4NG2A

Crystal structure of lasr lbd-qsla complex from pseudomonas aeruginosa
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
166
structure length
166
Chain Sequence
b'ALVDGFLELERSSGKLEWSAILQKMASDLGFSKILFGLLPKDSQDYENAFIVGNYPAAWREHYDRAGYARVDPTVSHCTQSVLPIFWEPSIYQTRKQHEFFEEASAAGLVYGLTMPLHGARGELGALSLSVEAENRAEANRFMESVLPTLWMLKDYALQSGAGLAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional activator protein LasR
publication title QsIA disrupts LasR dimerization in antiactivation of bacterial quorum sensing
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription regulator
total genus 54
structure length 166
sequence length 166
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03472 Autoind_bind Autoinducer binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.80 Alpha Beta 2-Layer Sandwich Beta-Lactamase Transcription factor LuxR-like, autoinducer-binding domain 4ng2A00
4LFUA 3QP6A 2Q0OA 3QP2A 4LGWA 3IX4A 3QP1A 3QP5A 3IX8A 5L07A 5L09A 5L10A 1H0MA 3QP8A 4NG2A 3IX3A 4Y13A 3SZTA 3JPUA 3QP4A 2AVXA 4Y15A 4Y17A 1L3LA 2UV0E
chains in the Genus database with same CATH superfamily
2E8IA 1XA7A 3F1NA 1RCJA 2HJ9C 2B5RA 3V5MA 5L09A 2B18A 4F94A 3T4QA 4HP9A 3WS5A 5E43A 3M2KA 3W2ZA 1QMEA 4HNBA 3SW1A 3O87A 1FCNA 4EEUA 4MN5A 3MXRA 3GTCA 1L0EA 2W1TA 2G2UA 3WRTA 3L7HA 3ZG8B 4JLFA 4EQIA 3CJMA 5FDSA 3WRZA 3JVVA 3HUOA 2Y4AA 1FCMA 3MMHA 2QYBA 5DF9A 5F82A 1RGYA 4ZJ2A 2BASA 3S7QA 3E98A 2C5WB 4KZ9A 1BZAA 5IS1A 4U0TA 3V3SA 4C6YA 3K3CA 1FCOA 1XXMA 1YQSA 4IVKA 2B95A 4S2LA 4OP8A 4GHIB 2VV7A 2Y2OA 3BLMA 2ZMVA 1AWIA 5HDSA 3UE0A 3HREA 4B9OA 2PAVP 1Z09A 1BULA 3QP1A 2JC7A 3VE4A 2ZBBA 2WKRA 4ZJ1A 5MC7A 1SHVA 4OQGA 5HFOA 4QY6A 1CEGA 3PAGA 4S2IA 5M19A 2UV0E 3E2KA 1BLCA 4LV0A 4B88A 4K91A 3MKFA 1MKIA 5LBRA 4KQQA 1X0OA 3C5AA 1MKMA 4U0XA 5C5KA 5BOHA 4S2OA 4QWOA 3CUEC 2OWJA 2ZLYA 1YLTA 3MFXA 5L07A 4BBTA 2A49A 1XJ2A 4YWZA 1W63Q 1O7EA 3GVBA 1WE4A 3BFGA 3I7JA 4WBGA 3E4PA 3O3VA 3CPTB 1FR1A 2Y2JA 3FV7A 4Y0OA 1U60A 5HL1A 1V9ZA 3T1QB 3KYZA 3UNWA 1H0MA 1F9IA 3O5YA 4MMNA 2A3UA 2JKGA 3HLCA 5EM1A 4HP4A 4OKPA 1Q2QA 2VX8A 3HJKA 4H6JA 1HTZA 4HBUA 3W8KA 4DE2A 1LSVA 1W8YA 3CWFA 4QB8A 4OOLA 2EX6A 1H8ZA 2J9PA 2VGLM 3FWLA 2ZD8A 1PI5A 4KG6A 4E3MA 1XKZA 1PZOA 5DF7A 4OLDA 1LL9A 1P97A 5TFQA 1LHYA 2H0YA 4WEKA 3LIDA 3HLDA 1XJ3A 2NUTC 3UB5P 2VGLS 3D72A 4N1XA 3QP5A 4NG2A 4Y7PA 1ODVA 4QPRA 1NZOA 1ES5A 1DRMA 3ULFA 2V9AA 1AXBA 5J7EA 3IWQA 4BQMA 4OPQA 1DJAA 3QP2A 4PMAA 4P6ZS 1LI0A 4X53A 2VK3A 1TDLA 3VOLA 3LR3A 2DMWA 2ZM0A 3C7VA 1BYWA 3H7WA 2PYPA 4L9FA 3TOIA 3T1SA 5G18A 2OOLA 4ZBEA 4PAUA 5FATA 3CMZA 1SDEA 4RX2A 4GN2A 3LY4A 4Y17A 5EVIA 5HPFA 4KZBA 3MS6A 4GW9A 4O01A 1FSYA 4NK3A 4GD6A 1E3UA 1D1JA 2PU4A 5DVAA 4LV3A 2QJ5A 5A93A 3MZFA 2L4RA 5KZHA 2YKFA 2X01A 4DXBA 3ZHHA 4PM5A 3MXSA 3NOUC 5EVEA 1NJ4A 1T19A 3A3DA 3GQZA 4P6BA 2HP6A 2ZQ8A 1XX2A 3LFVA 5KSHA 3LIAA 4LV2A 4JKTA 2OSUA 5CGWA 1EW0A 3JYIA 2X02A 3VP2A 3S7OA 2ZMFA 4BLMA 1ACFA 1W79A 1FSWA 5EECA 3SS5A 4EETB 1DP6A 1YMXA 4XUZA 2OV5A 3N4IA 2HZ5A 3HUNA 1TD5A 5DTKA 3ITAA 2W3DA 3IF6B 3LR4A 1BLPA 3B3XA 3SOIA 1W7FA 3BY9A 2R78A 2FFYA 4QJGA 4S2MA 1E25A 1ES2A 1SKOB 2JKTI 3Q82A 1N9OA 2PBYA 3IX8A 4M3KA 3QP8A 2ACGA 5CERA 2ZC4B 1KE4A 5CEDA 2L0WA 2O9AA 4HESA 5EOOA 2H5SA 2G2WA 1PYYA 4UQIM 3NOTC 4FSFA 1P9RA 3W4PA 1G6OA 2P7JA 2PU2A 3IF6C 3ZG7B 1KOUA 1DY6A 1PI4A 2O99A 1G5UA 1OT6A 1K54C 3PBRA 2ZL1B 4YOFA 4WM9A 1LI9A 1GHMA 2WKQA 3NY4A 4R4SA 1N9BA 4WMCA 3A3IA 1PFLA 4UQIS 4OPYA 4DKIA 1NWZA 3IBRA 5L2FA 2KLIA 2I72A 3ZNTA 2XK1A 2MJ6A 5E2EA 3KSIA 4R3JA 2HGVA 1XJ4A 1H8YA 3IH9A 1IYQA 3OZHA 3ZG5A 5TBMB 3VSLA 4U3TA 4DN0A 5F1FA 5HWWA 4Y0UA 4JF4A 4K0XA 3ZVWA 4GJ4A 1NZUA 1N9NA 3SH9A 1ALQA 2PHYA 1VETA 5AVFA 2EWWA 4G3KA 3D9YA 1EWZA 3MF0A 5DTTA 4E3LA 3BLSA 5HAQA 3UPPA 4YINA 4E6WA 5AQBA 3DBAA 2IWBA 1LT0A 4NKPA 4I38A 5FAPA 1TS6A 3IF5A 4OQ0A 2IA2A 2WK0A 4R23A 2JCHA 3UPNA 3OPRA 4LV1A 5GHZA 1PWGA 2C6WB 3E4QA 2Y2NA 5HWVA 4FH4A 3N7WA 2O0YA 2ZOIA 1UWNX 2INWA 4Z1WA 2A24A 3OPHA 4CLCB 4LLOB 1PNEA 3HLEA 3DTKA 5FQ9A 3HL9A 1SZVA 1Q2PA 3G2YA 5CTNA 4X6TA 1NLZA 3M6HA 1TF1A 2LB5A 2WGIA 1NRJA 1KVMA 4EUZA 2PDRA 2R9WA 2KOIA 4JGRA 4N1HA 5FI7A 2Y8HA 1VQQA 3VP0A 2CMNA 5FI2A 4N9KA 4GCZA 3RTYA 1UGUA 3C2WA 5TJJA 1ONHA 4P85A 4CLCC 3PBQA 2J3WA 4NXBA 4A5RA 5KIZA 1L0GA 5CGXA 1FQGA 1J3WA 1K4EA 4GKUA 5CHUA 3HVFA 1BLSA 5F83A 4LRXC 4R4RA 3MSHA 4F3LB 4B4ZA 1KDWA 1VEUA 3T4SA 2YKHA 1IFQA 3BFDA 1E3UD 4MBFA 5CTMA 4O7DA 1BUEA 3RXXA 1JWVA 3QP6A 4QHCA 3UMDA 3ISGA 4G3WA 2WZXA 3F1PB 1PRQA 2Z2LB 4CPKA 2QPNA 4OOMA 5CGSA 2WADA 5CEBA 1OTIA 1LL8A 4Q0IA 4PM7A 2PYRA 1K57C 1OMEA 3EGXC 4UEYA 4HJ4A 1IYSA 1IEMA 2V2FF 2EX9A 4LPZA 3SS4A 3T4LA 1GSXA 5G4YA 2V1BA 4DF6A 4DDYA 1Y54A 4WLAA 1EI5A 4PPRA 2DRWA 4L9EA 1PWDA 2ZC5B 1PW1A 2JKRM 4GLQA 3EQVA 4FD8A 5FQMA 4LCLA 1KE3A 3OC2A 3B47A 1T1BA 2B02A 3HLFA 3UDFA 3WS0A 1NYYA 4IJGA 3IXBA 4S2NC 3GECA 3DTIA 3ICYA 3P98A 1DJBA 1K6SA 1S4SA 2P08A 4R38A 3PXPA 3FKVA 5CXWA 4R3BA 1RGZA 3AGEA 1Y4OA 3Q7ZA 4GS9B 4LGWA 4Q8IA 1HD8A 3BY8A 4BWIA 4LRZE 3V50A 5A8BA 4Y0TA 5I94A 3LIFA 3TW8A 4HQAA 4HJ6A 4PM9A 2J8YA 3N8SA 1N4OA 2A2LA 2LB9A 3NCKA 4MNRA 1W5DA 3UE6A 3QP4A 4OH0A 3BW6A 2EFUA 4D2OA 2FFFB 4KZ4A 3IXDA 1W8QA 1P9WA 4JXWA 3LY3A 1KGEA 1OTAA 3D3OA 2D01A 1YLJA 2WKIA 4O8GA 1KE0A 1OJ5A 4Y3IA 3IF6A 2D02A 1MWRA 1FR6A 4EERA 1K0KA 1YLPA 4E6XA 3UO9A 5M18A 4WF0A 1GA0A 4Y5FA 3ZGAB 1XFNA 2ZOHA 1TDGA 4FTXA 1G6AA 3GMWA 4ZRRA 4C75A 2QHKA 3NJAA 5K5BA 4KZ7A 2M1CA 5DFYA 4I39A 3UPOA 2W3FA 3Q7VA 4KENB 3BFFA 1ZG6A 2J9OA 1K56D 2V0UA 3G30A 3G31A 2HDQA 1GA9A 4KG2A 2XGNA 2ZQ9A 1XPBA 2KDKA 2GJ3A 3IT9A 4PKYG 4PM8A 2PR5A 3TSGA 2P74A 2Q9MA 2XD1A 4S2PA 1KDSA 1HLUP 5HARA 2Z6CA 3FPVA 4MDZA 3LIEA 2VGJA 1Y28A 5TBMA 4D60A 3WS2A 2HDRA 4EBNA 1PIOA 2V1AA 4P6ZM 1K55C 4GB7A 1CQAA 5F69A 1H8MA 2HV1A 4R70A 2O9BA 1JTDA 4UA7A 1FOFA 2XLNA 1YLZA 2O9CA 2VLGA 5HSQA 1GCEA 3IHBA 3NULA 3LIBA 2EX8A 3NHQA 3F1NB 1ESUA 4HY8A 4OLGA 2VJWA 1G28A 1MWUA 1MWTA 4DJ2A 1S1YA 3LCEA 2WUQA 3FC7A 3UB8A 3VP3A 5F68A 3S1YA 3TRCA 1WA9A 3VFHA 4YNRA 3PBNA 3MKEA 3OCNA 5FEGA 2Y2HA 5EFWA 2W1TB 3MZEA 3N8RA 4HH2A 3BWLA 2K31A 1T18A 1LSWA 2P9VA 2JE5A 3K3DA 3IX3A 4GDBA 1IKGA 3ZNYA 3T4JA 3H82A 4EV4A 3F1OA 5GLDA 3AGFA 5FL3A 2EWVA 5FASA 3T1XA 4H8RA 5HWTA 3UDXA 5EE8A 1F98A 5JYPA 4MEZA 3TG9A 3C4OA 3S7PA 4ID4A 1MY8A 4YFMA 3HJIA 4C3QA 2XDMA 4E3OA 4UA9A 1NXYA 2Q9NA 3IH8A 3NDEA 1A0KA 3UMEA 4BJPA 1I5QA 2M7UA 5HX9A 4XT2A 2EXBA 3G35A 5GLCA 2P04A 5AQ9A 4GNUA 1S66L 3VMAA 3PBTA 4ZDXA 2WGWB 1K57A 3M6BA 4XUXA 2CC1A 4RA7A 4F3LA 3IS2A 2Z6DA 1IYOA 5CHMA 4WELA 3BQAA 5TGFA 5FAQA 1L3LA 4DE1A 3UE3A 3GSGA 2XR0A 3LGOA 3VOZA 2WAFA 2M7VA 4DDSA 4EWFA 3F1PA 4ZJ3A 1GHIA 3OBFA 3PR6A 3KSGA 3NDGA 4S2NA 2E8JA 4JGOA 3JVUA 2NUPC 3U2AA 2XEPA 3V3RA 1MWSA 3IHAA 2DCFA 3HLGA 4RX3A 2VKSA 4KZ5A 3W4OA 4NXEA 3Q1FA 1VB6A 1SKFA 4Y13A 4JPMA 4LRYC 4OQHA 5FSRA 4EW7A 3HLBA 3CZDA 2Y2MA 2V8CA 1OT9A 2ZC3B 2Z2MB 5IU1A 2GX5A 3IXHA 2X71A 3BYDA 2W3GA 3ZVTA 5FAOA 4ME4A 3VFFA 4RVAA 1TVFA 1LL5A 4GD8A 2XA7S 1K38A 3UE1A 3BFCA 3DTEA 4BD0A 5HD5A 2OAP1 3TE8A 4H6JB 1JTGA 5E2FA 2JHEA 1ES4A 4IBRA 5I5LA 5DFXA 3ZQ5A 4GHIA 4UA6A 2WYXA 2XFTA 4HIAA 4IUKA 4EBPA 4GOGA 5A92A 3P09A 4I3IA 1PW8A 3CUEA 3SZTA 3H9WA 1D7EA 1ESIA 3G32A 3NIAA 5HAIA 1OTDA 3KO6A 1XJ6A 4FH2A 1M6KA 3UB6A 3MR0A 5D3OA 1L0DA 4KZAA 5GL9A 3OOVA 1S0WA 5E2HA 1IOUA 5HDCA 4KZ6A 1H5XA 2QJ7A 1I2WA 3KX0X 4K0WA 4WN5A 4DJ3A 2V20A 4JBFA 1ZTUA 2QKPA 3FPWA 4WZ5C 3KYEA 4LFUA 3U4LP 3SH8A 4KZ8A 5L10A 4HBTA 4S2JA 3T4OA 1S67L 2J3TD 3T4TA 2PD8A 2JN7A 3DTMA 3PYPA 4EQ1A 3BECA 2HPBA 3CPTA 2Y2PA 3VE3A 2GZAA 4HEFA 4OQIA 1ERQA 1ERMA 1J9MA 4JXGA 1K55A 1XFQA 4PM6A 3N6IA 1TEMA 5GLBA 3K2NA 5EVID 4ETXA 5CECA 1CK3A 1CJFA 3NC8A 3EEAA 3UB7A 2Y79A 2PT7A 1TS8A 4DE0A 5HZHA 3LEQA 3JPUA 3A0VA 1BTLA 1YLYA 4WZ4A 5JYOA 3S4XA 2EA9A 4IEDA 4OPRA 2GDNA 3T4KA 3M2JA 5EPHA 1YAXA 3IXGA 1PZPA 3QHYA 2ZC7A 4ARZB 2XD5A 1NYMA 1V9YA 2BTFP 3C7UA 4M4XA 3CAXA 3KYQA 5FDHA 1LSXA 3T12B 2Y2GA 2EX2A 3MBZA 3O88A 3UY6A 3E0YA 1UWPX 1C3BA 1XGIA 2XROA 5HAPA 4X55A 3NBLA 3D4FA 2JKFA 5DJUA 4EUVA 5EOEA 1YLWA 2Y2KA 1ZG4A 3A3EA 1F5MA 2RL3A 3LUQA 2J80A 4Q0HA 3G34A 2Q0OA 2VGKA 2XH9A 3FYZA 4E04A 1QMFA 2Y91A 2IWDA 3MZDA 3LR0A 2PR6A 3DAVA 4FUWA 3FKWA 1MBLA 4UHUA 2XFSA 3P7NA 1MPLA 1W63M 2W1RA 4R0QA 3ITBA 3IQAA 1MC0A 5J8XA 1XP4A 4L0LA 1IKIA 4WL9A 4GDNA 4WMCD 5CRFA 4CQHA 4BBVA 1VETB 2JKTM 3MQ0A 3B42A 1NY0A 4NETA 3C38A 2QMIA 4B93A 1M40A 2WGWA 3SH7A 1G68A 2BG1A 1P0ZA 4MN7A 1S4RA 4NXFA 2QZ6A 1K54A 4ESPA 1OTEA 5F6AA 4BENA 1K25A 2W0NA 4FCFA 5DTSA 1HVBA 4NEED 3CHWP 5GLAA 4NXGA 1I2SA 1SKOA 1JVJA 2WKPA 1MZUA 4QY5A 3CLOA 2RCXA 3EOIA 5L8MA 3OPPA 2VV8A 3VOYA 4HI4A 2A24B 5FQKA 3R7WB 2GNXA 2FZ0A 2AVXA 2ZM2A 2W27A 4HHDA 4Y15A 1ZHHB 1YM1A 3C4PA 3BFEA 3RH8B 3SS3A 4JXVA 5A90A 3DWKA 3L9KA 2ZL1A 4E3IA 1SDNA 3BQ8A 5FA7A 4EEPA 4O0PA 5KMWA 3G4PA 2WGVA 4DMZA 3CG5A 4G3VA 1RP5A 4E3KA 3FZCA 2ZJ9A 4IBXA 3UB9A 3ZG9B 3ZG0A 3WS1A 2HP5A 2HJEA 2ZQAA 3PHYA 5A91A 3IBJA 4P87A 1L2SA 3HCYA 4EBLA 4OPZA 2Y2LA 1DP9A 4N9LA 4FOFA 3OCLA 2HP9A 3BJNA 1VEUB 4I3JA 5HDDA 3G6OA 4IVIA 4XXRA 3ZYTA 4MN6A 4WZ5A 1ZC2A 4HJ3A 3CI6A 3T50A 3PBOA 2XQZA 3Q07A 4CLCE 2OLVA 2QWSA 4B4XA 3B33A 3RXWA 4LENA 3G2ZA 2XSSA 5F1GA 5AJGA 4R6LA 3RJUA 2J7VA 5TR7A 1ES3A 5GHXA 4IHQA 2KX6A 3HBRA 3VV4A 3WWXA 4PKYA 2PD7A 1YT4A 5F5YA 5HD3A 4QD4A 3GDIA 3PBSA 1STZA 4R3AA 4X25A 3S22A 1H3QA 2JBFA 4LCMA 2V8FA 2W3HA 4EESA 3IX4A 4X1MA 4CLCA 4OONA 5J4EA 1D06A 1OTBA 2IWCA 2XRNA 4KQDA 5G4ZA 2OLUA 1XA1A 3P01A 4S2KA 2ZQCA 1DP8A 2Y2IA 4OVDA 4Q0JA 5DKLA 5KSCA 2VV6A 2R9XA 4X56A 3MQOA 3CITA 2EFXA 2DNSA 3OLOA 4II7A 2ZMAA 1FIKA 1HZOA 3Q81A 4BMWA 5FI6A 5EUAA 2K7SA 3E4OA 4RYEA 2JKRI 4DXCA 5AQ7A 2K2NA 2OAQ1 3IWIA 3OPLA 3EQUA 5M1AA 4HH3A 3R4KA 3A0RA 2WKHA 3BRMA 5CHJA 2G7UA 5E2GA 3MJQA 3VSKA 3NI9A 5DKKA 5DF8A 1CEFA 2ZQ7A 3E2LA 1K6RA 3LO7A 4BD1A 2H10A 2PBDP 1NRFA 1YSPA 3GRJA 4X69A 3EWKA 4BL3A 1NLYA 2H0TA 1EROA 4AFIA 3TJZC 2V0WA 3WS4A 4ARZA 3A0SA 3IWOA 3V67A 1LLBA 2VZWA 1TS7A 4KUKA 2OWHA 3VP4A 2Y2QA 1YSQA 4X68A 1S6RA 1KVLA 3A3JA 3BEBA 2Y55A 2XA7M 1KGGA 2I9VA 3PTEA 5HL6A 1OPXA 2XF3A 2ZC6B 1Z6FA 1KGFA 2VA0A 3Q7VB 5AQAA 3S7NA 3LYXA 3LI9A 3C8CA 3HUMA 4KQOA 4K08A 3A3FA 1GSWA 4E3NA 5DJTA 3C30A 1SCWA 4ZTKA 1GHPA 3W4QA 1IYPA 4X1LA 3GR2A 5EVLA 4BBUA 2HF6A 3QNCA 4Y2FA 3O86A 4ETZA 3LICA 1JWZA 3LEZA 4I5SA 1MXOA 1N9LA 1VHMA 5U47A 3HLWA 5EV0A 4GS9A 3ZDJA 2WZZA 1TS0A 4E3JA 3QNBA 4EXOA 1JWPA 4N92A 4IUHA 5HPIA 1BLHA 1WYCA 2ZQDA 1VM1A 1JNUA 5HW3A 3MXQA 2L1MA 5AVEA 4R1GA 1XGJA 1BT5A 3RFBA 1FILA 4JF6A 2FH5A 4WEJA 1K4FA 4KUOA 5J3WA 2V1ZA 1ONGA 1L0FA 3KSFA 3KSHA 4L9GA 4MBHA 4KG5A 1K56A 4GZBA 5CX7A 3H7WB 1CI9A 1T1CA 3DWZA 4QU3A 3MFDA 2WKEA 2BLSA 4EU0A 4JF5A 4MBKA 1CF0A 1S1ZA 3VP1A 3EGDC 3EEHA 5EVIB 3BM6A 4UAAA 1GSVA 3AGDA 4WYYA 1T1AA 3R7WA 2J3TC 2P9VB 3NECA 4JXSA 4DE3A 2UWXA 3H82B 3MQQA 3N8LA 3F1OB 2EXAA 5FEFA 1F2KA 4P0MA 2Y59A 5IT5A 1YKDA 3NOPC 3PAEA 3ZCZA 1WYBA 2PRFA 4KQRA 1YMSA 1YPRA 5FQQA 3ZFZA 2HDSA 3GV9A 2ZM8A 1O07A 1CI8A 2W3EA 3DW0A 3LI8A 5FQJA 2VEAA 1E4DA 1PWCA 5EVIC 4HOIA 4DRTA 4JGPA 4CLCD 4JGQA 4WUJA 4ZAMA 4XT2B 4BL2A 4Z9QA 3FG8A 4PHTA 1OJGA 4OP5A 1BSGA 3UN7A 4MCWA 2WAEA 3LR5A 1IELA 3T1RA 4I3AA 1ZKJA 3IS2B 2HDUA 2H28A 4MLLA 4CJNA 5FQIA 5EM0A 1DJCA 5IHVA 3UDIA 4OOYA 5GHYA 4RQ9A 3V39A 4KZ3A
chains in the Genus database with same CATH topology
4LFUA 3QP6A 2Q0OA 3QP2A 4LGWA 3IX4A 3QP1A 3QP5A 3IX8A 5L07A 5L09A 5L10A 1H0MA 3QP8A 4NG2A 3IX3A 4Y13A 3SZTA 3JPUA 3QP4A 2AVXA 4Y15A 4Y17A 1L3LA 2UV0E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFU A;  3QP6 A;  2Q0O A;  3QP2 A;  4LGW A;  3IX4 A;  3QP1 A;  3QP5 A;  3IX8 A;  5L07 A;  5L09 A;  5L10 A;  1H0M A;  3QP8 A;  4NG2 A;  3IX3 A;  4Y13 A;  3SZT A;  3JPU A;  3QP4 A;  2AVX A;  4Y15 A;  4Y17 A;  1L3L A;  2UV0 E; 
#chains in the Genus database with same CATH topology
 2E8I A;  1XA7 A;  3F1N A;  1RCJ A;  2HJ9 C;  2B5R A;  3V5M A;  5L09 A;  2B18 A;  4F94 A;  3T4Q A;  4HP9 A;  3WS5 A;  5E43 A;  3M2K A;  3W2Z A;  1QME A;  4HNB A;  3SW1 A;  3O87 A;  1FCN A;  4EEU A;  4MN5 A;  3MXR A;  3GTC A;  1L0E A;  2W1T A;  2G2U A;  3WRT A;  3L7H A;  3ZG8 B;  4JLF A;  4EQI A;  3CJM A;  5FDS A;  3WRZ A;  3JVV A;  3HUO A;  2Y4A A;  1FCM A;  3MMH A;  2QYB A;  5DF9 A;  5F82 A;  1RGY A;  4ZJ2 A;  2BAS A;  3S7Q A;  3E98 A;  2C5W B;  4KZ9 A;  1BZA A;  5IS1 A;  4U0T A;  3V3S A;  4C6Y A;  3K3C A;  1FCO A;  1XXM A;  1YQS A;  4IVK A;  2B95 A;  4S2L A;  4OP8 A;  4GHI B;  2VV7 A;  2Y2O A;  3BLM A;  2ZMV A;  1AWI A;  5HDS A;  3UE0 A;  3HRE A;  4B9O A;  2PAV P;  1Z09 A;  1BUL A;  3QP1 A;  2JC7 A;  3VE4 A;  2ZBB A;  2WKR A;  4ZJ1 A;  5MC7 A;  1SHV A;  4OQG A;  5HFO A;  4QY6 A;  1CEG A;  3PAG A;  4S2I A;  5M19 A;  2UV0 E;  3E2K A;  1BLC A;  4LV0 A;  4B88 A;  4K91 A;  3MKF A;  1MKI A;  5LBR A;  4KQQ A;  1X0O A;  3C5A A;  1MKM A;  4U0X A;  5C5K A;  5BOH A;  4S2O A;  4QWO A;  3CUE C;  2OWJ A;  2ZLY A;  1YLT A;  3MFX A;  5L07 A;  4BBT A;  2A49 A;  1XJ2 A;  4YWZ A;  1W63 Q;  1O7E A;  3GVB A;  1WE4 A;  3BFG A;  3I7J A;  4WBG A;  3E4P A;  3O3V A;  3CPT B;  1FR1 A;  2Y2J A;  3FV7 A;  4Y0O A;  1U60 A;  5HL1 A;  1V9Z A;  3T1Q B;  3KYZ A;  3UNW A;  1H0M A;  1F9I A;  3O5Y A;  4MMN A;  2A3U A;  2JKG A;  3HLC A;  5EM1 A;  4HP4 A;  4OKP A;  1Q2Q A;  2VX8 A;  3HJK A;  4H6J A;  1HTZ A;  4HBU A;  3W8K A;  4DE2 A;  1LSV A;  1W8Y A;  3CWF A;  4QB8 A;  4OOL A;  2EX6 A;  1H8Z A;  2J9P A;  2VGL M;  3FWL A;  2ZD8 A;  1PI5 A;  4KG6 A;  4E3M A;  1XKZ A;  1PZO A;  5DF7 A;  4OLD A;  1LL9 A;  1P97 A;  5TFQ A;  1LHY A;  2H0Y A;  4WEK A;  3LID A;  3HLD A;  1XJ3 A;  2NUT C;  3UB5 P;  2VGL S;  3D72 A;  4N1X A;  3QP5 A;  4NG2 A;  4Y7P A;  1ODV A;  4QPR A;  1NZO A;  1ES5 A;  1DRM A;  3ULF A;  2V9A A;  1AXB A;  5J7E A;  3IWQ A;  4BQM A;  4OPQ A;  1DJA A;  3QP2 A;  4PMA A;  4P6Z S;  1LI0 A;  4X53 A;  2VK3 A;  1TDL A;  3VOL A;  3LR3 A;  2DMW A;  2ZM0 A;  3C7V A;  1BYW A;  3H7W A;  2PYP A;  4L9F A;  3TOI A;  3T1S A;  5G18 A;  2OOL A;  4ZBE A;  4PAU A;  5FAT A;  3CMZ A;  1SDE A;  4RX2 A;  4GN2 A;  3LY4 A;  4Y17 A;  5EVI A;  5HPF A;  4KZB A;  3MS6 A;  4GW9 A;  4O01 A;  1FSY A;  4NK3 A;  4GD6 A;  1E3U A;  1D1J A;  2PU4 A;  5DVA A;  4LV3 A;  2QJ5 A;  5A93 A;  3MZF A;  2L4R A;  5KZH A;  2YKF A;  2X01 A;  4DXB A;  3ZHH A;  4PM5 A;  3MXS A;  3NOU C;  5EVE A;  1NJ4 A;  1T19 A;  3A3D A;  3GQZ A;  4P6B A;  2HP6 A;  2ZQ8 A;  1XX2 A;  3LFV A;  5KSH A;  3LIA A;  4LV2 A;  4JKT A;  2OSU A;  5CGW A;  1EW0 A;  3JYI A;  2X02 A;  3VP2 A;  3S7O A;  2ZMF A;  4BLM A;  1ACF A;  1W79 A;  1FSW A;  5EEC A;  3SS5 A;  4EET B;  1DP6 A;  1YMX A;  4XUZ A;  2OV5 A;  3N4I A;  2HZ5 A;  3HUN A;  1TD5 A;  5DTK A;  3ITA A;  2W3D A;  3IF6 B;  3LR4 A;  1BLP A;  3B3X A;  3SOI A;  1W7F A;  3BY9 A;  2R78 A;  2FFY A;  4QJG A;  4S2M A;  1E25 A;  1ES2 A;  1SKO B;  2JKT I;  3Q82 A;  1N9O A;  2PBY A;  3IX8 A;  4M3K A;  3QP8 A;  2ACG A;  5CER A;  2ZC4 B;  1KE4 A;  5CED A;  2L0W A;  2O9A A;  4HES A;  5EOO A;  2H5S A;  2G2W A;  1PYY A;  4UQI M;  3NOT C;  4FSF A;  1P9R A;  3W4P A;  1G6O A;  2P7J A;  2PU2 A;  3IF6 C;  3ZG7 B;  1KOU A;  1DY6 A;  1PI4 A;  2O99 A;  1G5U A;  1OT6 A;  1K54 C;  3PBR A;  2ZL1 B;  4YOF A;  4WM9 A;  1LI9 A;  1GHM A;  2WKQ A;  3NY4 A;  4R4S A;  1N9B A;  4WMC A;  3A3I A;  1PFL A;  4UQI S;  4OPY A;  4DKI A;  1NWZ A;  3IBR A;  5L2F A;  2KLI A;  2I72 A;  3ZNT A;  2XK1 A;  2MJ6 A;  5E2E A;  3KSI A;  4R3J A;  2HGV A;  1XJ4 A;  1H8Y A;  3IH9 A;  1IYQ A;  3OZH A;  3ZG5 A;  5TBM B;  3VSL A;  4U3T A;  4DN0 A;  5F1F A;  5HWW A;  4Y0U A;  4JF4 A;  4K0X A;  3ZVW A;  4GJ4 A;  1NZU A;  1N9N A;  3SH9 A;  1ALQ A;  2PHY A;  1VET A;  5AVF A;  2EWW A;  4G3K A;  3D9Y A;  1EWZ A;  3MF0 A;  5DTT A;  4E3L A;  3BLS A;  5HAQ A;  3UPP A;  4YIN A;  4E6W A;  5AQB A;  3DBA A;  2IWB A;  1LT0 A;  4NKP A;  4I38 A;  5FAP A;  1TS6 A;  3IF5 A;  4OQ0 A;  2IA2 A;  2WK0 A;  4R23 A;  2JCH A;  3UPN A;  3OPR A;  4LV1 A;  5GHZ A;  1PWG A;  2C6W B;  3E4Q A;  2Y2N A;  5HWV A;  4FH4 A;  3N7W A;  2O0Y A;  2ZOI A;  1UWN X;  2INW A;  4Z1W A;  2A24 A;  3OPH A;  4CLC B;  4LLO B;  1PNE A;  3HLE A;  3DTK A;  5FQ9 A;  3HL9 A;  1SZV A;  1Q2P A;  3G2Y A;  5CTN A;  4X6T A;  1NLZ A;  3M6H A;  1TF1 A;  2LB5 A;  2WGI A;  1NRJ A;  1KVM A;  4EUZ A;  2PDR A;  2R9W A;  2KOI A;  4JGR A;  4N1H A;  5FI7 A;  2Y8H A;  1VQQ A;  3VP0 A;  2CMN A;  5FI2 A;  4N9K A;  4GCZ A;  3RTY A;  1UGU A;  3C2W A;  5TJJ A;  1ONH A;  4P85 A;  4CLC C;  3PBQ A;  2J3W A;  4NXB A;  4A5R A;  5KIZ A;  1L0G A;  5CGX A;  1FQG A;  1J3W A;  1K4E A;  4GKU A;  5CHU A;  3HVF A;  1BLS A;  5F83 A;  4LRX C;  4R4R A;  3MSH A;  4F3L B;  4B4Z A;  1KDW A;  1VEU A;  3T4S A;  2YKH A;  1IFQ A;  3BFD A;  1E3U D;  4MBF A;  5CTM A;  4O7D A;  1BUE A;  3RXX A;  1JWV A;  3QP6 A;  4QHC A;  3UMD A;  3ISG A;  4G3W A;  2WZX A;  3F1P B;  1PRQ A;  2Z2L B;  4CPK A;  2QPN A;  4OOM A;  5CGS A;  2WAD A;  5CEB A;  1OTI A;  1LL8 A;  4Q0I A;  4PM7 A;  2PYR A;  1K57 C;  1OME A;  3EGX C;  4UEY A;  4HJ4 A;  1IYS A;  1IEM A;  2V2F F;  2EX9 A;  4LPZ A;  3SS4 A;  3T4L A;  1GSX A;  5G4Y A;  2V1B A;  4DF6 A;  4DDY A;  1Y54 A;  4WLA A;  1EI5 A;  4PPR A;  2DRW A;  4L9E A;  1PWD A;  2ZC5 B;  1PW1 A;  2JKR M;  4GLQ A;  3EQV A;  4FD8 A;  5FQM A;  4LCL A;  1KE3 A;  3OC2 A;  3B47 A;  1T1B A;  2B02 A;  3HLF A;  3UDF A;  3WS0 A;  1NYY A;  4IJG A;  3IXB A;  4S2N C;  3GEC A;  3DTI A;  3ICY A;  3P98 A;  1DJB A;  1K6S A;  1S4S A;  2P08 A;  4R38 A;  3PXP A;  3FKV A;  5CXW A;  4R3B A;  1RGZ A;  3AGE A;  1Y4O A;  3Q7Z A;  4GS9 B;  4LGW A;  4Q8I A;  1HD8 A;  3BY8 A;  4BWI A;  4LRZ E;  3V50 A;  5A8B A;  4Y0T A;  5I94 A;  3LIF A;  3TW8 A;  4HQA A;  4HJ6 A;  4PM9 A;  2J8Y A;  3N8S A;  1N4O A;  2A2L A;  2LB9 A;  3NCK A;  4MNR A;  1W5D A;  3UE6 A;  3QP4 A;  4OH0 A;  3BW6 A;  2EFU A;  4D2O A;  2FFF B;  4KZ4 A;  3IXD A;  1W8Q A;  1P9W A;  4JXW A;  3LY3 A;  1KGE A;  1OTA A;  3D3O A;  2D01 A;  1YLJ A;  2WKI A;  4O8G A;  1KE0 A;  1OJ5 A;  4Y3I A;  3IF6 A;  2D02 A;  1MWR A;  1FR6 A;  4EER A;  1K0K A;  1YLP A;  4E6X A;  3UO9 A;  5M18 A;  4WF0 A;  1GA0 A;  4Y5F A;  3ZGA B;  1XFN A;  2ZOH A;  1TDG A;  4FTX A;  1G6A A;  3GMW A;  4ZRR A;  4C75 A;  2QHK A;  3NJA A;  5K5B A;  4KZ7 A;  2M1C A;  5DFY A;  4I39 A;  3UPO A;  2W3F A;  3Q7V A;  4KEN B;  3BFF A;  1ZG6 A;  2J9O A;  1K56 D;  2V0U A;  3G30 A;  3G31 A;  2HDQ A;  1GA9 A;  4KG2 A;  2XGN A;  2ZQ9 A;  1XPB A;  2KDK A;  2GJ3 A;  3IT9 A;  4PKY G;  4PM8 A;  2PR5 A;  3TSG A;  2P74 A;  2Q9M A;  2XD1 A;  4S2P A;  1KDS A;  1HLU P;  5HAR A;  2Z6C A;  3FPV A;  4MDZ A;  3LIE A;  2VGJ A;  1Y28 A;  5TBM A;  4D60 A;  3WS2 A;  2HDR A;  4EBN A;  1PIO A;  2V1A A;  4P6Z M;  1K55 C;  4GB7 A;  1CQA A;  5F69 A;  1H8M A;  2HV1 A;  4R70 A;  2O9B A;  1JTD A;  4UA7 A;  1FOF A;  2XLN A;  1YLZ A;  2O9C A;  2VLG A;  5HSQ A;  1GCE A;  3IHB A;  3NUL A;  3LIB A;  2EX8 A;  3NHQ A;  3F1N B;  1ESU A;  4HY8 A;  4OLG A;  2VJW A;  1G28 A;  1MWU A;  1MWT A;  4DJ2 A;  1S1Y A;  3LCE A;  2WUQ A;  3FC7 A;  3UB8 A;  3VP3 A;  5F68 A;  3S1Y A;  3TRC A;  1WA9 A;  3VFH A;  4YNR A;  3PBN A;  3MKE A;  3OCN A;  5FEG A;  2Y2H A;  5EFW A;  2W1T B;  3MZE A;  3N8R A;  4HH2 A;  3BWL A;  2K31 A;  1T18 A;  1LSW A;  2P9V A;  2JE5 A;  3K3D A;  3IX3 A;  4GDB A;  1IKG A;  3ZNY A;  3T4J A;  3H82 A;  4EV4 A;  3F1O A;  5GLD A;  3AGF A;  5FL3 A;  2EWV A;  5FAS A;  3T1X A;  4H8R A;  5HWT A;  3UDX A;  5EE8 A;  1F98 A;  5JYP A;  4MEZ A;  3TG9 A;  3C4O A;  3S7P A;  4ID4 A;  1MY8 A;  4YFM A;  3HJI A;  4C3Q A;  2XDM A;  4E3O A;  4UA9 A;  1NXY A;  2Q9N A;  3IH8 A;  3NDE A;  1A0K A;  3UME A;  4BJP A;  1I5Q A;  2M7U A;  5HX9 A;  4XT2 A;  2EXB A;  3G35 A;  5GLC A;  2P04 A;  5AQ9 A;  4GNU A;  1S66 L;  3VMA A;  3PBT A;  4ZDX A;  2WGW B;  1K57 A;  3M6B A;  4XUX A;  2CC1 A;  4RA7 A;  4F3L A;  3IS2 A;  2Z6D A;  1IYO A;  5CHM A;  4WEL A;  3BQA A;  5TGF A;  5FAQ A;  1L3L A;  4DE1 A;  3UE3 A;  3GSG A;  2XR0 A;  3LGO A;  3VOZ A;  2WAF A;  2M7V A;  4DDS A;  4EWF A;  3F1P A;  4ZJ3 A;  1GHI A;  3OBF A;  3PR6 A;  3KSG A;  3NDG A;  4S2N A;  2E8J A;  4JGO A;  3JVU A;  2NUP C;  3U2A A;  2XEP A;  3V3R A;  1MWS A;  3IHA A;  2DCF A;  3HLG A;  4RX3 A;  2VKS A;  4KZ5 A;  3W4O A;  4NXE A;  3Q1F A;  1VB6 A;  1SKF A;  4Y13 A;  4JPM A;  4LRY C;  4OQH A;  5FSR A;  4EW7 A;  3HLB A;  3CZD A;  2Y2M A;  2V8C A;  1OT9 A;  2ZC3 B;  2Z2M B;  5IU1 A;  2GX5 A;  3IXH A;  2X71 A;  3BYD A;  2W3G A;  3ZVT A;  5FAO A;  4ME4 A;  3VFF A;  4RVA A;  1TVF A;  1LL5 A;  4GD8 A;  2XA7 S;  1K38 A;  3UE1 A;  3BFC A;  3DTE A;  4BD0 A;  5HD5 A;  2OAP 1;  3TE8 A;  4H6J B;  1JTG A;  5E2F A;  2JHE A;  1ES4 A;  4IBR A;  5I5L A;  5DFX A;  3ZQ5 A;  4GHI A;  4UA6 A;  2WYX A;  2XFT A;  4HIA A;  4IUK A;  4EBP A;  4GOG A;  5A92 A;  3P09 A;  4I3I A;  1PW8 A;  3CUE A;  3SZT A;  3H9W A;  1D7E A;  1ESI A;  3G32 A;  3NIA A;  5HAI A;  1OTD A;  3KO6 A;  1XJ6 A;  4FH2 A;  1M6K A;  3UB6 A;  3MR0 A;  5D3O A;  1L0D A;  4KZA A;  5GL9 A;  3OOV A;  1S0W A;  5E2H A;  1IOU A;  5HDC A;  4KZ6 A;  1H5X A;  2QJ7 A;  1I2W A;  3KX0 X;  4K0W A;  4WN5 A;  4DJ3 A;  2V20 A;  4JBF A;  1ZTU A;  2QKP A;  3FPW A;  4WZ5 C;  3KYE A;  4LFU A;  3U4L P;  3SH8 A;  4KZ8 A;  5L10 A;  4HBT A;  4S2J A;  3T4O A;  1S67 L;  2J3T D;  3T4T A;  2PD8 A;  2JN7 A;  3DTM A;  3PYP A;  4EQ1 A;  3BEC A;  2HPB A;  3CPT A;  2Y2P A;  3VE3 A;  2GZA A;  4HEF A;  4OQI A;  1ERQ A;  1ERM A;  1J9M A;  4JXG A;  1K55 A;  1XFQ A;  4PM6 A;  3N6I A;  1TEM A;  5GLB A;  3K2N A;  5EVI D;  4ETX A;  5CEC A;  1CK3 A;  1CJF A;  3NC8 A;  3EEA A;  3UB7 A;  2Y79 A;  2PT7 A;  1TS8 A;  4DE0 A;  5HZH A;  3LEQ A;  3JPU A;  3A0V A;  1BTL A;  1YLY A;  4WZ4 A;  5JYO A;  3S4X A;  2EA9 A;  4IED A;  4OPR A;  2GDN A;  3T4K A;  3M2J A;  5EPH A;  1YAX A;  3IXG A;  1PZP A;  3QHY A;  2ZC7 A;  4ARZ B;  2XD5 A;  1NYM A;  1V9Y A;  2BTF P;  3C7U A;  4M4X A;  3CAX A;  3KYQ A;  5FDH A;  1LSX A;  3T12 B;  2Y2G A;  2EX2 A;  3MBZ A;  3O88 A;  3UY6 A;  3E0Y A;  1UWP X;  1C3B A;  1XGI A;  2XRO A;  5HAP A;  4X55 A;  3NBL A;  3D4F A;  2JKF A;  5DJU A;  4EUV A;  5EOE A;  1YLW A;  2Y2K A;  1ZG4 A;  3A3E A;  1F5M A;  2RL3 A;  3LUQ A;  2J80 A;  4Q0H A;  3G34 A;  2Q0O A;  2VGK A;  2XH9 A;  3FYZ A;  4E04 A;  1QMF A;  2Y91 A;  2IWD A;  3MZD A;  3LR0 A;  2PR6 A;  3DAV A;  4FUW A;  3FKW A;  1MBL A;  4UHU A;  2XFS A;  3P7N A;  1MPL A;  1W63 M;  2W1R A;  4R0Q A;  3ITB A;  3IQA A;  1MC0 A;  5J8X A;  1XP4 A;  4L0L A;  1IKI A;  4WL9 A;  4GDN A;  4WMC D;  5CRF A;  4CQH A;  4BBV A;  1VET B;  2JKT M;  3MQ0 A;  3B42 A;  1NY0 A;  4NET A;  3C38 A;  2QMI A;  4B93 A;  1M40 A;  2WGW A;  3SH7 A;  1G68 A;  2BG1 A;  1P0Z A;  4MN7 A;  1S4R A;  4NXF A;  2QZ6 A;  1K54 A;  4ESP A;  1OTE A;  5F6A A;  4BEN A;  1K25 A;  2W0N A;  4FCF A;  5DTS A;  1HVB A;  4NEE D;  3CHW P;  5GLA A;  4NXG A;  1I2S A;  1SKO A;  1JVJ A;  2WKP A;  1MZU A;  4QY5 A;  3CLO A;  2RCX A;  3EOI A;  5L8M A;  3OPP A;  2VV8 A;  3VOY A;  4HI4 A;  2A24 B;  5FQK A;  3R7W B;  2GNX A;  2FZ0 A;  2AVX A;  2ZM2 A;  2W27 A;  4HHD A;  4Y15 A;  1ZHH B;  1YM1 A;  3C4P A;  3BFE A;  3RH8 B;  3SS3 A;  4JXV A;  5A90 A;  3DWK A;  3L9K A;  2ZL1 A;  4E3I A;  1SDN A;  3BQ8 A;  5FA7 A;  4EEP A;  4O0P A;  5KMW A;  3G4P A;  2WGV A;  4DMZ A;  3CG5 A;  4G3V A;  1RP5 A;  4E3K A;  3FZC A;  2ZJ9 A;  4IBX A;  3UB9 A;  3ZG9 B;  3ZG0 A;  3WS1 A;  2HP5 A;  2HJE A;  2ZQA A;  3PHY A;  5A91 A;  3IBJ A;  4P87 A;  1L2S A;  3HCY A;  4EBL A;  4OPZ A;  2Y2L A;  1DP9 A;  4N9L A;  4FOF A;  3OCL A;  2HP9 A;  3BJN A;  1VEU B;  4I3J A;  5HDD A;  3G6O A;  4IVI A;  4XXR A;  3ZYT A;  4MN6 A;  4WZ5 A;  1ZC2 A;  4HJ3 A;  3CI6 A;  3T50 A;  3PBO A;  2XQZ A;  3Q07 A;  4CLC E;  2OLV A;  2QWS A;  4B4X A;  3B33 A;  3RXW A;  4LEN A;  3G2Z A;  2XSS A;  5F1G A;  5AJG A;  4R6L A;  3RJU A;  2J7V A;  5TR7 A;  1ES3 A;  5GHX A;  4IHQ A;  2KX6 A;  3HBR A;  3VV4 A;  3WWX A;  4PKY A;  2PD7 A;  1YT4 A;  5F5Y A;  5HD3 A;  4QD4 A;  3GDI A;  3PBS A;  1STZ A;  4R3A A;  4X25 A;  3S22 A;  1H3Q A;  2JBF A;  4LCM A;  2V8F A;  2W3H A;  4EES A;  3IX4 A;  4X1M A;  4CLC A;  4OON A;  5J4E A;  1D06 A;  1OTB A;  2IWC A;  2XRN A;  4KQD A;  5G4Z A;  2OLU A;  1XA1 A;  3P01 A;  4S2K A;  2ZQC A;  1DP8 A;  2Y2I A;  4OVD A;  4Q0J A;  5DKL A;  5KSC A;  2VV6 A;  2R9X A;  4X56 A;  3MQO A;  3CIT A;  2EFX A;  2DNS A;  3OLO A;  4II7 A;  2ZMA A;  1FIK A;  1HZO A;  3Q81 A;  4BMW A;  5FI6 A;  5EUA A;  2K7S A;  3E4O A;  4RYE A;  2JKR I;  4DXC A;  5AQ7 A;  2K2N A;  2OAQ 1;  3IWI A;  3OPL A;  3EQU A;  5M1A A;  4HH3 A;  3R4K A;  3A0R A;  2WKH A;  3BRM A;  5CHJ A;  2G7U A;  5E2G A;  3MJQ A;  3VSK A;  3NI9 A;  5DKK A;  5DF8 A;  1CEF A;  2ZQ7 A;  3E2L A;  1K6R A;  3LO7 A;  4BD1 A;  2H10 A;  2PBD P;  1NRF A;  1YSP A;  3GRJ A;  4X69 A;  3EWK A;  4BL3 A;  1NLY A;  2H0T A;  1ERO A;  4AFI A;  3TJZ C;  2V0W A;  3WS4 A;  4ARZ A;  3A0S A;  3IWO A;  3V67 A;  1LLB A;  2VZW A;  1TS7 A;  4KUK A;  2OWH A;  3VP4 A;  2Y2Q A;  1YSQ A;  4X68 A;  1S6R A;  1KVL A;  3A3J A;  3BEB A;  2Y55 A;  2XA7 M;  1KGG A;  2I9V A;  3PTE A;  5HL6 A;  1OPX A;  2XF3 A;  2ZC6 B;  1Z6F A;  1KGF A;  2VA0 A;  3Q7V B;  5AQA A;  3S7N A;  3LYX A;  3LI9 A;  3C8C A;  3HUM A;  4KQO A;  4K08 A;  3A3F A;  1GSW A;  4E3N A;  5DJT A;  3C30 A;  1SCW A;  4ZTK A;  1GHP A;  3W4Q A;  1IYP A;  4X1L A;  3GR2 A;  5EVL A;  4BBU A;  2HF6 A;  3QNC A;  4Y2F A;  3O86 A;  4ETZ A;  3LIC A;  1JWZ A;  3LEZ A;  4I5S A;  1MXO A;  1N9L A;  1VHM A;  5U47 A;  3HLW A;  5EV0 A;  4GS9 A;  3ZDJ A;  2WZZ A;  1TS0 A;  4E3J A;  3QNB A;  4EXO A;  1JWP A;  4N92 A;  4IUH A;  5HPI A;  1BLH A;  1WYC A;  2ZQD A;  1VM1 A;  1JNU A;  5HW3 A;  3MXQ A;  2L1M A;  5AVE A;  4R1G A;  1XGJ A;  1BT5 A;  3RFB A;  1FIL A;  4JF6 A;  2FH5 A;  4WEJ A;  1K4F A;  4KUO A;  5J3W A;  2V1Z A;  1ONG A;  1L0F A;  3KSF A;  3KSH A;  4L9G A;  4MBH A;  4KG5 A;  1K56 A;  4GZB A;  5CX7 A;  3H7W B;  1CI9 A;  1T1C A;  3DWZ A;  4QU3 A;  3MFD A;  2WKE A;  2BLS A;  4EU0 A;  4JF5 A;  4MBK A;  1CF0 A;  1S1Z A;  3VP1 A;  3EGD C;  3EEH A;  5EVI B;  3BM6 A;  4UAA A;  1GSV A;  3AGD A;  4WYY A;  1T1A A;  3R7W A;  2J3T C;  2P9V B;  3NEC A;  4JXS A;  4DE3 A;  2UWX A;  3H82 B;  3MQQ A;  3N8L A;  3F1O B;  2EXA A;  5FEF A;  1F2K A;  4P0M A;  2Y59 A;  5IT5 A;  1YKD A;  3NOP C;  3PAE A;  3ZCZ A;  1WYB A;  2PRF A;  4KQR A;  1YMS A;  1YPR A;  5FQQ A;  3ZFZ A;  2HDS A;  3GV9 A;  2ZM8 A;  1O07 A;  1CI8 A;  2W3E A;  3DW0 A;  3LI8 A;  5FQJ A;  2VEA A;  1E4D A;  1PWC A;  5EVI C;  4HOI A;  4DRT A;  4JGP A;  4CLC D;  4JGQ A;  4WUJ A;  4ZAM A;  4XT2 B;  4BL2 A;  4Z9Q A;  3FG8 A;  4PHT A;  1OJG A;  4OP5 A;  1BSG A;  3UN7 A;  4MCW A;  2WAE A;  3LR5 A;  1IEL A;  3T1R A;  4I3A A;  1ZKJ A;  3IS2 B;  2HDU A;  2H28 A;  4MLL A;  4CJN A;  5FQI A;  5EM0 A;  1DJC A;  5IHV A;  3UDI A;  4OOY A;  5GHY A;  4RQ9 A;  3V39 A;  4KZ3 A; 
#chains in the Genus database with same CATH homology
 4LFU A;  3QP6 A;  2Q0O A;  3QP2 A;  4LGW A;  3IX4 A;  3QP1 A;  3QP5 A;  3IX8 A;  5L07 A;  5L09 A;  5L10 A;  1H0M A;  3QP8 A;  4NG2 A;  3IX3 A;  4Y13 A;  3SZT A;  3JPU A;  3QP4 A;  2AVX A;  4Y15 A;  4Y17 A;  1L3L A;  2UV0 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...