J6AA 4JD6A 5F47A 3CMAZ 1K731 3EC4A 2PJ0A 4PPZA 3CC2Z 5J8FA 4QTTA 2IJZA 5LYLA 4CYQA 2QYVA 3BJ8A 2Z11A 4NBHA 1I50I 4A3GI 1QXFA 3D8PA 4J3GA 4PK3A 4RUHA 3CCLZ 3GCFA 2JIMA 5HVHA 1ZG7A 3IIBA 3SXOA 5D1OA 1WW9A 4MY3A 4P4JA 3TC8A 4B5PB 4NGNA 4A93I 1VQ51 3IGRA 4RS4A 2HB6A 4MCQA 5I4MA 1FDOA 1IYKA 1ZLHA 4ZGYB 4MHZA 2FS5A 3VMHA 2JBKA 3KR4A 1RO5A 2P6FA 4EWCA 1OBRA 2NVTI 4WWVA 3S14I 4AVCA 1Q2YA 4QB9A 1HDQA 4ZY1A 2ZW6A 3G6EZ 5ELYA 2GU2A 4OMEA 5EMIA 5HVGA 5C44I 2I3CA 1TKJA 3S6FA
chains in the Genus database with same CATH topology
2AFSA 4R8FA 1CX8A 2JMOA 3CCJZ 4E33A 5C4JI 3GTLI 2JEWA 2OZKA 4P4BA 2JR6A 3QNVA 3VH9A 7CPAA 2WZNA 1PCAA 3NA6A 1S7MA 3G6E1 2IZ3A 4NOZA 4NFRA 4BY1I 3HOVI 2F4MA 2XEGA 1YHQZ 1KC82 3B3VA 2C6GA 3JRUA 3HUVA 4MHNA 1XRYA 1BPNA 3MONA 1I3QI 3CMEZ 4FWUA 2O53A 3IJ3A 1IGBA 2C1CA 4ZYQA 3D7FA 3NH4A 3B3SA 4UF4A 3WC7A 4MCSA 3CCEZ 2HU9A 3PFOA 4DUKA 4P4DA 2FVGA 1Y0RA 1NJI2 3CCQ1 4NB8A 1YHQ1 2OR4A 4P4IA 3LUSA 1VQ9Z 1DTDA 2BCOA 2E2HI 5A2Qb 4YU9A 1TWAI 1GYTA 1EE3P 2F7VA 4OKOA 1KRLA 2BJOA 1TKJA 1YUAA 3PFEA 2AFMA 2ZEGA 1TF9A 1VQ41 4OC5A 3FVLA 2Q43A 1WIIA 5K8MA 3ISXA 2DEAA 2NVYI 2V8IA 1P9NA 3IO1A 3CC7Z 2NSMA 3CXCY 1F57A 4NBGA 2RBLA 4DGLA 1YJ9Z 2B63I 3S2DI 4A3KI 3MN8A 2IZ4A 1TFIA 3EERA 1VQLZ 2OTLZ 2RT9A 2ZEPA 2ZELA 5HVFA 3CCUZ 4NB9A 4A3FI 4DQYB 3BHXA 1YI2Z 2JA6I 4P44A 4H2KA 4CPAA 1QVGY 2QEXZ 1AYEA 4A38A 5HXDA 1ZG8A 2V8GA 3FQMA 2PE3A 3KZWA 3CC21 3G4SZ 1VIXA 2ABZA 2PCUA 3CDXA 4GM5A 3T8WA 4R76A 2AFXA 1XMBA 4NGTA 2Y0SA 2ZOFA 3RZOI 1YITZ 4A3DI 1CG2A 1KWMA 1QYPA 4HGZA 3PBEA 3VATA 1R9TI 1Q7Y1 3CPWY 3CCV1 5K8NA 1S72Z 3BI0A 2R7ZI 2BOAA 2ZAEB 1YMEA 1XFOA 5THWA 4F9UA 2E9HA 1VGYA 2GLJA 2PVWA 3KL9A 1VQ61 2QEX1 4FUUA 2PJCA 2KI7B 5IT9b 4AXVA 1I6HI 3FF3A 1F2PA 1DE4C 1FT7A 2CTCA 4NJQA 4NBEA 3KI9A 3SI2A 3SI1A 3CCL1 3IFUA 4RVHA 3WC5A 1RLYA 1QQ9A 1LOKA 1YIT1 2VUGA 3PB4X 3CCM1 1Q821 3CCSZ 1M1K1 4P10A 4ZY2A 4NBDA 1Q811 3HOUI 4NGPA 4P4EA 3S9NA 1RO0A 3TE5B 2AFUA 3D9XA 4O23A 1N2FA 1K9M1 4ZY0A 2P3YA 3GLJA 1K8A1 4QTUA 1M4LA 1PFTA 2JNYA 3HOZI 3FMCA 1VQ81 3CPXA 2JUBA 4EWTA 3B7IA 3QWUA 4A3EI 1QVFZ 3FEDA 5IB9A 3GTKI 3SJGA 1H8LA 3PO2I 4OIWA 3GKQA 2ZEDA 1Y0YA 3RBUA 3OW2Y 1Q7Y2 3KIHA 3GTMS 2VF1A 4MD7A 3SI0A 3H0GI 2PJ5A 4IAVA 2F4OA 2GTIA 4XX2A 2PMZA 4W9YA 5J1QA 5LL6f 2KPIA 3JAMb 1VQNZ 2VL1A 3GTQI 5D29A 3D7DA 4E2WA 2EWBA 4CL1A 3I4NI 4OC2A 2NVXI 1RTQA 8CPAA 1QF8A 2EK9A 1WCMI 1RO2A 2OOYB 3I551 1N8R1 2W03A 2W04A 3IWWA 4Y7NI 4MH4A 1VLAA 4HH4A 3WT4A 1M1K2 3CC4Z 1Q812 3VTNA 3SJXA 2NVQI 2V8JA 4MD9A 3GTJI 3HOYI 1QMUA 3G71Z 1VHOA 1K9M2 3B3CA 3LMSA 5D8NA 3BXMA 2R6MA 1UWYA 3CCJ1 2R93I 4ZX8A 1K8A2 5LRKA 3D6WA 1Y1VI 2PJ8A 4E31A 3KR5A 1AMPA 1Y1VS 2QA4Z 3WC6A 4BBSI 3ISZA 3KHXA 2PM9A 3M3YI 1LFWA 2F8HA 5K8OA 4MMOA 2RHBA 1BLLE 3KASA 2C6PA 5FLXb 2HF1A 3GTOI 1W2BY 4HGYA 5A2Qf 4NGMA 4PXCA 3S9MA 4OIDA 4WJBA 3CT9A 1ZB8A 3CME1 4JYWA 3M4OI 3I07A 4S1TA 2PK7A 1VQMZ 2V8KA 4NBFA 3DLJA 3CD6Z 2ZENA 5DS0A 5IP7I 4G1PA 3I1UA 5LYIA 4E30A 1N8R2 4UIBA 2RPRA 3VB9A 3CCE1 2Q51A 3IX0A 1DL6A 2PJ9A 1KQSY 2DE5A 3B35A 1TWHI 1NUIA 2DE7A 3TDHB 3I4MI 3RZAA 1TXRA 3NH5A 1VQ7Z 1VQ91 4EFDA 1M901 4NJRA 4RVFA 3CXCZ 3D7GA 2ZEOA 2QKDA 2WB1A 2PRQA 2AKLA 3GTGI 5LRGA 4EMEA 4NGRA 3NDIA 3NH8A 5C3EI 2JA5I 1YW6A 2V77A 3BG1B 4P6YA 3V7ZA 4F8ZA 1TWGI 3S1RI 1QVGZ 2K3RA 4DYOA 1Z2LA 4ZI6A 1Z03A 3CC71 3SJEA 1FNOA 5T64A 4ZX9A 3CPAA 1TF8A 1LQLA 1YJ91 1VQ71 3D7HA 1VQ5Z 1JWHC 1VQKZ 4X6AI 1KD11 4MHYA 4UIAA 2OTL1 1VQL1 3CCU1 3IFEA 4RVDA 1YI21 1CBXA 3CPWZ 2E2II 1Z8LA 1F2OA 2ZEMA 1X3ZA 5IT9f 4IHMA 3D68A 5CPAA 3S15I 4E2YA 2JA7I 2PIYA 3FX6A 2WAQA 4E2ZA 3G4S1 1HEEA 2J9AA 1YJNZ 2JBJA 3D66A 3FEEA 3FKII 1SFOI 4FAIA 3CQZI 3CCRZ 4A3CI 1M902 5C4XI 1CP6A 3N5FA 3KGQA 3D4UA 3WABA 2YU9I 1VQPZ 1S721 2OTJZ 3RAMA 3V38A 5LYDA 2QJ8A 3BI1A 4KSIA 4A94A 2YADA 5D1OB 2PJ2A 2P28A 2QRCB 4X3RA 2GTHA 1VQOZ 3J80f 3K7AI 2M6NA 4UEZA 5T6BA 3J80b 4K3NA 5JM6A 2G2KA 3HOWI 1XBUA 2PJ7A 2ZOGA 2V8DA 1YJN1 4OC3A 1ELLP 1ELMP 4A3II 3GTMI 1X0TA 1Q861 5JH9A 3CCS1 1KD12 1ARLA 4E32A 2OOTA 2ZEEA 3PB9X 3NFZA 2OTJ1 3JAMf 4A3JI 5LRJA 3OW2Z 1JJ2Y 1Y1WI 1Y7EA 2POKA 3KIFA 3F3FC 3HKZA 2PJ4A 1BAVA 3H8GA 4OC4A 2K5RA 2XEIA 4MHPA 3S16I 1LANA 4A3LI 3PO3I 2RFHA 1NJI1 1Q822 2E2JI 3PO3S 1YW4A 1Z5RA 2QVPA 1USPB 2V8HA 3EEDA 3J81f 1NSAA 2AFZA 3PEIA 5LYFA 3HLPA 1PYTB 3VMIA 5JGFA 3J81b 2AFOA 4F9VA 4OC0A 1TWCI 3S1MI 2XEJA 4A3MI 2R92I 1VQN1 2C6CA 4Z65A 1XJOA 5IP9I 2V8VA 1YUKA 3F3PC 3KQZA 4NBBA 2QRDB 4TNUA 3S17I 2CIJA 1Z01A 2RB7A 5FLXf 1YIJZ 3CCQZ 1ZH1A 3TX8A 3VMGA 4BBRI 1Q862 1YJWZ 4LQGA 2AFWA 5T67A 1ZLIA 5K8PA 3K9TA 3CC41 2PJAA 3PB6X 1LAPA 3S2HI 2GLFA 3G711 4NGSA 3P5JB 1RNIA 3S9LA 1W2BZ 3B3TA 4P4FA 4DK1A 3LWUA 1VQ4Z 2EK8A 3I56Z 2QLVB 2QR1B 4A3BI 3RZDI 4PQAA 4NBAA 2OOXB 4E2XA 2QA41 1RQFA 4MONA 4MXUA 2JA8I 1R3NA 5F09A 2PJ1A 3PBBA 1YLOA 3DGVA 3FH4A 3IC1A 1YIJ1 3Q87A 3ESWA 4PXEA 3KQXA 3PRTA 1YJW1 2CTBA 6CPAA 1CPSA 2QREB 3FQQA 1KQSZ 3BG0B 3T4NB 4Y52I 2ZEHA 4YWYA 1ARMA 3B3WA 3PB7X 2HC9A 4A39A 2ZEFA 2J6AA 3I561 1VQM1 4BD9A 3H8FA 3CMAZ 1K731 2PJ0A 3CD61 4PPZA 4UEFA 4B6ZA 3CC2Z 1TWFI 1IY7A 2ANPA 1CPXA 4BY7I 4PXDA 2PJ3A 1LCPA 1VHEA 1ML8A 4QTTA 4NGQA 4NBCA 2DE6A 3D67A 1K83I 3J7A4 2G9DA 3GB0A 3S1NI 2IJZA 3NDJA 2O4HA 4TWEA 5LYLA 4OC1A 3CCVZ 2QYVA 4R6TA 1Q7LA 2PJ6A 4NBHA 3U50C 4MRIA 1BPMA 4AYBA 1HDUA 4MCPA 2EGTA 2Q4ZA 4JZ0A 2WYRA 1VQ6Z 4MCRA 1I50I 3MRUA 4A3GI 1YSJA 3SJFA 3CMA1 3GTPI 2JS4A 3MZKB 4BXXI 4RUHA 3CCLZ 1JQGA 4R7MA 3GCFA 4RVGA 5HVHA 1ZG7A 3IIBA 2VUMI 4PXBA 5D1OA 3VARA 1WW9A 3CCMZ 5AN9F 2NYQA 4X2TA 3TC8A 3IF8A 2GREA 4P4JA 4NGNA 4A93I 1ZB9A 1VQ51 2H85A 4RS4A 1VQK1 3K2KA 3HOXI 2HB6A 2PIZA 2RIQA 4IK2A 4MCQA 4X8IA 5I4MA 1K732 1ZLHA 4UEEA 1VQ8Z 4MHZA 1R43A 1RO4A 3VMHA 5FLMI 2IQ6A 4P45A 4A37A 1Z02A 2JBKA 2M48A 3KR4A 4ONWA 4DJLA 5D1PA 4NH1C 4OP4A 2PJBA 3CCR1 1KC81 1CP7A 3PB8X 4MD8A 4RV9A 4EWCA 3FJUA 1VQP1 3H8EA 1OBRA 5CBMA 3GUXA 2NVTI 1QVFY 1TKHA 3KHZA 5CM2M 4WWVA 1USPA 3S14I 2CF4A 1LAMA 2IMOA 3MZLB 1HDQA 4ZY1A 2LFUA 1JJ2Z 4FBEA 1VQO1 3G6EZ 3I55Z 1X3WA 2LIYA 5ELYA 3IEHA 2BO9A 2XEFA 2GU2A 4OMEA 2PVVA 3S1QI 3L2NA 5HVGA 5C44I 2I3CA 3H3VJ 1TKFA 1ZG9A 1L1OC 3B2YA 1NP6A 3FECA 4Q7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AFS A;  4R8F A;  1CX8 A;  2JEW A;  4P4B A;  3QNV A;  3VH9 A;  7CPA A;  2WZN A;  1PCA A;  3NA6 A;  4NFR A;  2XEG A;  3B3V A;  3JRU A;  2C6G A;  3HUV A;  4MHN A;  1XRY A;  1BPN A;  4FWU A;  2O53 A;  3IJ3 A;  1IGB A;  2C1C A;  4ZYQ A;  3D7F A;  3NH4 A;  3B3S A;  4UF4 A;  3WC7 A;  4MCS A;  3PFO A;  4DUK A;  4P4D A;  2FVG A;  1Y0R A;  2OR4 A;  4P4I A;  1DTD A;  2BCO A;  4YU9 A;  1GYT A;  1EE3 P;  2F7V A;  4OKO A;  3PFE A;  2AFM A;  2ZEG A;  1TF9 A;  4OC5 A;  3FVL A;  2Q43 A;  5K8M A;  3ISX A;  2DEA A;  3IO1 A;  2NSM A;  1F57 A;  3MN8 A;  2ZEP A;  5HVF A;  2ZEL A;  3BHX A;  4P44 A;  4CPA A;  4H2K A;  1AYE A;  4A38 A;  5HXD A;  1ZG8 A;  2V8G A;  2PE3 A;  3KZW A;  1VIX A;  2ABZ A;  2PCU A;  3CDX A;  4GM5 A;  3T8W A;  4R76 A;  2AFX A;  1XMB A;  4NGT A;  2ZOF A;  1CG2 A;  1KWM A;  3PBE A;  3VAT A;  5K8N A;  3BI0 A;  2BOA A;  1YME A;  1XFO A;  5THW A;  4F9U A;  1VGY A;  2GLJ A;  2PVW A;  3KL9 A;  4FUU A;  2PJC A;  4AXV A;  3FF3 A;  1F2P A;  1DE4 C;  1FT7 A;  2CTC A;  3KI9 A;  3SI2 A;  3SI1 A;  3WC5 A;  1QQ9 A;  1LOK A;  3PB4 X;  4P10 A;  4ZY2 A;  4NGP A;  4P4E A;  3S9N A;  2AFU A;  4O23 A;  4ZY0 A;  3GLJ A;  1M4L A;  3FMC A;  3CPX A;  4EWT A;  3B7I A;  3FED A;  5IB9 A;  3SJG A;  1H8L A;  4OIW A;  2ZED A;  1Y0Y A;  3RBU A;  3SI0 A;  2PJ5 A;  4IAV A;  4W9Y A;  5J1Q A;  2VL1 A;  5D29 A;  3D7D A;  2EWB A;  4OC2 A;  1RTQ A;  8CPA A;  2EK9 A;  3IWW A;  3WT4 A;  3SJX A;  1QMU A;  1VHO A;  3B3C A;  3LMS A;  5D8N A;  3BXM A;  1UWY A;  4ZX8 A;  5LRK A;  2PJ8 A;  3KR5 A;  1AMP A;  3WC6 A;  3ISZ A;  3KHX A;  1LFW A;  2F8H A;  5K8O A;  4MMO A;  1BLL E;  3KAS A;  2C6P A;  4NGM A;  4PXC A;  3S9M A;  4OID A;  4WJB A;  3CT9 A;  4JYW A;  3DLJ A;  2ZEN A;  5DS0 A;  4G1P A;  5LYI A;  3I1U A;  4UIB A;  2Q51 A;  2PJ9 A;  3B35 A;  3RZA A;  4EFD A;  1TXR A;  3NH5 A;  4NJR A;  3D7G A;  2ZEO A;  2PRQ A;  5LRG A;  4EME A;  4NGR A;  3NH8 A;  1YW6 A;  2V77 A;  3V7Z A;  4P6Y A;  4F8Z A;  4DYO A;  1Z2L A;  4ZI6 A;  3SJE A;  1FNO A;  4ZX9 A;  3CPA A;  1TF8 A;  3D7H A;  4MHY A;  4UIA A;  3IFE A;  4NJQ A;  1CBX A;  1Z8L A;  4IHM A;  1F2O A;  2ZEM A;  3D68 A;  5CPA A;  3FX6 A;  2PIY A;  1HEE A;  2J9A A;  2JBJ A;  3D66 A;  3FEE A;  4FAI A;  1CP6 A;  3N5F A;  3KGQ A;  3D4U A;  3WAB A;  3RAM A;  3V38 A;  5LYD A;  2QJ8 A;  3BI1 A;  4KSI A;  4A94 A;  2PJ2 A;  4X3R A;  4UEZ A;  4K3N A;  5JM6 A;  1XBU A;  2PJ7 A;  2ZOG A;  2V8D A;  4OC3 A;  1ELL P;  1ELM P;  5JH9 A;  1ARL A;  2OOT A;  2ZEE A;  3PB9 X;  3NFZ A;  5LRJ A;  1Y7E A;  2POK A;  2PJ4 A;  1BAV A;  3H8G A;  4OC4 A;  2XEI A;  4MHP A;  1LAN A;  2RFH A;  1YW4 A;  1Z5R A;  2QVP A;  2V8H A;  1NSA A;  2AFZ A;  3PEI A;  5LYF A;  3HLP A;  1PYT B;  5JGF A;  2AFO A;  4F9V A;  4OC0 A;  2XEJ A;  2C6C A;  4Z65 A;  1XJO A;  2V8V A;  3KQZ A;  4TNU A;  2CIJ A;  2RB7 A;  3TX8 A;  4LQG A;  2AFW A;  1ZLI A;  5K8P A;  3K9T A;  2PJA A;  3PB6 X;  1LAP A;  2GLF A;  4NGS A;  3S9L A;  3B3T A;  4P4F A;  3LWU A;  2EK8 A;  4PQA A;  4MXU A;  1R3N A;  5F09 A;  2PJ1 A;  3PBB A;  1YLO A;  3DGV A;  3FH4 A;  3IC1 A;  4PXE A;  3KQX A;  3PRT A;  2CTB A;  6CPA A;  1CPS A;  2ZEH A;  4YWY A;  1ARM A;  3B3W A;  3PB7 X;  2HC9 A;  4A39 A;  2ZEF A;  4BD9 A;  3H8F A;  2PJ0 A;  4PPZ A;  4UEF A;  4B6Z A;  1IY7 A;  2ANP A;  1CPX A;  4PXD A;  2PJ3 A;  1LCP A;  1VHE A;  4NGQ A;  3D67 A;  3GB0 A;  2G9D A;  2IJZ A;  5LYL A;  2O4H A;  4TWE A;  4OC1 A;  2QYV A;  4R6T A;  1Q7L A;  2PJ6 A;  4MRI A;  1BPM A;  1HDU A;  4MCP A;  2Q4Z A;  4JZ0 A;  2WYR A;  4MCR A;  3MRU A;  1YSJ A;  3SJF A;  4RUH A;  1JQG A;  4R7M A;  5HVH A;  1ZG7 A;  3IIB A;  4PXB A;  3VAR A;  2NYQ A;  4X2T A;  3TC8 A;  4P4J A;  2GRE A;  4NGN A;  3K2K A;  2HB6 A;  2PIZ A;  4IK2 A;  4MCQ A;  4X8I A;  5I4M A;  1ZLH A;  4UEE A;  4MHZ A;  1R43 A;  2IQ6 A;  4P45 A;  4A37 A;  2JBK A;  3KR4 A;  4ONW A;  4DJL A;  4OP4 A;  2PJB A;  1CP7 A;  3PB8 X;  3FJU A;  3H8E A;  1OBR A;  5CBM A;  3GUX A;  1TKH A;  3KHZ A;  4WWV A;  2CF4 A;  1LAM A;  2IMO A;  1HDQ A;  4ZY1 A;  4FBE A;  5ELY A;  3IEH A;  2BO9 A;  2XEF A;  2GU2 A;  4OME A;  2PVV A;  3L2N A;  5HVG A;  2I3C A;  1TKF A;  1ZG9 A;  3B2Y A;  1TKJ A;  3FEC A;  4Q7A A; 
#chains in the Genus database with same CATH topology
 2JMO A;  4E33 A;  3GTL I;  2JEW A;  3EFA A;  4R9M A;  4DNC A;  3P2F A;  1KUX A;  1KC8 2;  3JRU A;  3DR8 A;  2AE6 A;  2CNM A;  1IGB A;  2C1C A;  4ZYQ A;  4F0X A;  5G20 A;  3NH4 A;  3B3S A;  3CCE Z;  2HU9 A;  1QST A;  1M1D A;  1Y0R A;  1AUG A;  4YU9 A;  3PGP A;  2F7V A;  2Q4V A;  1YUA A;  1VQ4 1;  4NF1 A;  2VPW A;  4Y49 B;  3IO1 A;  2PRB A;  3ZZI A;  4NBG A;  2RBL A;  3TO9 A;  2FCK A;  2IZ4 A;  1TFI A;  2ZEP A;  1VQL Z;  2RT9 A;  4DQY B;  1YI2 Z;  5G22 A;  2V8G A;  2PE3 A;  1VIX A;  2PCU A;  4GM5 A;  3T8W A;  3DDD A;  2AFX A;  2D4P A;  1XF8 A;  2ZOF A;  4A3D I;  2Q04 A;  3FIX A;  1KWM A;  1Q7Y 1;  1KZF A;  3BI0 A;  1XIX A;  1XFO A;  3T9Y A;  5THW A;  3FBU A;  2PVW A;  1VQ6 1;  2PJC A;  2KI7 B;  5IT9 b;  1I6H I;  2LEX A;  2CTC A;  2ZW7 A;  1RLY A;  1Q82 1;  4ZY2 A;  1Q81 1;  1Q16 A;  3S9N A;  2AFU A;  2B4D A;  3GLJ A;  4GXH A;  1M4L A;  4A3E I;  3W6S A;  5IB9 A;  3GTK I;  1WWZ A;  4OIW A;  2J8R A;  3OW2 Y;  1YVK A;  2VF1 A;  4Q38 A;  4IAV A;  4KS9 A;  2F4O A;  4XX2 A;  2PMZ A;  2Q0Y A;  5J1Q A;  5LL6 f;  3JAM b;  2VL1 A;  5D29 A;  3GTQ I;  3D7D A;  2EWB A;  2NVX I;  1QF8 A;  1WCM I;  3OWC A;  2W04 A;  3IWW A;  4KOT A;  4AG7 A;  3WT4 A;  1M1K 2;  3SJX A;  3GTJ I;  3G71 Z;  1K9M 2;  3LMS A;  4ZX8 A;  2PJ8 A;  4BBS I;  2V3V A;  2F8H A;  4CYO A;  1BLL E;  2C6P A;  4KZT A;  3IU1 A;  3S9M A;  4UFV A;  3CT9 A;  3M4O I;  4B13 A;  3TTH A;  3DLJ A;  1M4D A;  2ZEN A;  5BWA B;  4E30 A;  3RO0 A;  4KSF A;  2DE5 A;  3RZA A;  3TDH B;  1VQ9 1;  1Z8X A;  2IV2 X;  4A95 A;  2ATR A;  2AKL A;  4JJX A;  3NDI A;  3BG1 B;  2A4N A;  1TWG I;  4ZI6 A;  3CC7 1;  1KUY A;  1LQL A;  1VQ5 Z;  4MHY A;  3NE7 A;  1CBX A;  2E2I I;  4IHM A;  5IT9 f;  4KOW A;  4E2Z A;  2J9A A;  1P4N A;  1YJN Z;  2JBJ A;  4A3C I;  1QSR A;  3N5F A;  5H84 A;  2C27 A;  4H6Z A;  1R57 A;  2DPT A;  2QIR A;  2Z10 A;  2AJ6 A;  4YFJ A;  2P28 A;  4X3R A;  2GTH A;  4UEZ A;  3J80 b;  1XBU A;  2ZOG A;  4MHD A;  2V8D A;  4OC3 A;  3NE8 A;  1Q86 1;  4OAD A;  3CCS 1;  2OOT A;  2OTJ 1;  3JAM f;  4KVO E;  3SHP A;  4RI1 A;  2FL4 A;  1Y1W I;  3F3F C;  4FD7 A;  1TIQ A;  2Q7S A;  2K5R A;  4R87 A;  4A32 A;  2RFH A;  1Q82 2;  3PO3 S;  4XPD C;  1Z5R A;  1USP B;  3J81 f;  2AFZ A;  3PEI A;  2XEJ A;  4A3M I;  1XJO A;  5A27 A;  1YUK A;  4CGM A;  3KQZ A;  3MGD A;  4XNH B;  4OAE A;  2ZW5 A;  1ZH1 A;  3VMG A;  1YJW Z;  1UFH A;  1ZLI A;  5JPH A;  1WK4 A;  3S9L A;  1W2B Z;  1Z4E A;  4P4F A;  2KCW A;  1VQ4 Z;  2EK8 A;  2VEZ A;  2QR1 B;  2OH1 A;  5IX3 A;  2OOX B;  4MXU A;  1R3N A;  4AVA A;  2PJ1 A;  3PBB A;  3DGV A;  3P2H A;  4KOS A;  3ESW A;  3KQX A;  6CPA A;  5AG6 A;  4YWY A;  3B3W A;  4A39 A;  2ZEF A;  1VQM 1;  3H8F A;  2Z3K A;  4PK2 A;  4B6Z A;  2ANP A;  4BY7 I;  4PXD A;  3D67 A;  2G9D A;  2O4H A;  4TWE A;  5J8C A;  1Q7L A;  1BPM A;  4CAX A;  1VQ6 Z;  5KTD A;  3SJF A;  2JS4 A;  3MZK B;  1Z9U A;  3DNS A;  4CGN A;  4RVG A;  2VUM I;  3VAR A;  5AN9 F;  2O28 A;  1S7F A;  3HOX I;  2ZW4 A;  4IK2 A;  2VXK A;  4X8I A;  2GAN A;  4UEE A;  4L8A A;  1R43 A;  2FT0 A;  1RO4 A;  5FLM I;  2IQ6 A;  4P45 A;  4A37 A;  4CYP A;  2YNC A;  2V45 A;  5D1P A;  2PR1 A;  1KC8 1;  1CP7 A;  3PB8 X;  1IYL A;  1QVF Y;  5A28 A;  3TCV A;  4YGO A;  1JJ2 Z;  1VQO 1;  1S60 A;  3IEH A;  2BO9 A;  2PVV A;  1IOI A;  3L2N A;  5DWN A;  1X10 A;  4R57 A;  1L1O C;  2YNE A;  3B2Y A;  1NP6 A;  3FEC A;  5C4J I;  3B8G A;  2JEV A;  4NXY A;  3T90 A;  1PCA A;  4NOZ A;  4NFR A;  3HOV I;  4CGL A;  1YHQ Z;  4LX9 A;  2VZZ A;  2Z0Z A;  3A9L A;  4MHN A;  1XRY A;  4MJ8 A;  1BPN A;  4PSW A;  4CRZ B;  4UFX A;  3PFO A;  4DUK A;  4P4D A;  2FVG A;  4NB8 A;  3LUS A;  1VQ9 Z;  1LRZ A;  5A2Q b;  1IU8 A;  1TWA I;  4B12 A;  2AFM A;  1TF9 A;  4CRY B;  4UWJ A;  2EUI A;  2CNT A;  2P0W A;  2Q43 A;  2VZY A;  5K8M A;  2Q7B A;  5H86 A;  2NVY I;  1P9N A;  3CC7 Z;  3CXC Y;  1F57 A;  5FVJ A;  4DGL A;  5AG7 A;  2PC1 A;  4JXR A;  4A3K I;  2PQ8 A;  4CAE A;  1B87 A;  2YND A;  4NB9 A;  4A3F I;  3BHX A;  2B3V A;  4H2K A;  1QVG Y;  4B5P A;  1AYE A;  2EBJ A;  4KVM E;  3CDX A;  1Q2C A;  3D2M A;  1YIT Z;  4HNW B;  1QYP A;  2I00 A;  3VAT A;  4E8O A;  3CCV 1;  5K8N A;  5JQ4 A;  3CXP A;  5CNP A;  2GLJ A;  2QEX 1;  4FUU A;  3FF3 A;  1FT7 A;  4NBE A;  3KI9 A;  3SI2 A;  4RVH A;  2VQY A;  1S5K A;  3PB4 X;  3CCM 1;  3CCS Z;  1M1K 1;  5AGE A;  3HOU I;  4P4E A;  1K9M 1;  4ZY0 A;  5KTC A;  5HH1 A;  4QTU A;  3CPX A;  4H6U A;  4EWT A;  3QWU A;  3PO2 I;  2JDC A;  3W6X A;  3SI0 A;  1Z8T A;  4W9Y A;  2R7H A;  3QAH A;  3F8K A;  4E2W A;  4CL1 A;  3I4N I;  1RTQ A;  4KUB A;  3TT2 A;  3KKW A;  2OOY B;  1YRE A;  1JWQ A;  4HH4 A;  3VTN A;  3HOY I;  4LQ6 A;  5D8N A;  4U9Z A;  2J8M A;  3WC6 A;  3ISZ A;  2PM9 A;  2REF A;  4L89 A;  5K8O A;  4MMO A;  5KTA A;  3GTO I;  2Q4Y A;  2FIA A;  5A2Q f;  4NGM A;  4WJB A;  2B5G B;  4KOY A;  2BL1 A;  2PK7 A;  1VQM Z;  2V8K A;  1MK4 A;  4MFL A;  2RPR A;  3VB9 A;  1XOV A;  3IX0 A;  2RC4 A;  1KQS Y;  1TWH I;  3NH5 A;  1VQ7 Z;  3TOA A;  4RVF A;  2DXQ A;  3D7G A;  2ZEO A;  1S3Z A;  2JA5 I;  2V77 A;  3V7Z A;  4F8Z A;  3D2P A;  3K9U A;  2DPS A;  2WPW A;  4ZX9 A;  3CPA A;  1TF8 A;  2OU2 A;  1JWH C;  4X6A I;  4PV6 A;  1N71 A;  2BSW A;  3R9G A;  3IR7 A;  3CCU 1;  4NJQ A;  4RVD A;  1Z8L A;  4AB7 A;  2ZEM A;  3S15 I;  2JA7 I;  2PIY A;  3FX6 A;  4KOX A;  2R1I A;  1K4J A;  1Y9K A;  3WAB A;  3TO6 A;  5LYD A;  1YGH A;  3BI1 A;  3CXS A;  2WPX A;  1VQO Z;  3K7A I;  5JM6 A;  2G2K A;  2PJ7 A;  5C88 A;  3FRM A;  1ELL P;  1ELM P;  2WSA A;  4PSX A;  1X0T A;  1IB1 E;  1KD1 2;  1A2Z A;  4E32 A;  4C2Z A;  1YX0 A;  3PP9 A;  4FD5 A;  3OW2 Z;  3KIF A;  2GE3 A;  3H8G A;  4MFK A;  4OC4 A;  4KSA A;  4MHP A;  4YRH A;  4C68 A;  1YW4 A;  3LAC A;  2V8H A;  1L0C A;  1NSA A;  3J81 b;  2AFO A;  4Q36 A;  4Y49 C;  2R92 I;  4Z65 A;  2V8V A;  3F3P C;  2Z3O A;  3S17 I;  4TNU A;  4JLY A;  4A2Z A;  4BBR I;  1RXT A;  4FD6 A;  2AFW A;  3K9T A;  4A30 A;  3CC4 1;  2PJA A;  1MJB A;  3S2H I;  3PZJ A;  1BOB A;  4NGS A;  3P5J B;  4NSQ A;  1OZP A;  2FSR A;  2QLV B;  3RZD I;  4UCM A;  1IIC A;  4C2Y A;  1YIJ 1;  4PXE A;  4XPK A;  3QAY A;  2CTB A;  1CPS A;  2QRE B;  3FQQ A;  3T4N B;  2ZEH A;  3PB7 X;  3I56 1;  4BD9 A;  4QBJ A;  1IY7 A;  1CPX A;  1LCP A;  2FXF A;  1ML8 A;  4NGQ A;  5AG4 A;  3CXQ A;  4NBC A;  2DE6 A;  1CJW A;  3J7A 4;  3GB0 A;  4BBH A;  1QSN A;  5AG5 A;  4OC1 A;  1J4J A;  3CCV Z;  2JLM A;  4R6T A;  2PJ6 A;  3U50 C;  4AYB A;  4MCP A;  2EGT A;  4JZ0 A;  2CNS A;  3CMA 1;  3GTP I;  1NE9 A;  4BXX I;  4M3S A;  2GFQ A;  3CCM Z;  2NYQ A;  3IF8 A;  2GRE A;  2CXA A;  2H85 A;  4F0Y A;  3K2K A;  2PIZ A;  4RN7 A;  2P6E A;  4HNX B;  2M48 A;  4ONW A;  4NH1 C;  4OP4 A;  4MD8 A;  5IB0 A;  4RV9 A;  1P0H A;  1VQP 1;  3GUX A;  3KHZ A;  5F48 A;  1USP A;  2CF4 A;  1V0C A;  2LFU A;  4FBE A;  2LIY A;  2XEF A;  3H3V J;  4Q7A A;  4KUA A;  4P4B A;  3IWE A;  1SIW A;  2JR6 A;  3VH9 A;  7CPA A;  3NA6 A;  1S7M A;  3G6E 1;  2IZ3 A;  1YR0 A;  3R95 A;  4A33 A;  1SQH A;  2G3A A;  3IJ3 A;  4M6I A;  4MCS A;  4U9Y A;  3TOB A;  2JIO A;  2OR4 A;  4QVT A;  2E2H I;  4GS4 A;  2FE7 A;  1EE3 P;  4OKO A;  2BJO A;  4BMH A;  3S6H A;  2ODF A;  2HQY A;  3ISX A;  2DEA A;  4U5Y A;  2Q44 A;  2V8I A;  5DWM A;  1Z4R A;  4QC6 A;  2PDO A;  3S2D I;  3MN8 A;  4ORF A;  3EER A;  2ZEL A;  3CCU Z;  2JA6 I;  4CPA A;  4KOU A;  4A38 A;  5HXD A;  1ZG8 A;  3IWG A;  1QSM A;  2VPY A;  3FB3 A;  4NGT A;  3DR6 A;  4CS0 B;  4X5K A;  3PBE A;  1R9T I;  3CPW Y;  4CGO A;  2B4B A;  2BOA A;  4HKF A;  4F9U A;  2E9H A;  5E96 A;  1VGY A;  3DSB A;  3KL9 A;  3R9E A;  2F5I A;  3W91 A;  1QQ9 A;  1LOK A;  4CAF A;  2X7B A;  4P10 A;  4NGP A;  4K30 A;  4KVX A;  3LOD A;  3D9X A;  4O23 A;  2D4O A;  2P3Y A;  4XNH C;  3BLN A;  1PFT A;  2JNY A;  1VQ8 1;  2JUB A;  1QVF Z;  3FED A;  3SJG A;  1H8L A;  2WUU A;  1B6B A;  3FYN A;  3RBU A;  3GTM S;  4MD7 A;  2PJ5 A;  2KPI A;  2ARH A;  2EK9 A;  3I55 1;  5C82 A;  4Y7N I;  1VLA A;  2REE A;  1ZO0 A;  3CC4 Z;  2NVQ I;  3B3C A;  3BXM A;  3CCJ 1;  2R93 I;  1K8A 2;  3D6W A;  2E7Z A;  1Y1V I;  1AMP A;  4AG9 A;  3KHX A;  3M3Y I;  1LFW A;  5FLX b;  3G3S A;  4HGY A;  4PXC A;  3H5Z A;  4OID A;  4IUS A;  1ZB8 A;  3CME 1;  4JYW A;  3I07 A;  2JIP A;  1I1D A;  4S1T A;  1FY7 A;  5DS0 A;  3I1U A;  3FNC A;  1N8R 2;  2Q51 A;  4NCZ A;  1S7L A;  1Q2D A;  2DE7 A;  4EFD A;  2BUE A;  1TXR A;  4IF5 A;  3CXC Z;  2QKD A;  2WB1 A;  4KOV A;  1WJ2 A;  3GTG I;  4EME A;  4NGR A;  3NH8 A;  5C3E I;  1YW6 A;  4P6Y A;  3S1R I;  4CAW A;  1QVG Z;  2K3R A;  4DYO A;  2I79 A;  3SJE A;  1FNO A;  4UA3 A;  4NEX A;  2YNC C;  1YJ9 1;  4AVB A;  5ISV A;  1KD1 1;  4UIA A;  1NSL A;  4II9 A;  2OTL 1;  3S6G A;  1F2O A;  1X3Z A;  3D68 A;  5IV0 A;  2R8V A;  3G4S 1;  4B11 A;  2JIQ A;  3FEE A;  1SFO I;  4FAI A;  3CQZ I;  1M90 2;  5C4X I;  1CP6 A;  4UFW A;  3GKR A;  2YU9 I;  1VQP Z;  1S72 1;  2OTJ Z;  3RAM A;  2QJ8 A;  1X12 A;  2YAD A;  4LUA A;  5D1O B;  2PJ2 A;  2IL4 A;  1VHS A;  4A31 A;  2K5T A;  4QUS A;  5T6B A;  1YJN 1;  4A3I I;  3GTM I;  2B3U A;  5JH9 A;  1ARL A;  2ZEE A;  3PB9 X;  4A3J I;  2G3T A;  1Y7E A;  2POK A;  4C2X A;  3BJ7 A;  3TO7 A;  3UY5 A;  1BAV A;  3C26 A;  2XEI A;  1LAN A;  4A3L I;  4CAV A;  1NJI 1;  3EED A;  2EO8 A;  1TWC I;  3S1M I;  1VQN 1;  2B5G A;  3RYO A;  4NBB A;  2QRD B;  1Z01 A;  5FLX f;  2OZG A;  5T67 A;  5K8P A;  4XPL A;  2GLF A;  1CM0 A;  1RNI A;  4A3B I;  4NBA A;  4E2X A;  2QA4 1;  4MON A;  3TE4 A;  1YLO A;  3FH4 A;  3PRT A;  1YJW 1;  3I3G A;  2JIR A;  1KQS Z;  4Y52 I;  2HC9 A;  4E0A A;  2HV2 A;  3CD6 1;  4UEF A;  4MBU A;  4KOR A;  2ZXV A;  1TWF I;  1GHE A;  2PJ3 A;  1VHE A;  1K83 I;  3LD2 A;  3S1N I;  3NDJ A;  1XE4 A;  1MJ9 A;  4MRI A;  2B58 A;  1HDU A;  2Q4Z A;  2WYR A;  4MCR A;  3MRU A;  1YSJ A;  2FIW A;  1JQG A;  4R7M A;  2VI7 A;  4PXB A;  1I21 A;  3JTK A;  4X2T A;  4MI4 A;  4M6G A;  1ZB9 A;  1VQK 1;  3TFY A;  2RIQ A;  4M85 A;  4JXQ A;  1K73 2;  1QSO A;  4E2A A;  1VQ8 Z;  4UCN A;  1Z02 A;  4DJL A;  2PJB A;  5F49 A;  3CCR 1;  3FJU A;  4M6H A;  1XEB A;  3H8E A;  4OLL A;  5CBM A;  1TKH A;  5CM2 M;  4UCP A;  2OB0 A;  1LAM A;  2IMO A;  4B14 A;  3MZL B;  3I55 Z;  1X3W A;  3GY9 A;  1ON0 A;  3S1Q I;  2B4D B;  1I12 A;  1TKF A;  1ZG9 A;  3V8I A;  2AFS A;  4R8F A;  1CX8 A;  3CCJ Z;  2VPZ A;  2OZK A;  3SXN A;  3QNV A;  2WZN A;  4CYN A;  4BY1 I;  2F4M A;  3R96 A;  2XEG A;  4MFQ A;  3B3V A;  2C6G A;  3HUV A;  1YQE A;  2NAP A;  1I3Q I;  3MON A;  3CME Z;  4FWU A;  2O53 A;  1NMT A;  1AA6 A;  3D7F A;  4UF4 A;  3WC7 A;  1NJI 2;  3CCQ 1;  3N7Z A;  1YHQ 1;  3IU2 A;  4P4I A;  2JDD A;  1DTD A;  2BCO A;  3I9S A;  3H4Q A;  1GYT A;  4I49 A;  1FDI A;  4XPD B;  1KRL A;  3PFE A;  2ZEG A;  4OC5 A;  3FVL A;  4ZBG A;  1WII A;  4KLV A;  4RS2 A;  2NSM A;  1YJ9 Z;  2B63 I;  2QML A;  4B5O A;  4R3L A;  2Z3P A;  2OTL Z;  5HVF A;  2VBQ A;  3JUW A;  4P44 A;  2QEX Z;  4CGP A;  4MY0 A;  3FQM A;  3KZW A;  3CC2 1;  3G4S Z;  2ABZ A;  4R76 A;  1XMB A;  4HPS A;  2Y0S A;  3RZO I;  1CG2 A;  3GIU A;  4HGZ A;  1M4I A;  2Z3N A;  1S72 Z;  2R7Z I;  2ZAE B;  2PR8 A;  1YME A;  2Z3L A;  2Z3M A;  4AXV A;  1F2P A;  1DE4 C;  4JWP A;  3SI1 A;  3CCL 1;  4F6A A;  3IFU A;  3WC5 A;  4B10 A;  1YIT 1;  2VUG A;  2OZH A;  2ZPA A;  4NBD A;  1RO0 A;  3TE5 B;  1N2F A;  1K8A 1;  1Z8W A;  1IID A;  3HOZ I;  3D3S A;  3FMC A;  1M44 A;  3B7I A;  4KLW A;  2G0B A;  3GKQ A;  5EC4 A;  2ZED A;  1Y0Y A;  1S7N A;  4MFZ A;  1Q7Y 2;  4H89 A;  3KIH A;  1YLE A;  3H0G I;  1WZN A;  2GTI A;  5GCN A;  1VQN Z;  3VWD A;  4EVY A;  2HUZ A;  3F0A A;  4OC2 A;  1YVO A;  5G1Z A;  8CPA A;  2GIV A;  1RO2 A;  1N8R 1;  2PSW A;  2W03 A;  2R98 A;  2EVN A;  4MH4 A;  5F46 A;  1Q81 2;  1U6M A;  2V8J A;  4MD9 A;  3FXT A;  1QMU A;  1VHO A;  3D2L A;  2R6M A;  1UWY A;  5LRK A;  3EXN A;  4E31 A;  3KR5 A;  1Y1V S;  2QA4 Z;  2J8N A;  1VKC A;  3EO4 A;  2RHB A;  3KAS A;  2QEC A;  2HF1 A;  1W2B Y;  2DF5 A;  3QB8 A;  1XMT A;  1IOF A;  4R3K A;  4MFP A;  4NBF A;  3CD6 Z;  2VPX A;  5IP7 I;  2BEI A;  4G1P A;  5LYI A;  4UBR A;  4UIB A;  3CCE 1;  4C7I A;  1DL6 A;  2PJ9 A;  3B35 A;  4FD4 A;  1NUI A;  3I4M I;  5EBV A;  1M90 1;  4NJR A;  1PU9 A;  4UWI A;  2PRQ A;  5LRG A;  1BO4 A;  3F5B A;  4C7H A;  2OZU A;  1Z2L A;  1Z03 A;  4MFJ A;  5T64 A;  1VQ7 1;  3D7H A;  3E0K A;  1VQK Z;  3JVN A;  1VQL 1;  3IFE A;  1YI2 1;  3CPW Z;  5CPA A;  4E2Y A;  3ZJ0 A;  5HMN A;  2WAQ A;  1HEE A;  4HNY B;  3D66 A;  3FKI I;  1S7K A;  3R9F A;  3CCR Z;  3S6K A;  3KGQ A;  3D4U A;  3V38 A;  4KSI A;  4A94 A;  2QRC B;  3J80 f;  1Y7R A;  2M6N A;  5I0C A;  4K3N A;  3HOW I;  3RNZ A;  3G8W A;  3NFZ A;  5LRJ A;  1JJ2 Y;  1Y9W A;  3HKZ A;  2PJ4 A;  3CZX A;  2NMT A;  3S16 I;  4BIN A;  3PO3 I;  1PUA A;  3GYA A;  2E2J I;  1KUV A;  1Y8C A;  2QVP A;  1M4G A;  5LYF A;  3HLP A;  1PYT B;  3VMI A;  5JGF A;  2AYD A;  5G21 A;  4F9V A;  4OC0 A;  2C6C A;  5IP9 I;  3WR7 A;  2CIJ A;  2RB7 A;  2YGW A;  1YIJ Z;  3CCQ Z;  3TX8 A;  1Q86 2;  4LQG A;  3PB6 X;  1LAP A;  3G71 1;  1MJA A;  3B3T A;  2P6G A;  4DK1 A;  3LWU A;  3I56 Z;  4PQA A;  2JA8 I;  3EY5 A;  1RQF A;  5F09 A;  2Y0M A;  2H5M A;  3IC1 A;  3R1K A;  3Q87 A;  2CY2 A;  3VWE A;  3BG0 B;  1YK3 A;  1ARM A;  4ONU A;  2J6A A;  4JD6 A;  5F47 A;  3CMA Z;  1K73 1;  3EC4 A;  2PJ0 A;  4PPZ A;  3CC2 Z;  5J8F A;  4QTT A;  2IJZ A;  5LYL A;  4CYQ A;  2QYV A;  3BJ8 A;  2Z11 A;  4NBH A;  1I50 I;  4A3G I;  1QXF A;  3D8P A;  4J3G A;  4PK3 A;  4RUH A;  3CCL Z;  3GCF A;  2JIM A;  5HVH A;  1ZG7 A;  3IIB A;  3SXO A;  5D1O A;  1WW9 A;  4MY3 A;  4P4J A;  3TC8 A;  4B5P B;  4NGN A;  4A93 I;  1VQ5 1;  3IGR A;  4RS4 A;  2HB6 A;  4MCQ A;  5I4M A;  1FDO A;  1IYK A;  1ZLH A;  4ZGY B;  4MHZ A;  2FS5 A;  3VMH A;  2JBK A;  3KR4 A;  1RO5 A;  2P6F A;  4EWC A;  1OBR A;  2NVT I;  4WWV A;  3S14 I;  4AVC A;  1Q2Y A;  4QB9 A;  1HDQ A;  4ZY1 A;  2ZW6 A;  3G6E Z;  5ELY A;  2GU2 A;  4OME A;  5EMI A;  5HVG A;  5C44 I;  2I3C A;  1TKJ A;  3S6F A; 
#chains in the Genus database with same CATH homology
 2AFS A;  4R8F A;  1CX8 A;  2JMO A;  3CCJ Z;  4E33 A;  5C4J I;  3GTL I;  2JEW A;  2OZK A;  4P4B A;  2JR6 A;  3QNV A;  3VH9 A;  7CPA A;  2WZN A;  1PCA A;  3NA6 A;  1S7M A;  3G6E 1;  2IZ3 A;  4NOZ A;  4NFR A;  4BY1 I;  3HOV I;  2F4M A;  2XEG A;  1YHQ Z;  1KC8 2;  3B3V A;  2C6G A;  3JRU A;  3HUV A;  4MHN A;  1XRY A;  1BPN A;  3MON A;  1I3Q I;  3CME Z;  4FWU A;  2O53 A;  3IJ3 A;  1IGB A;  2C1C A;  4ZYQ A;  3D7F A;  3NH4 A;  3B3S A;  4UF4 A;  3WC7 A;  4MCS A;  3CCE Z;  2HU9 A;  3PFO A;  4DUK A;  4P4D A;  2FVG A;  1Y0R A;  1NJI 2;  3CCQ 1;  4NB8 A;  1YHQ 1;  2OR4 A;  4P4I A;  3LUS A;  1VQ9 Z;  1DTD A;  2BCO A;  2E2H I;  5A2Q b;  4YU9 A;  1TWA I;  1GYT A;  1EE3 P;  2F7V A;  4OKO A;  1KRL A;  2BJO A;  1TKJ A;  1YUA A;  3PFE A;  2AFM A;  2ZEG A;  1TF9 A;  1VQ4 1;  4OC5 A;  3FVL A;  2Q43 A;  1WII A;  5K8M A;  3ISX A;  2DEA A;  2NVY I;  2V8I A;  1P9N A;  3IO1 A;  3CC7 Z;  2NSM A;  3CXC Y;  1F57 A;  4NBG A;  2RBL A;  4DGL A;  1YJ9 Z;  2B63 I;  3S2D I;  4A3K I;  3MN8 A;  2IZ4 A;  1TFI A;  3EER A;  1VQL Z;  2OTL Z;  2RT9 A;  2ZEP A;  2ZEL A;  5HVF A;  3CCU Z;  4NB9 A;  4A3F I;  4DQY B;  3BHX A;  1YI2 Z;  2JA6 I;  4P44 A;  4H2K A;  4CPA A;  1QVG Y;  2QEX Z;  1AYE A;  4A38 A;  5HXD A;  1ZG8 A;  2V8G A;  3FQM A;  2PE3 A;  3KZW A;  3CC2 1;  3G4S Z;  1VIX A;  2ABZ A;  2PCU A;  3CDX A;  4GM5 A;  3T8W A;  4R76 A;  2AFX A;  1XMB A;  4NGT A;  2Y0S A;  2ZOF A;  3RZO I;  1YIT Z;  4A3D I;  1CG2 A;  1KWM A;  1QYP A;  4HGZ A;  3PBE A;  3VAT A;  1R9T I;  1Q7Y 1;  3CPW Y;  3CCV 1;  5K8N A;  1S72 Z;  3BI0 A;  2R7Z I;  2BOA A;  2ZAE B;  1YME A;  1XFO A;  5THW A;  4F9U A;  2E9H A;  1VGY A;  2GLJ A;  2PVW A;  3KL9 A;  1VQ6 1;  2QEX 1;  4FUU A;  2PJC A;  2KI7 B;  5IT9 b;  4AXV A;  1I6H I;  3FF3 A;  1F2P A;  1DE4 C;  1FT7 A;  2CTC A;  4NJQ A;  4NBE A;  3KI9 A;  3SI2 A;  3SI1 A;  3CCL 1;  3IFU A;  4RVH A;  3WC5 A;  1RLY A;  1QQ9 A;  1LOK A;  1YIT 1;  2VUG A;  3PB4 X;  3CCM 1;  1Q82 1;  3CCS Z;  1M1K 1;  4P10 A;  4ZY2 A;  4NBD A;  1Q81 1;  3HOU I;  4NGP A;  4P4E A;  3S9N A;  1RO0 A;  3TE5 B;  2AFU A;  3D9X A;  4O23 A;  1N2F A;  1K9M 1;  4ZY0 A;  2P3Y A;  3GLJ A;  1K8A 1;  4QTU A;  1M4L A;  1PFT A;  2JNY A;  3HOZ I;  3FMC A;  1VQ8 1;  3CPX A;  2JUB A;  4EWT A;  3B7I A;  3QWU A;  4A3E I;  1QVF Z;  3FED A;  5IB9 A;  3GTK I;  3SJG A;  1H8L A;  3PO2 I;  4OIW A;  3GKQ A;  2ZED A;  1Y0Y A;  3RBU A;  3OW2 Y;  1Q7Y 2;  3KIH A;  3GTM S;  2VF1 A;  4MD7 A;  3SI0 A;  3H0G I;  2PJ5 A;  4IAV A;  2F4O A;  2GTI A;  4XX2 A;  2PMZ A;  4W9Y A;  5J1Q A;  5LL6 f;  2KPI A;  3JAM b;  1VQN Z;  2VL1 A;  3GTQ I;  5D29 A;  3D7D A;  4E2W A;  2EWB A;  4CL1 A;  3I4N I;  4OC2 A;  2NVX I;  1RTQ A;  8CPA A;  1QF8 A;  2EK9 A;  1WCM I;  1RO2 A;  2OOY B;  3I55 1;  1N8R 1;  2W03 A;  2W04 A;  3IWW A;  4Y7N I;  4MH4 A;  1VLA A;  4HH4 A;  3WT4 A;  1M1K 2;  3CC4 Z;  1Q81 2;  3VTN A;  3SJX A;  2NVQ I;  2V8J A;  4MD9 A;  3GTJ I;  3HOY I;  1QMU A;  3G71 Z;  1VHO A;  1K9M 2;  3B3C A;  3LMS A;  5D8N A;  3BXM A;  2R6M A;  1UWY A;  3CCJ 1;  2R93 I;  4ZX8 A;  1K8A 2;  5LRK A;  3D6W A;  1Y1V I;  2PJ8 A;  4E31 A;  3KR5 A;  1AMP A;  1Y1V S;  2QA4 Z;  3WC6 A;  4BBS I;  3ISZ A;  3KHX A;  2PM9 A;  3M3Y I;  1LFW A;  2F8H A;  5K8O A;  4MMO A;  2RHB A;  1BLL E;  3KAS A;  2C6P A;  5FLX b;  2HF1 A;  3GTO I;  1W2B Y;  4HGY A;  5A2Q f;  4NGM A;  4PXC A;  3S9M A;  4OID A;  4WJB A;  3CT9 A;  1ZB8 A;  3CME 1;  4JYW A;  3M4O I;  3I07 A;  4S1T A;  2PK7 A;  1VQM Z;  2V8K A;  4NBF A;  3DLJ A;  3CD6 Z;  2ZEN A;  5DS0 A;  5IP7 I;  4G1P A;  3I1U A;  5LYI A;  4E30 A;  1N8R 2;  4UIB A;  2RPR A;  3VB9 A;  3CCE 1;  2Q51 A;  3IX0 A;  1DL6 A;  2PJ9 A;  1KQS Y;  2DE5 A;  3B35 A;  1TWH I;  1NUI A;  2DE7 A;  3TDH B;  3I4M I;  3RZA A;  1TXR A;  3NH5 A;  1VQ7 Z;  1VQ9 1;  4EFD A;  1M90 1;  4NJR A;  4RVF A;  3CXC Z;  3D7G A;  2ZEO A;  2QKD A;  2WB1 A;  2PRQ A;  2AKL A;  3GTG I;  5LRG A;  4EME A;  4NGR A;  3NDI A;  3NH8 A;  5C3E I;  2JA5 I;  1YW6 A;  2V77 A;  3BG1 B;  4P6Y A;  3V7Z A;  4F8Z A;  1TWG I;  3S1R I;  1QVG Z;  2K3R A;  4DYO A;  1Z2L A;  4ZI6 A;  1Z03 A;  3CC7 1;  3SJE A;  1FNO A;  5T64 A;  4ZX9 A;  3CPA A;  1TF8 A;  1LQL A;  1YJ9 1;  1VQ7 1;  3D7H A;  1VQ5 Z;  1JWH C;  1VQK Z;  4X6A I;  1KD1 1;  4MHY A;  4UIA A;  2OTL 1;  1VQL 1;  3CCU 1;  3IFE A;  4RVD A;  1YI2 1;  1CBX A;  3CPW Z;  2E2I I;  1Z8L A;  1F2O A;  2ZEM A;  1X3Z A;  5IT9 f;  4IHM A;  3D68 A;  5CPA A;  3S15 I;  4E2Y A;  2JA7 I;  2PIY A;  3FX6 A;  2WAQ A;  4E2Z A;  3G4S 1;  1HEE A;  2J9A A;  1YJN Z;  2JBJ A;  3D66 A;  3FEE A;  3FKI I;  1SFO I;  4FAI A;  3CQZ I;  3CCR Z;  4A3C I;  1M90 2;  5C4X I;  1CP6 A;  3N5F A;  3KGQ A;  3D4U A;  3WAB A;  2YU9 I;  1VQP Z;  1S72 1;  2OTJ Z;  3RAM A;  3V38 A;  5LYD A;  2QJ8 A;  3BI1 A;  4KSI A;  4A94 A;  2YAD A;  5D1O B;  2PJ2 A;  2P28 A;  2QRC B;  4X3R A;  2GTH A;  1VQO Z;  3J80 f;  3K7A I;  2M6N A;  4UEZ A;  5T6B A;  3J80 b;  4K3N A;  5JM6 A;  2G2K A;  3HOW I;  1XBU A;  2PJ7 A;  2ZOG A;  2V8D A;  1YJN 1;  4OC3 A;  1ELL P;  1ELM P;  4A3I I;  3GTM I;  1X0T A;  1Q86 1;  5JH9 A;  3CCS 1;  1KD1 2;  1ARL A;  4E32 A;  2OOT A;  2ZEE A;  3PB9 X;  3NFZ A;  2OTJ 1;  3JAM f;  4A3J I;  5LRJ A;  3OW2 Z;  1JJ2 Y;  1Y1W I;  1Y7E A;  2POK A;  3KIF A;  3F3F C;  3HKZ A;  2PJ4 A;  1BAV A;  3H8G A;  4OC4 A;  2K5R A;  2XEI A;  4MHP A;  3S16 I;  1LAN A;  4A3L I;  3PO3 I;  2RFH A;  1NJI 1;  1Q82 2;  2E2J I;  3PO3 S;  1YW4 A;  1Z5R A;  2QVP A;  1USP B;  2V8H A;  3EED A;  3J81 f;  1NSA A;  2AFZ A;  3PEI A;  5LYF A;  3HLP A;  1PYT B;  3VMI A;  5JGF A;  3J81 b;  2AFO A;  4F9V A;  4OC0 A;  1TWC I;  3S1M I;  2XEJ A;  4A3M I;  2R92 I;  1VQN 1;  2C6C A;  4Z65 A;  1XJO A;  5IP9 I;  2V8V A;  1YUK A;  3F3P C;  3KQZ A;  4NBB A;  2QRD B;  4TNU A;  3S17 I;  2CIJ A;  1Z01 A;  2RB7 A;  5FLX f;  1YIJ Z;  3CCQ Z;  1ZH1 A;  3TX8 A;  3VMG A;  4BBR I;  1Q86 2;  1YJW Z;  4LQG A;  2AFW A;  5T67 A;  1ZLI A;  5K8P A;  3K9T A;  3CC4 1;  2PJA A;  3PB6 X;  1LAP A;  3S2H I;  2GLF A;  3G71 1;  4NGS A;  3P5J B;  1RNI A;  3S9L A;  1W2B Z;  3B3T A;  4P4F A;  4DK1 A;  3LWU A;  1VQ4 Z;  2EK8 A;  3I56 Z;  2QLV B;  2QR1 B;  4A3B I;  3RZD I;  4PQA A;  4NBA A;  2OOX B;  4E2X A;  2QA4 1;  1RQF A;  4MON A;  4MXU A;  2JA8 I;  1R3N A;  5F09 A;  2PJ1 A;  3PBB A;  1YLO A;  3DGV A;  3FH4 A;  3IC1 A;  1YIJ 1;  3Q87 A;  3ESW A;  4PXE A;  3KQX A;  3PRT A;  1YJW 1;  2CTB A;  6CPA A;  1CPS A;  2QRE B;  3FQQ A;  1KQS Z;  3BG0 B;  3T4N B;  4Y52 I;  2ZEH A;  4YWY A;  1ARM A;  3B3W A;  3PB7 X;  2HC9 A;  4A39 A;  2ZEF A;  2J6A A;  3I56 1;  1VQM 1;  4BD9 A;  3H8F A;  3CMA Z;  1K73 1;  2PJ0 A;  3CD6 1;  4PPZ A;  4UEF A;  4B6Z A;  3CC2 Z;  1TWF I;  1IY7 A;  2ANP A;  1CPX A;  4BY7 I;  4PXD A;  2PJ3 A;  1LCP A;  1VHE A;  1ML8 A;  4QTT A;  4NGQ A;  4NBC A;  2DE6 A;  3D67 A;  1K83 I;  3J7A 4;  2G9D A;  3GB0 A;  3S1N I;  2IJZ A;  3NDJ A;  2O4H A;  4TWE A;  5LYL A;  4OC1 A;  3CCV Z;  2QYV A;  4R6T A;  1Q7L A;  2PJ6 A;  4NBH A;  3U50 C;  4MRI A;  1BPM A;  4AYB A;  1HDU A;  4MCP A;  2EGT A;  2Q4Z A;  4JZ0 A;  2WYR A;  1VQ6 Z;  4MCR A;  1I50 I;  3MRU A;  4A3G I;  1YSJ A;  3SJF A;  3CMA 1;  3GTP I;  2JS4 A;  3MZK B;  4BXX I;  4RUH A;  3CCL Z;  1JQG A;  4R7M A;  3GCF A;  4RVG A;  5HVH A;  1ZG7 A;  3IIB A;  2VUM I;  4PXB A;  5D1O A;  3VAR A;  1WW9 A;  3CCM Z;  5AN9 F;  2NYQ A;  4X2T A;  3TC8 A;  3IF8 A;  2GRE A;  4P4J A;  4NGN A;  4A93 I;  1ZB9 A;  1VQ5 1;  2H85 A;  4RS4 A;  1VQK 1;  3K2K A;  3HOX I;  2HB6 A;  2PIZ A;  2RIQ A;  4IK2 A;  4MCQ A;  4X8I A;  5I4M A;  1K73 2;  1ZLH A;  4UEE A;  1VQ8 Z;  4MHZ A;  1R43 A;  1RO4 A;  3VMH A;  5FLM I;  2IQ6 A;  4P45 A;  4A37 A;  1Z02 A;  2JBK A;  2M48 A;  3KR4 A;  4ONW A;  4DJL A;  5D1P A;  4NH1 C;  4OP4 A;  2PJB A;  3CCR 1;  1KC8 1;  1CP7 A;  3PB8 X;  4MD8 A;  4RV9 A;  4EWC A;  3FJU A;  1VQP 1;  3H8E A;  1OBR A;  5CBM A;  3GUX A;  2NVT I;  1QVF Y;  1TKH A;  3KHZ A;  5CM2 M;  4WWV A;  1USP A;  3S14 I;  2CF4 A;  1LAM A;  2IMO A;  3MZL B;  1HDQ A;  4ZY1 A;  2LFU A;  1JJ2 Z;  4FBE A;  1VQO 1;  3G6E Z;  3I55 Z;  1X3W A;  2LIY A;  5ELY A;  3IEH A;  2BO9 A;  2XEF A;  2GU2 A;  4OME A;  2PVV A;  3S1Q I;  3L2N A;  5HVG A;  5C44 I;  2I3C A;  3H3V J;  1TKF A;  1ZG9 A;  1L1O C;  3B2Y A;  1NP6 A;  3FEC A;  4Q7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...