4NG2A

Crystal structure of lasr lbd-qsla complex from pseudomonas aeruginosa
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
166
structure length
166
Chain Sequence
ALVDGFLELERSSGKLEWSAILQKMASDLGFSKILFGLLPKDSQDYENAFIVGNYPAAWREHYDRAGYARVDPTVSHCTQSVLPIFWEPSIYQTRKQHEFFEEASAAGLVYGLTMPLHGARGELGALSLSVEAENRAEANRFMESVLPTLWMLKDYALQSGAGLAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional activator protein LasR
publication title QsIA disrupts LasR dimerization in antiactivation of bacterial quorum sensing
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription regulator
total genus 54
structure length 166
sequence length 166
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03472 Autoind_bind Autoinducer binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.80 Alpha Beta 2-Layer Sandwich Beta-Lactamase Transcription factor LuxR-like, autoinducer-binding domain 4ng2A00
4Y15A 3JPUA 2Q0OA 4LFUA 3IX4A 4Y17A 1H0MA 3IX8A 3QP2A 1L3LA 2UV0E 3IX3A 5L07A 4LGWA 3QP1A 3QP4A 4NG2A 2AVXA 5L09A 3QP6A 4Y13A 3QP8A 3QP5A 3SZTA 5L10A
chains in the Genus database with same CATH superfamily
1K57A 1KGFA 2O9AA 3GDIA 4QHCA 3PBOA 4PKYA 1K55A 5CHMA 1V9ZA 5AQ7A 5M18A 1E25A 3UE3A 4X55A 3HBRA 3K2NA 3E4PA 2J3WA 3NDEA 4HHDA 5EV0A 2Y2QA 1YLPA 2QYBA 1QMFA 2PU4A 1G6OA 3BW6A 4II7A 2QZ6A 2BASA 3JVVA 3U4LP 2X71A 2QJ7A 4IUHA 1L0FA 1ZG6A 2CC1A 4RA7A 3KYQA 1L0EA 1T18A 3VP2A 3IH9A 4RX2A 3LIDA 1K25A 1K54C 4MBFA 2R9WA 2XA7S 2O9BA 1MWRA 1BTLA 2J9OA 3RXXA 1MKIA 2VGJA 3GVBA 1NLZA 4OKPA 2OSUA 4E6WA 1WYCA 1XA1A 4O8GA 3UDIA 3VP3A 4S2JA 3C38A 3B42A 1D7EA 2HF6A 3A0SA 2O99A 4OQHA 3EEHA 4C3QA 4PM9A 4WMCD 1PWGA 2XROA 1GSVA 2GNXA 2V0UA 2EWWA 2EX9A 2HP9A 3VOLA 4S2NC 3UMDA 3WS0A 4A5RA 4L9EA 3HUOA 2M7UA 2XRNA 3VFFA 4N1HA 2PBYA 5A90A 3MSHA 3NULA 3GMWA 3EQVA 5CX7A 5HD5A 3CMZA 1MWSA 1K55C 4RX3A 3C7VA 3O5YA 1L0GA 1TS7A 1G5UA 4WZ4A 5CGSA 1DY6A 3NIAA 2FFFB 4HBUA 1NYMA 3UN7A 5CTMA 3IBJA 3WRZA 2PDRA 4R3JA 4HJ6A 4WZ5A 3HLEA 3SS4A 4WELA 2OV5A 3LY4A 4KZ4A 3SH9A 3PBTA 4KQOA 3JYIA 1PFLA 5F6AA 1IOUA 4IEDA 2ZOHA 5AQ9A 3TRCA 4KZ6A 4LV3A 2Y2MA 2Y91A 1W63M 2Y8HA 3LIEA 2UWXA 4S2MA 5EOOA 3IF6B 3V50A 5HDDA 4FD8A 3NOUC 2PD8A 1VHMA 4U3TA 4PM5A 3VP4A 5DTTA 4EEUA 4IVIA 3S4XA 2XGNA 3PHYA 4R4RA 4GN2A 3CPTB 1S67L 3E4OA 4LRYC 2Z6CA 1FCNA 1ES3A 2PT7A 1PZPA 1SDNA 1NLYA 3N4IA 1S6RA 4JF6A 5HPFA 4CPKA 2PU2A 2WAFA 2ZQ7A 1TEMA 3OC2A 1NY0A 2Y2GA 3V5MA 2INWA 2ZQAA 4UA9A 2A24B 4XXRA 1XXMA 3RTYA 1K6RA 5AJGA 5J7EA 1N9LA 1FILA 1U60A 5HW3A 4X68A 3E0YA 5AQBA 1F9IA 5K5BA 5A92A 1Y54A 5FDHA 2Z2MB 3G6OA 3MJQA 3T1XA 1I5QA 1OMEA 3IHBA 1YQSA 2JKTM 3BRMA 3M2JA 4JXVA 4ZBEA 4S2IA 3VSKA 3G32A 1MKMA 5FQMA 4FTXA 3BQ8A 2RCXA 3BWLA 2JBFA 1ZKJA 3W4OA 3PAGA 2PYPA 4X69A 1K4FA 4I38A 4XT2A 4PM6A 4BD0A 1SCWA 4WZ5C 4R70A 4GCZA 4KZ5A 3ZNTA 4ARZA 2J7VA 4GOGA 3GQZA 1HLUP 4PKYG 4KQRA 4E3OA 4I5SA 2RL3A 5D3OA 4EESA 4I39A 3MR0A 4HP4A 2AVXA 5CEBA 2EWVA 5E2GA 4EEPA 4LLOB 3OCLA 2YKHA 4QU3A 4ETXA 1MWUA 4KG2A 2H5SA 1CEFA 3EOIA 2W1TB 2WGWB 4XUXA 5HPIA 1NZOA 4KENB 5HSQA 3R7WA 1LSXA 2CMNA 4Y0TA 1VM1A 4ESPA 1A0KA 4MDZA 1KE0A 1XGIA 1GHPA 5DTSA 3T4QA 2O0YA 4HH3A 2WKQA 4YWZA 3IS2A 4P6BA 4GW9A 1VEUA 4MN7A 1XJ3A 4UEYA 1NRFA 4PMAA 2QWSA 5EPHA 4G3VA 1KVMA 2QJ5A 1STZA 5FEFA 1PWDA 4YNRA 2Z6DA 3BY8A 4X6TA 1G68A 5DFYA 1SDEA 2HPBA 5FI7A 1IELA 3BLMA 4OQGA 4H6JB 1H8MA 5FASA 2VJWA 3F1OB 2JE5A 4GS9A 3UB7A 1EI5A 1ERMA 4KUKA 5HWWA 4FSFA 4QJGA 1ESUA 5EM0A 4BENA 1E3UA 2I9VA 3WS2A 4S2KA 3HLGA 4JGRA 2ZLYA 1Z6FA 3C5AA 5U47A 3DTEA 3MXQA 2VGKA 4GDNA 3KSHA 2BG1A 2J9PA 3UPPA 1KE3A 4GNUA 2JKFA 3Q82A 3H7WA 1LSVA 3JPUA 3SS5A 4WUJA 4HOIA 4RYEA 4P85A 3BFGA 1P0ZA 5EVIA 2EFXA 3D4FA 5J3WA 5GLAA 4ZJ3A 3VFHA 5HFOA 3N8SA 3TW8A 5GHXA 1G28A 3A3EA 2QKPA 1IYOA 3O3VA 1CF0A 1M40A 2J80A 2VGLM 1ZC2A 2Y2LA 4WN5A 4EU0A 3HJKA 1ZHHB 4AFIA 4WLAA 2WGVA 2P08A 2Z2LB 2ZM2A 2IA2A 3Q81A 2P7JA 1LL8A 3SH8A 1TF1A 5AQAA 3A3DA 4R3BA 2JKGA 1N4OA 2Q9MA 4LENA 1MY8A 4Z1WA 5L07A 5DVAA 3M6HA 2R9XA 3HJIA 4YFMA 4YINA 5FQQA 4ZJ1A 2ACGA 4KQQA 4X25A 2OLVA 1NZUA 2R78A 2ZC5B 3LUQA 1YAXA 1RCJA 5LBRA 3UB5P 3UB6A 3K3CA 1L3LA 1PIOA 1IKGA 1T19A 4Q0JA 3QP1A 1EWZA 1JWVA 1LHYA 3QNCA 1XX2A 4CLCD 4ME4A 1TDLA 2XDMA 2A3UA 4R38A 2A2LA 3LI9A 3WWXA 2PR5A 3E98A 4GJ4A 1NYYA 3CITA 3I7JA 3VSLA 1IKIA 5FA7A 3LIAA 4ZTKA 3FG8A 3P09A 3KSIA 5FAOA 3N8LA 4EETB 2JKRM 2UV0E 5TBMB 5HL1A 4S2PA 1N9BA 5FDSA 2V8FA 1AWIA 4MBHA 1T1CA 5HD3A 5CTNA 5E2HA 1O07A 1LT0A 5EVIC 3Q7ZA 1DJCA 2NUTC 2NUPC 3Q7VA 1VB6A 1DP9A 1YKDA 2WAEA 3DTIA 3GTCA 2KOIA 3UY6A 1MBLA 1PWCA 3CZDA 3IT9A 4B4ZA 2JHEA 5EFWA 2VEAA 2OWJA 3DAVA 5EVEA 2B18A 2OAQ1 1VQQA 4P6ZM 3NECA 1MXOA 5GLDA 3F1NA 1S0WA 3ZHHA 2HP5A 1L0DA 3FWLA 1BLHA 1CEGA 4I3IA 1YSPA 2XD1A 4KZ9A 1YLTA 3T1QB 3V3RA 3FKVA 1JWZA 5DTKA 4ZJ2A 5KIZA 1VETA 5IS1A 3GECA 4R3AA 1FQGA 2Q0OA 3UPOA 3IX4A 5FI6A 4KG6A 3LIFA 1UWNX 3Q1FA 2P04A 2VGLS 3K3DA 3UB8A 4OPRA 1E4DA 3GSGA 3SS3A 5JYOA 3IWQA 1YM1A 2W3FA 1OTBA 3ZCZA 3BJNA 2KDKA 3CHWP 1KDWA 2JKTI 4IVKA 4DE3A 1FOFA 4E3IA 4LFUA 1LI0A 2ZQ8A 2OOLA 4FH2A 1NRJA 4Y0UA 1J3WA 3WS5A 4R1GA 4JBFA 5L2FA 1ES2A 2G2UA 2HDUA 2OAP1 3OOVA 3NJAA 3OPPA 5DF7A 1W8QA 4JLFA 3RH8B 3AGDA 1TS8A 1FCOA 4B9OA 4FOFA 4N92A 3V67A 3T4JA 4BL2A 3NHQA 1OPXA 4BBUA 5DKLA 3FZCA 3IXDA 3T1RA 4DKIA 3PBNA 1ZTUA 1F2KA 2O9CA 5J8XA 4PAUA 1SKOA 1K57C 3LIBA 3WS4A 1PW8A 2XQZA 3IF6A 3G30A 2C6WB 2Y79A 1KDSA 4KZ7A 5HZHA 1PI5A 2KLIA 5F69A 1LLBA 3UMEA 2V9AA 4M4XA 3CWFA 3LGOA 3PBSA 4JXWA 4KG5A 4D60A 2LB9A 4I3AA 4JXSA 5TGFA 2VK3A 2OLUA 2HDRA 4NXEA 3GR2A 1CI9A 4LPZA 3MKFA 4ZDXA 3ITAA 3GV9A 3BFEA 2VX8A 2W3EA 4HIAA 4LV0A 2Y2JA 5EECA 2ZD8A 1MPLA 1ES4A 3LR4A 4HESA 1JVJA 2V8CA 3ZQ5A 2EX8A 3ZG8B 3KO6A 4P6ZS 1ODVA 2XR0A 3FYZA 3D72A 5F1FA 3UB9A 4LRXC 1BSGA 1D06A 1ACFA 2DCFA 3LY3A 2A49A 5CEDA 1G6AA 2HV1A 4M3KA 3CLOA 3HVFA 1S66L 1H8ZA 3HLFA 3AGFA 4DE2A 1GHMA 5CERA 4OQIA 1BLCA 2VKSA 3SZTA 2W3GA 2J3TC 1I2SA 1RGZA 1CK3A 2H28A 4F94A 4HI4A 1K6SA 2HDSA 3ZYTA 2WZZA 2K7SA 2XSSA 1OTIA 1MC0A 4I3JA 1OT9A 3ZDJA 5DJUA 2EFUA 4G3KA 2IWDA 4PHTA 1ONGA 1O7EA 4DRTA 5FATA 4MN5A 4F3LA 4UQIM 4C75A 3B3XA 3KSGA 3WS1A 1LI9A 2XH9A 1JTDA 2PBDP 4IBRA 3SH7A 5FEGA 2VV7A 1CJFA 1DJBA 1BUEA 4UHUA 4OP8A 4R6LA 3KYZA 4E6XA 1JTGA 2HGVA 1OT6A 1PRQA 4E04A 2D02A 2HDQA 3KX0X 1FSYA 5GLBA 4MCWA 5KZHA 2DNSA 3PAEA 2BLSA 5I5LA 3OPRA 3LCEA 4MN6A 4S2OA 3RFBA 4OOMA 2H0TA 4E3LA 3IXBA 3MXSA 1P97A 4WL9A 3OLOA 5A93A 5HAPA 4MMNA 1XPBA 5G4YA 3CI6A 4HEFA 5AVFA 4IHQA 3O86A 4FUWA 2WK0A 5E43A 2V1BA 5L8MA 1YMSA 3P98A 1KE4A 3M6BA 3P01A 3RJUA 3IWIA 2WUQA 5IT5A 3VOYA 5HWTA 2ZMFA 3DWKA 1Z09A 3QP4A 3W4PA 5HDCA 3R4KA 3F1PA 1DP6A 3ICYA 2M1CA 3ZG5A 4WEJA 4ARZB 5J4EA 1L2SA 1UGUA 1XFNA 4CJNA 5DFXA 4CQHA 1JNUA 3ZVTA 3L7HA 1W5DA 5HARA 4LCMA 1Q2QA 2ZC3B 4WBGA 3ZG7B 5KMWA 4Y2FA 3H82A 3UPNA 3S7QA 1TVFA 1MZUA 2JKRI 4Q0IA 1BULA 1Y4OA 3KYEA 4KZ8A 2Y4AA 1YLWA 1BT5A 3CAXA 4GKUA 4HJ3A 1H5XA 4B4XA 4OLGA 4LCLA 2PRFA 4E3MA 3MMHA 4K91A 3R7WB 4GHIA 3B33A 3HUMA 1W79A 3CG5A 1PW1A 4HH2A 1NXYA 3UDFA 1PNEA 3IS2B 4PPRA 3MFDA 3TG9A 1FR6A 3OZHA 1VEUB 3CUEA 1SKFA 4UQIS 2V0WA 5GL9A 3HUNA 3P7NA 2Y2NA 3IXHA 4BQMA 4G3WA 4QB8A 5TR7A 2PAVP 1RP5A 1ZG4A 5EE8A 4CLCA 1TS0A 2E8IA 1ONHA 3EGXC 3FC7A 3E4QA 4XUZA 3JVUA 1EW0A 3NI9A 3ZNYA 3HL9A 4EERA 5FSRA 3MXRA 4OONA 1F5MA 2ZL1A 4GS9B 1HTZA 5A8BA 3UNWA 4Y7PA 4KZAA 3LI8A 3VP1A 5L10A 3O87A 1I2WA 3OPHA 2Y2KA 3HLDA 4E3JA 3C4OA 1XA7A 3Q07A 4B88A 2GJ3A 1J9MA 3ISGA 4BLMA 1PI4A 1ESIA 4EQ1A 1DJAA 4X1LA 2L4RA 2B5RA 1YT4A 1H0MA 4K0WA 3H7WB 2ZC6B 3IBRA 2XFSA 3FKWA 1RGYA 2WKIA 5EVIB 1YSQA 5IHVA 5F83A 2QHKA 2P9VA 2WGIA 2ZQCA 1OTDA 3N6IA 2LB5A 2P74A 3W2ZA 3SOIA 2ZBBA 5FI2A 1PZOA 2QPNA 4OOLA 5EUAA 3BFCA 1HZOA 1W63Q 1DP8A 2X02A 4PM8A 4ZAMA 1IYQA 2JC7A 3LR3A 1UWPX 4UA6A 4FCFA 4OPYA 4L9FA 2VZWA 3A0RA 1S1ZA 3LR5A 4NXGA 3CJMA 5EVLA 2ZQ9A 2Y59A 3ULFA 3PXPA 5FL3A 1FIKA 5EVID 3A0VA 4WMCA 3ITBA 1S4SA 1HD8A 4WYYA 3C2WA 1K56D 2EX6A 1ERQA 3ZVWA 5JYPA 1H8YA 3IQAA 5HWVA 1GSWA 1GA9A 5F1GA 5AVEA 1GCEA 1S1YA 5A91A 2W27A 4NXFA 5G18A 2H10A 2E8JA 2Y2IA 4X56A 2H0YA 2WYXA 3OPLA 3T4LA 4CLCE 4LGWA 4B93A 3EQUA 5HAQA 4DE1A 3MZFA 4NK3A 3G4PA 3O88A 5DKKA 4GD6A 3S22A 4BBVA 4MLLA 5HX9A 3HLCA 3IF5A 3OBFA 2DRWA 4KUOA 1BLSA 3VMAA 4HQAA 3T4TA 1XJ4A 2XK1A 3Q7VB 4OVDA 3FPWA 4E3KA 2EX2A 1EROA 4Y13A 2ZC7A 2ZOIA 4HBTA 4ID4A 1MWTA 3E2LA 4IJGA 3VV4A 4O7DA 4U0XA 1TDGA 4JPMA 1IEMA 2BTFP 2EXAA 3F1NB 3W4QA 3H9WA 5IU1A 4LV2A 4BL3A 1OJ5A 4BD1A 3C30A 4BWIA 5CGXA 5MC7A 3RXWA 1BYWA 2FH5A 1KGGA 4DXCA 3T1SA 3LR0A 5FQKA 1VETB 5CRFA 3C4PA 3QP2A 1WA9A 3MQQA 1XJ2A 2HJ9C 2C5WB 2DMWA 1FCMA 5FAQA 5CXWA 2Y2OA 2EA9A 3NOPC 2HP6A 1PYYA 5F82A 1F98A 4GDBA 2X01A 3T50A 3MF0A 1OTEA 4Q8IA 1AXBA 4EQIA 2W1RA 4EUZA 3NY4A 2VV8A 2XFTA 1N9NA 5FQ9A 3QP5A 3ZFZA 5I94A 3NCKA 2ZJ9A 4UA7A 5HDSA 3CPTA 4GB7A 2FZ0A 5FAPA 4Y17A 5DF8A 3OCNA 5GHYA 5TFQA 3N8RA 1LL9A 2V1AA 1GA0A 5EM1A 3TE8A 2PHYA 1CQAA 1XKZA 5FQJA 3HCYA 4IBXA 1SKOB 3MZEA 3GRJA 4P87A 2WKHA 4WF0A 3V39A 3V3SA 2A24A 1YLZA 3C8CA 1OTAA 5M19A 3G34A 4D2OA 4DJ2A 3MBZA 3UDXA 3HLWA 4OPQA 4PM7A 3LICA 3MQOA 4JGQA 4NETA 3T4OA 4S2LA 4IUKA 2V20A 5HAIA 1P9WA 3BQAA 3KSFA 2J3TD 2ZM0A 3S1YA 4C6YA 1WYBA 4MNRA 5BOHA 4EBLA 1KGEA 3IWOA 2D01A 2JCHA 4O01A 2GDNA 3M2KA 4DJ3A 3EEAA 3A3JA 4EWFA 2EXBA 3TJZC 1ES5A 1OJGA 5EOEA 4OOYA 2Y2HA 2V1ZA 3HREA 4ZRRA 5DJTA 4NKPA 4R4SA 4YOFA 2G2WA 1XFQA 3DW0A 2B02A 4RQ9A 3NOTC 5KSHA 4QPRA 4OP5A 1D1JA 2I72A 3BECA 3EWKA 4HNBA 4HP9A 3NDGA 3IF6C 5KSCA 4OQ0A 5FQIA 5GLCA 2WADA 4EXOA 4HY8A 1IFQA 2YKFA 2WKRA 3IX8A 4Y0OA 4L9GA 2WKEA 3G2ZA 4Y3IA 1XP4A 4NXBA 4R23A 3NBLA 4GD8A 5E2FA 4KZ3A 2W1TA 2WGWA 5C5KA 4NEED 4E3NA 2OWHA 1M6KA 4EV4A 3TOIA 1V9YA 1TD5A 4F3LB 5CECA 1W7FA 4DDSA 3FV7A 2G7UA 4QD4A 3MZDA 3LO7A 2HZ5A 3MQ0A 3IXGA 4Z9QA 3PYPA 1Q2PA 3ZGAB 2VA0A 1YLYA 1FR1A 2VLGA 5DF9A 3LEQA 5E2EA 3BFFA 1N9OA 4XT2B 2W3DA 2Q9NA 1K4EA 5CGWA 1Y28A 1TS6A 2ZM8A 3VE3A 5M1AA 3PTEA 4H6JA 3UE1A 4EUVA 3F1OA 3ZG9B 2XLNA 2JN7A 3C7UA 2XEPA 3BLSA 4MBKA 1SZVA 3UO9A 4QY6A 3S7OA 3WRTA 3UE0A 1YPRA 4P0MA 4JGOA 1GHIA 1SHVA 3AGEA 4U0TA 3BYDA 2QMIA 2GZAA 3L9KA 4DDYA 4MEZA 1H3QA 2KX6A 4H8RA 3UE6A 4QWOA 5GHZA 3VE4A 2VV6A 3DWZA 2L0WA 4GLQA 3QP8A 5HL6A 3T4SA 4WM9A 3FPVA 4JKTA 1NWZA 3F1PB 4HJ4A 1KOUA 4EBNA 2K2NA 4X1MA 3B47A 1KVLA 4RVAA 5TJJA 4LRZE 3BM6A 2ZMAA 4L0LA 3LEZA 3QP6A 2IWBA 3BFDA 5F5YA 3DTKA 3H82B 1C3BA 3LYXA 1T1BA 4EBPA 4DE0A 4KQDA 3N7WA 1HVBA 3A3IA 4DMZA 4JXGA 4OLDA 4QY5A 3G35A 3E2KA 3G2YA 1YMXA 1WE4A 3T4KA 1XGJA 1P9RA 3PBRA 5CHJA 3TSGA 3A3FA 4GHIB 4KZBA 2M7VA 3HLBA 2PD7A 3D9YA 4DN0A 4OH0A 1CI8A 3BY9A 3ZG0A 2W3HA 1K56A 3IH8A 2PYRA 4N9LA 4LV1A 3MS6A 2ZMVA 3QHYA 2ZQDA 4R0QA 2FFYA 4CLCB 1XJ6A 1S4RA 2XA7M 4BJPA 2WZXA 2XD5A 3S7PA 1DRMA 4OPZA 4FH4A 1IYSA 4O0PA 4Q0HA 3DBAA 4JGPA 2HJEA 2Y2PA 3EGDC 3U2AA 3MFXA 4K08A 2W0NA 2ZL1B 3SW1A 2ZC4B 1QMEA 2V2FF 5TBMA 1T1AA 3S7NA 4JF4A 4DXBA 4N9KA 2B95A 5CHUA 4X53A 3W8KA 1BZAA 4ETZA 2PR6A 1K54A 1K38A 1E3UD 1LL5A 5L09A 4BBTA 2WKPA 4N1XA 5F68A 3T12B 4WEKA 3D3OA 4JF5A 3CUEC 3NC8A 3PR6A 1IYPA 4DF6A 3IX3A 1X0OA 4K0XA 3PBQA 1GSXA 4NG2A 1K0KA 4EW7A 4CLCC 2L1MA 3BEBA 2GX5A 4BMWA 3MKEA 2IWCA 4GZBA 5G4ZA 3IHAA 4Y15A 1JWPA 3G31A 4UAAA 3LFVA 2J8YA 1LSWA 2XF3A 2P9VB 4Y5FA 3QNBA 4S2NA 1NJ4A 1FSWA 2K31A 1YLJA 1W8YA 3DTMA 1BLPA 1ALQA 3VP0A 3VOZA 2MJ6A 2Y55A
chains in the Genus database with same CATH topology
4Y15A 3JPUA 2Q0OA 4LFUA 3IX4A 4Y17A 1H0MA 3IX8A 3QP2A 1L3LA 2UV0E 3IX3A 5L07A 4LGWA 3QP1A 3QP4A 4NG2A 2AVXA 5L09A 3QP6A 4Y13A 3QP8A 3QP5A 3SZTA 5L10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y15 A;  3JPU A;  2Q0O A;  4LFU A;  3IX4 A;  4Y17 A;  1H0M A;  3IX8 A;  3QP2 A;  1L3L A;  2UV0 E;  3IX3 A;  5L07 A;  4LGW A;  3QP1 A;  3QP4 A;  4NG2 A;  2AVX A;  5L09 A;  3QP6 A;  4Y13 A;  3QP8 A;  3QP5 A;  3SZT A;  5L10 A; 
#chains in the Genus database with same CATH topology
 1K57 A;  1KGF A;  2O9A A;  3GDI A;  4QHC A;  3PBO A;  4PKY A;  1K55 A;  5CHM A;  1V9Z A;  5AQ7 A;  5M18 A;  1E25 A;  3UE3 A;  4X55 A;  3HBR A;  3K2N A;  3E4P A;  2J3W A;  3NDE A;  4HHD A;  5EV0 A;  2Y2Q A;  1YLP A;  2QYB A;  1QMF A;  2PU4 A;  1G6O A;  3BW6 A;  4II7 A;  2QZ6 A;  2BAS A;  3JVV A;  3U4L P;  2X71 A;  2QJ7 A;  4IUH A;  1L0F A;  1ZG6 A;  2CC1 A;  4RA7 A;  3KYQ A;  1L0E A;  1T18 A;  3VP2 A;  3IH9 A;  4RX2 A;  3LID A;  1K25 A;  1K54 C;  4MBF A;  2R9W A;  2XA7 S;  2O9B A;  1MWR A;  1BTL A;  2J9O A;  3RXX A;  1MKI A;  2VGJ A;  3GVB A;  1NLZ A;  4OKP A;  2OSU A;  4E6W A;  1WYC A;  1XA1 A;  4O8G A;  3UDI A;  3VP3 A;  4S2J A;  3C38 A;  3B42 A;  1D7E A;  2HF6 A;  3A0S A;  2O99 A;  4OQH A;  3EEH A;  4C3Q A;  4PM9 A;  4WMC D;  1PWG A;  2XRO A;  1GSV A;  2GNX A;  2V0U A;  2EWW A;  2EX9 A;  2HP9 A;  3VOL A;  4S2N C;  3UMD A;  3WS0 A;  4A5R A;  4L9E A;  3HUO A;  2M7U A;  2XRN A;  3VFF A;  4N1H A;  2PBY A;  5A90 A;  3MSH A;  3NUL A;  3GMW A;  3EQV A;  5CX7 A;  5HD5 A;  3CMZ A;  1MWS A;  1K55 C;  4RX3 A;  3C7V A;  3O5Y A;  1L0G A;  1TS7 A;  1G5U A;  4WZ4 A;  5CGS A;  1DY6 A;  3NIA A;  2FFF B;  4HBU A;  1NYM A;  3UN7 A;  5CTM A;  3IBJ A;  3WRZ A;  2PDR A;  4R3J A;  4HJ6 A;  4WZ5 A;  3HLE A;  3SS4 A;  4WEL A;  2OV5 A;  3LY4 A;  4KZ4 A;  3SH9 A;  3PBT A;  4KQO A;  3JYI A;  1PFL A;  5F6A A;  1IOU A;  4IED A;  2ZOH A;  5AQ9 A;  3TRC A;  4KZ6 A;  4LV3 A;  2Y2M A;  2Y91 A;  1W63 M;  2Y8H A;  3LIE A;  2UWX A;  4S2M A;  5EOO A;  3IF6 B;  3V50 A;  5HDD A;  4FD8 A;  3NOU C;  2PD8 A;  1VHM A;  4U3T A;  4PM5 A;  3VP4 A;  5DTT A;  4EEU A;  4IVI A;  3S4X A;  2XGN A;  3PHY A;  4R4R A;  4GN2 A;  3CPT B;  1S67 L;  3E4O A;  4LRY C;  2Z6C A;  1FCN A;  1ES3 A;  2PT7 A;  1PZP A;  1SDN A;  1NLY A;  3N4I A;  1S6R A;  4JF6 A;  5HPF A;  4CPK A;  2PU2 A;  2WAF A;  2ZQ7 A;  1TEM A;  3OC2 A;  1NY0 A;  2Y2G A;  3V5M A;  2INW A;  2ZQA A;  4UA9 A;  2A24 B;  4XXR A;  1XXM A;  3RTY A;  1K6R A;  5AJG A;  5J7E A;  1N9L A;  1FIL A;  1U60 A;  5HW3 A;  4X68 A;  3E0Y A;  5AQB A;  1F9I A;  5K5B A;  5A92 A;  1Y54 A;  5FDH A;  2Z2M B;  3G6O A;  3MJQ A;  3T1X A;  1I5Q A;  1OME A;  3IHB A;  1YQS A;  2JKT M;  3BRM A;  3M2J A;  4JXV A;  4ZBE A;  4S2I A;  3VSK A;  3G32 A;  1MKM A;  5FQM A;  4FTX A;  3BQ8 A;  2RCX A;  3BWL A;  2JBF A;  1ZKJ A;  3W4O A;  3PAG A;  2PYP A;  4X69 A;  1K4F A;  4I38 A;  4XT2 A;  4PM6 A;  4BD0 A;  1SCW A;  4WZ5 C;  4R70 A;  4GCZ A;  4KZ5 A;  3ZNT A;  4ARZ A;  2J7V A;  4GOG A;  3GQZ A;  1HLU P;  4PKY G;  4KQR A;  4E3O A;  4I5S A;  2RL3 A;  5D3O A;  4EES A;  4I39 A;  3MR0 A;  4HP4 A;  2AVX A;  5CEB A;  2EWV A;  5E2G A;  4EEP A;  4LLO B;  3OCL A;  2YKH A;  4QU3 A;  4ETX A;  1MWU A;  4KG2 A;  2H5S A;  1CEF A;  3EOI A;  2W1T B;  2WGW B;  4XUX A;  5HPI A;  1NZO A;  4KEN B;  5HSQ A;  3R7W A;  1LSX A;  2CMN A;  4Y0T A;  1VM1 A;  4ESP A;  1A0K A;  4MDZ A;  1KE0 A;  1XGI A;  1GHP A;  5DTS A;  3T4Q A;  2O0Y A;  4HH3 A;  2WKQ A;  4YWZ A;  3IS2 A;  4P6B A;  4GW9 A;  1VEU A;  4MN7 A;  1XJ3 A;  4UEY A;  1NRF A;  4PMA A;  2QWS A;  5EPH A;  4G3V A;  1KVM A;  2QJ5 A;  1STZ A;  5FEF A;  1PWD A;  4YNR A;  2Z6D A;  3BY8 A;  4X6T A;  1G68 A;  5DFY A;  1SDE A;  2HPB A;  5FI7 A;  1IEL A;  3BLM A;  4OQG A;  4H6J B;  1H8M A;  5FAS A;  2VJW A;  3F1O B;  2JE5 A;  4GS9 A;  3UB7 A;  1EI5 A;  1ERM A;  4KUK A;  5HWW A;  4FSF A;  4QJG A;  1ESU A;  5EM0 A;  4BEN A;  1E3U A;  2I9V A;  3WS2 A;  4S2K A;  3HLG A;  4JGR A;  2ZLY A;  1Z6F A;  3C5A A;  5U47 A;  3DTE A;  3MXQ A;  2VGK A;  4GDN A;  3KSH A;  2BG1 A;  2J9P A;  3UPP A;  1KE3 A;  4GNU A;  2JKF A;  3Q82 A;  3H7W A;  1LSV A;  3JPU A;  3SS5 A;  4WUJ A;  4HOI A;  4RYE A;  4P85 A;  3BFG A;  1P0Z A;  5EVI A;  2EFX A;  3D4F A;  5J3W A;  5GLA A;  4ZJ3 A;  3VFH A;  5HFO A;  3N8S A;  3TW8 A;  5GHX A;  1G28 A;  3A3E A;  2QKP A;  1IYO A;  3O3V A;  1CF0 A;  1M40 A;  2J80 A;  2VGL M;  1ZC2 A;  2Y2L A;  4WN5 A;  4EU0 A;  3HJK A;  1ZHH B;  4AFI A;  4WLA A;  2WGV A;  2P08 A;  2Z2L B;  2ZM2 A;  2IA2 A;  3Q81 A;  2P7J A;  1LL8 A;  3SH8 A;  1TF1 A;  5AQA A;  3A3D A;  4R3B A;  2JKG A;  1N4O A;  2Q9M A;  4LEN A;  1MY8 A;  4Z1W A;  5L07 A;  5DVA A;  3M6H A;  2R9X A;  3HJI A;  4YFM A;  4YIN A;  5FQQ A;  4ZJ1 A;  2ACG A;  4KQQ A;  4X25 A;  2OLV A;  1NZU A;  2R78 A;  2ZC5 B;  3LUQ A;  1YAX A;  1RCJ A;  5LBR A;  3UB5 P;  3UB6 A;  3K3C A;  1L3L A;  1PIO A;  1IKG A;  1T19 A;  4Q0J A;  3QP1 A;  1EWZ A;  1JWV A;  1LHY A;  3QNC A;  1XX2 A;  4CLC D;  4ME4 A;  1TDL A;  2XDM A;  2A3U A;  4R38 A;  2A2L A;  3LI9 A;  3WWX A;  2PR5 A;  3E98 A;  4GJ4 A;  1NYY A;  3CIT A;  3I7J A;  3VSL A;  1IKI A;  5FA7 A;  3LIA A;  4ZTK A;  3FG8 A;  3P09 A;  3KSI A;  5FAO A;  3N8L A;  4EET B;  2JKR M;  2UV0 E;  5TBM B;  5HL1 A;  4S2P A;  1N9B A;  5FDS A;  2V8F A;  1AWI A;  4MBH A;  1T1C A;  5HD3 A;  5CTN A;  5E2H A;  1O07 A;  1LT0 A;  5EVI C;  3Q7Z A;  1DJC A;  2NUT C;  2NUP C;  3Q7V A;  1VB6 A;  1DP9 A;  1YKD A;  2WAE A;  3DTI A;  3GTC A;  2KOI A;  3UY6 A;  1MBL A;  1PWC A;  3CZD A;  3IT9 A;  4B4Z A;  2JHE A;  5EFW A;  2VEA A;  2OWJ A;  3DAV A;  5EVE A;  2B18 A;  2OAQ 1;  1VQQ A;  4P6Z M;  3NEC A;  1MXO A;  5GLD A;  3F1N A;  1S0W A;  3ZHH A;  2HP5 A;  1L0D A;  3FWL A;  1BLH A;  1CEG A;  4I3I A;  1YSP A;  2XD1 A;  4KZ9 A;  1YLT A;  3T1Q B;  3V3R A;  3FKV A;  1JWZ A;  5DTK A;  4ZJ2 A;  5KIZ A;  1VET A;  5IS1 A;  3GEC A;  4R3A A;  1FQG A;  2Q0O A;  3UPO A;  3IX4 A;  5FI6 A;  4KG6 A;  3LIF A;  1UWN X;  3Q1F A;  2P04 A;  2VGL S;  3K3D A;  3UB8 A;  4OPR A;  1E4D A;  3GSG A;  3SS3 A;  5JYO A;  3IWQ A;  1YM1 A;  2W3F A;  1OTB A;  3ZCZ A;  3BJN A;  2KDK A;  3CHW P;  1KDW A;  2JKT I;  4IVK A;  4DE3 A;  1FOF A;  4E3I A;  4LFU A;  1LI0 A;  2ZQ8 A;  2OOL A;  4FH2 A;  1NRJ A;  4Y0U A;  1J3W A;  3WS5 A;  4R1G A;  4JBF A;  5L2F A;  1ES2 A;  2G2U A;  2HDU A;  2OAP 1;  3OOV A;  3NJA A;  3OPP A;  5DF7 A;  1W8Q A;  4JLF A;  3RH8 B;  3AGD A;  1TS8 A;  1FCO A;  4B9O A;  4FOF A;  4N92 A;  3V67 A;  3T4J A;  4BL2 A;  3NHQ A;  1OPX A;  4BBU A;  5DKL A;  3FZC A;  3IXD A;  3T1R A;  4DKI A;  3PBN A;  1ZTU A;  1F2K A;  2O9C A;  5J8X A;  4PAU A;  1SKO A;  1K57 C;  3LIB A;  3WS4 A;  1PW8 A;  2XQZ A;  3IF6 A;  3G30 A;  2C6W B;  2Y79 A;  1KDS A;  4KZ7 A;  5HZH A;  1PI5 A;  2KLI A;  5F69 A;  1LLB A;  3UME A;  2V9A A;  4M4X A;  3CWF A;  3LGO A;  3PBS A;  4JXW A;  4KG5 A;  4D60 A;  2LB9 A;  4I3A A;  4JXS A;  5TGF A;  2VK3 A;  2OLU A;  2HDR A;  4NXE A;  3GR2 A;  1CI9 A;  4LPZ A;  3MKF A;  4ZDX A;  3ITA A;  3GV9 A;  3BFE A;  2VX8 A;  2W3E A;  4HIA A;  4LV0 A;  2Y2J A;  5EEC A;  2ZD8 A;  1MPL A;  1ES4 A;  3LR4 A;  4HES A;  1JVJ A;  2V8C A;  3ZQ5 A;  2EX8 A;  3ZG8 B;  3KO6 A;  4P6Z S;  1ODV A;  2XR0 A;  3FYZ A;  3D72 A;  5F1F A;  3UB9 A;  4LRX C;  1BSG A;  1D06 A;  1ACF A;  2DCF A;  3LY3 A;  2A49 A;  5CED A;  1G6A A;  2HV1 A;  4M3K A;  3CLO A;  3HVF A;  1S66 L;  1H8Z A;  3HLF A;  3AGF A;  4DE2 A;  1GHM A;  5CER A;  4OQI A;  1BLC A;  2VKS A;  3SZT A;  2W3G A;  2J3T C;  1I2S A;  1RGZ A;  1CK3 A;  2H28 A;  4F94 A;  4HI4 A;  1K6S A;  2HDS A;  3ZYT A;  2WZZ A;  2K7S A;  2XSS A;  1OTI A;  1MC0 A;  4I3J A;  1OT9 A;  3ZDJ A;  5DJU A;  2EFU A;  4G3K A;  2IWD A;  4PHT A;  1ONG A;  1O7E A;  4DRT A;  5FAT A;  4MN5 A;  4F3L A;  4UQI M;  4C75 A;  3B3X A;  3KSG A;  3WS1 A;  1LI9 A;  2XH9 A;  1JTD A;  2PBD P;  4IBR A;  3SH7 A;  5FEG A;  2VV7 A;  1CJF A;  1DJB A;  1BUE A;  4UHU A;  4OP8 A;  4R6L A;  3KYZ A;  4E6X A;  1JTG A;  2HGV A;  1OT6 A;  1PRQ A;  4E04 A;  2D02 A;  2HDQ A;  3KX0 X;  1FSY A;  5GLB A;  4MCW A;  5KZH A;  2DNS A;  3PAE A;  2BLS A;  5I5L A;  3OPR A;  3LCE A;  4MN6 A;  4S2O A;  3RFB A;  4OOM A;  2H0T A;  4E3L A;  3IXB A;  3MXS A;  1P97 A;  4WL9 A;  3OLO A;  5A93 A;  5HAP A;  4MMN A;  1XPB A;  5G4Y A;  3CI6 A;  4HEF A;  5AVF A;  4IHQ A;  3O86 A;  4FUW A;  2WK0 A;  5E43 A;  2V1B A;  5L8M A;  1YMS A;  3P98 A;  1KE4 A;  3M6B A;  3P01 A;  3RJU A;  3IWI A;  2WUQ A;  5IT5 A;  3VOY A;  5HWT A;  2ZMF A;  3DWK A;  1Z09 A;  3QP4 A;  3W4P A;  5HDC A;  3R4K A;  3F1P A;  1DP6 A;  3ICY A;  2M1C A;  3ZG5 A;  4WEJ A;  4ARZ B;  5J4E A;  1L2S A;  1UGU A;  1XFN A;  4CJN A;  5DFX A;  4CQH A;  1JNU A;  3ZVT A;  3L7H A;  1W5D A;  5HAR A;  4LCM A;  1Q2Q A;  2ZC3 B;  4WBG A;  3ZG7 B;  5KMW A;  4Y2F A;  3H82 A;  3UPN A;  3S7Q A;  1TVF A;  1MZU A;  2JKR I;  4Q0I A;  1BUL A;  1Y4O A;  3KYE A;  4KZ8 A;  2Y4A A;  1YLW A;  1BT5 A;  3CAX A;  4GKU A;  4HJ3 A;  1H5X A;  4B4X A;  4OLG A;  4LCL A;  2PRF A;  4E3M A;  3MMH A;  4K91 A;  3R7W B;  4GHI A;  3B33 A;  3HUM A;  1W79 A;  3CG5 A;  1PW1 A;  4HH2 A;  1NXY A;  3UDF A;  1PNE A;  3IS2 B;  4PPR A;  3MFD A;  3TG9 A;  1FR6 A;  3OZH A;  1VEU B;  3CUE A;  1SKF A;  4UQI S;  2V0W A;  5GL9 A;  3HUN A;  3P7N A;  2Y2N A;  3IXH A;  4BQM A;  4G3W A;  4QB8 A;  5TR7 A;  2PAV P;  1RP5 A;  1ZG4 A;  5EE8 A;  4CLC A;  1TS0 A;  2E8I A;  1ONH A;  3EGX C;  3FC7 A;  3E4Q A;  4XUZ A;  3JVU A;  1EW0 A;  3NI9 A;  3ZNY A;  3HL9 A;  4EER A;  5FSR A;  3MXR A;  4OON A;  1F5M A;  2ZL1 A;  4GS9 B;  1HTZ A;  5A8B A;  3UNW A;  4Y7P A;  4KZA A;  3LI8 A;  3VP1 A;  5L10 A;  3O87 A;  1I2W A;  3OPH A;  2Y2K A;  3HLD A;  4E3J A;  3C4O A;  1XA7 A;  3Q07 A;  4B88 A;  2GJ3 A;  1J9M A;  3ISG A;  4BLM A;  1PI4 A;  1ESI A;  4EQ1 A;  1DJA A;  4X1L A;  2L4R A;  2B5R A;  1YT4 A;  1H0M A;  4K0W A;  3H7W B;  2ZC6 B;  3IBR A;  2XFS A;  3FKW A;  1RGY A;  2WKI A;  5EVI B;  1YSQ A;  5IHV A;  5F83 A;  2QHK A;  2P9V A;  2WGI A;  2ZQC A;  1OTD A;  3N6I A;  2LB5 A;  2P74 A;  3W2Z A;  3SOI A;  2ZBB A;  5FI2 A;  1PZO A;  2QPN A;  4OOL A;  5EUA A;  3BFC A;  1HZO A;  1W63 Q;  1DP8 A;  2X02 A;  4PM8 A;  4ZAM A;  1IYQ A;  2JC7 A;  3LR3 A;  1UWP X;  4UA6 A;  4FCF A;  4OPY A;  4L9F A;  2VZW A;  3A0R A;  1S1Z A;  3LR5 A;  4NXG A;  3CJM A;  5EVL A;  2ZQ9 A;  2Y59 A;  3ULF A;  3PXP A;  5FL3 A;  1FIK A;  5EVI D;  3A0V A;  4WMC A;  3ITB A;  1S4S A;  1HD8 A;  4WYY A;  3C2W A;  1K56 D;  2EX6 A;  1ERQ A;  3ZVW A;  5JYP A;  1H8Y A;  3IQA A;  5HWV A;  1GSW A;  1GA9 A;  5F1G A;  5AVE A;  1GCE A;  1S1Y A;  5A91 A;  2W27 A;  4NXF A;  5G18 A;  2H10 A;  2E8J A;  2Y2I A;  4X56 A;  2H0Y A;  2WYX A;  3OPL A;  3T4L A;  4CLC E;  4LGW A;  4B93 A;  3EQU A;  5HAQ A;  4DE1 A;  3MZF A;  4NK3 A;  3G4P A;  3O88 A;  5DKK A;  4GD6 A;  3S22 A;  4BBV A;  4MLL A;  5HX9 A;  3HLC A;  3IF5 A;  3OBF A;  2DRW A;  4KUO A;  1BLS A;  3VMA A;  4HQA A;  3T4T A;  1XJ4 A;  2XK1 A;  3Q7V B;  4OVD A;  3FPW A;  4E3K A;  2EX2 A;  1ERO A;  4Y13 A;  2ZC7 A;  2ZOI A;  4HBT A;  4ID4 A;  1MWT A;  3E2L A;  4IJG A;  3VV4 A;  4O7D A;  4U0X A;  1TDG A;  4JPM A;  1IEM A;  2BTF P;  2EXA A;  3F1N B;  3W4Q A;  3H9W A;  5IU1 A;  4LV2 A;  4BL3 A;  1OJ5 A;  4BD1 A;  3C30 A;  4BWI A;  5CGX A;  5MC7 A;  3RXW A;  1BYW A;  2FH5 A;  1KGG A;  4DXC A;  3T1S A;  3LR0 A;  5FQK A;  1VET B;  5CRF A;  3C4P A;  3QP2 A;  1WA9 A;  3MQQ A;  1XJ2 A;  2HJ9 C;  2C5W B;  2DMW A;  1FCM A;  5FAQ A;  5CXW A;  2Y2O A;  2EA9 A;  3NOP C;  2HP6 A;  1PYY A;  5F82 A;  1F98 A;  4GDB A;  2X01 A;  3T50 A;  3MF0 A;  1OTE A;  4Q8I A;  1AXB A;  4EQI A;  2W1R A;  4EUZ A;  3NY4 A;  2VV8 A;  2XFT A;  1N9N A;  5FQ9 A;  3QP5 A;  3ZFZ A;  5I94 A;  3NCK A;  2ZJ9 A;  4UA7 A;  5HDS A;  3CPT A;  4GB7 A;  2FZ0 A;  5FAP A;  4Y17 A;  5DF8 A;  3OCN A;  5GHY A;  5TFQ A;  3N8R A;  1LL9 A;  2V1A A;  1GA0 A;  5EM1 A;  3TE8 A;  2PHY A;  1CQA A;  1XKZ A;  5FQJ A;  3HCY A;  4IBX A;  1SKO B;  3MZE A;  3GRJ A;  4P87 A;  2WKH A;  4WF0 A;  3V39 A;  3V3S A;  2A24 A;  1YLZ A;  3C8C A;  1OTA A;  5M19 A;  3G34 A;  4D2O A;  4DJ2 A;  3MBZ A;  3UDX A;  3HLW A;  4OPQ A;  4PM7 A;  3LIC A;  3MQO A;  4JGQ A;  4NET A;  3T4O A;  4S2L A;  4IUK A;  2V20 A;  5HAI A;  1P9W A;  3BQA A;  3KSF A;  2J3T D;  2ZM0 A;  3S1Y A;  4C6Y A;  1WYB A;  4MNR A;  5BOH A;  4EBL A;  1KGE A;  3IWO A;  2D01 A;  2JCH A;  4O01 A;  2GDN A;  3M2K A;  4DJ3 A;  3EEA A;  3A3J A;  4EWF A;  2EXB A;  3TJZ C;  1ES5 A;  1OJG A;  5EOE A;  4OOY A;  2Y2H A;  2V1Z A;  3HRE A;  4ZRR A;  5DJT A;  4NKP A;  4R4S A;  4YOF A;  2G2W A;  1XFQ A;  3DW0 A;  2B02 A;  4RQ9 A;  3NOT C;  5KSH A;  4QPR A;  4OP5 A;  1D1J A;  2I72 A;  3BEC A;  3EWK A;  4HNB A;  4HP9 A;  3NDG A;  3IF6 C;  5KSC A;  4OQ0 A;  5FQI A;  5GLC A;  2WAD A;  4EXO A;  4HY8 A;  1IFQ A;  2YKF A;  2WKR A;  3IX8 A;  4Y0O A;  4L9G A;  2WKE A;  3G2Z A;  4Y3I A;  1XP4 A;  4NXB A;  4R23 A;  3NBL A;  4GD8 A;  5E2F A;  4KZ3 A;  2W1T A;  2WGW A;  5C5K A;  4NEE D;  4E3N A;  2OWH A;  1M6K A;  4EV4 A;  3TOI A;  1V9Y A;  1TD5 A;  4F3L B;  5CEC A;  1W7F A;  4DDS A;  3FV7 A;  2G7U A;  4QD4 A;  3MZD A;  3LO7 A;  2HZ5 A;  3MQ0 A;  3IXG A;  4Z9Q A;  3PYP A;  1Q2P A;  3ZGA B;  2VA0 A;  1YLY A;  1FR1 A;  2VLG A;  5DF9 A;  3LEQ A;  5E2E A;  3BFF A;  1N9O A;  4XT2 B;  2W3D A;  2Q9N A;  1K4E A;  5CGW A;  1Y28 A;  1TS6 A;  2ZM8 A;  3VE3 A;  5M1A A;  3PTE A;  4H6J A;  3UE1 A;  4EUV A;  3F1O A;  3ZG9 B;  2XLN A;  2JN7 A;  3C7U A;  2XEP A;  3BLS A;  4MBK A;  1SZV A;  3UO9 A;  4QY6 A;  3S7O A;  3WRT A;  3UE0 A;  1YPR A;  4P0M A;  4JGO A;  1GHI A;  1SHV A;  3AGE A;  4U0T A;  3BYD A;  2QMI A;  2GZA A;  3L9K A;  4DDY A;  4MEZ A;  1H3Q A;  2KX6 A;  4H8R A;  3UE6 A;  4QWO A;  5GHZ A;  3VE4 A;  2VV6 A;  3DWZ A;  2L0W A;  4GLQ A;  3QP8 A;  5HL6 A;  3T4S A;  4WM9 A;  3FPV A;  4JKT A;  1NWZ A;  3F1P B;  4HJ4 A;  1KOU A;  4EBN A;  2K2N A;  4X1M A;  3B47 A;  1KVL A;  4RVA A;  5TJJ A;  4LRZ E;  3BM6 A;  2ZMA A;  4L0L A;  3LEZ A;  3QP6 A;  2IWB A;  3BFD A;  5F5Y A;  3DTK A;  3H82 B;  1C3B A;  3LYX A;  1T1B A;  4EBP A;  4DE0 A;  4KQD A;  3N7W A;  1HVB A;  3A3I A;  4DMZ A;  4JXG A;  4OLD A;  4QY5 A;  3G35 A;  3E2K A;  3G2Y A;  1YMX A;  1WE4 A;  3T4K A;  1XGJ A;  1P9R A;  3PBR A;  5CHJ A;  3TSG A;  3A3F A;  4GHI B;  4KZB A;  2M7V A;  3HLB A;  2PD7 A;  3D9Y A;  4DN0 A;  4OH0 A;  1CI8 A;  3BY9 A;  3ZG0 A;  2W3H A;  1K56 A;  3IH8 A;  2PYR A;  4N9L A;  4LV1 A;  3MS6 A;  2ZMV A;  3QHY A;  2ZQD A;  4R0Q A;  2FFY A;  4CLC B;  1XJ6 A;  1S4R A;  2XA7 M;  4BJP A;  2WZX A;  2XD5 A;  3S7P A;  1DRM A;  4OPZ A;  4FH4 A;  1IYS A;  4O0P A;  4Q0H A;  3DBA A;  4JGP A;  2HJE A;  2Y2P A;  3EGD C;  3U2A A;  3MFX A;  4K08 A;  2W0N A;  2ZL1 B;  3SW1 A;  2ZC4 B;  1QME A;  2V2F F;  5TBM A;  1T1A A;  3S7N A;  4JF4 A;  4DXB A;  4N9K A;  2B95 A;  5CHU A;  4X53 A;  3W8K A;  1BZA A;  4ETZ A;  2PR6 A;  1K54 A;  1K38 A;  1E3U D;  1LL5 A;  5L09 A;  4BBT A;  2WKP A;  4N1X A;  5F68 A;  3T12 B;  4WEK A;  3D3O A;  4JF5 A;  3CUE C;  3NC8 A;  3PR6 A;  1IYP A;  4DF6 A;  3IX3 A;  1X0O A;  4K0X A;  3PBQ A;  1GSX A;  4NG2 A;  1K0K A;  4EW7 A;  4CLC C;  2L1M A;  3BEB A;  2GX5 A;  4BMW A;  3MKE A;  2IWC A;  4GZB A;  5G4Z A;  3IHA A;  4Y15 A;  1JWP A;  3G31 A;  4UAA A;  3LFV A;  2J8Y A;  1LSW A;  2XF3 A;  2P9V B;  4Y5F A;  3QNB A;  4S2N A;  1NJ4 A;  1FSW A;  2K31 A;  1YLJ A;  1W8Y A;  3DTM A;  1BLP A;  1ALQ A;  3VP0 A;  3VOZ A;  2MJ6 A;  2Y55 A; 
#chains in the Genus database with same CATH homology
 4Y15 A;  3JPU A;  2Q0O A;  4LFU A;  3IX4 A;  4Y17 A;  1H0M A;  3IX8 A;  3QP2 A;  1L3L A;  2UV0 E;  3IX3 A;  5L07 A;  4LGW A;  3QP1 A;  3QP4 A;  4NG2 A;  2AVX A;  5L09 A;  3QP6 A;  4Y13 A;  3QP8 A;  3QP5 A;  3SZT A;  5L10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...