4NG2A

Crystal structure of lasr lbd-qsla complex from pseudomonas aeruginosa
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
166
structure length
166
Chain Sequence
b'ALVDGFLELERSSGKLEWSAILQKMASDLGFSKILFGLLPKDSQDYENAFIVGNYPAAWREHYDRAGYARVDPTVSHCTQSVLPIFWEPSIYQTRKQHEFFEEASAAGLVYGLTMPLHGARGELGALSLSVEAENRAEANRFMESVLPTLWMLKDYALQSGAGLAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional activator protein LasR
molecule tags Transcription regulator
source organism Pseudomonas aeruginosa
publication title QsIA disrupts LasR dimerization in antiactivation of bacterial quorum sensing
pubmed doi rcsb
total genus 54
structure length 166
sequence length 166
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03472 Autoind_bind Autoinducer binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.80 Alpha Beta 2-Layer Sandwich Beta-Lactamase Transcription factor LuxR-like, autoinducer-binding domain 4ng2A00
1L3LA 4LGWA 3IX4A 3QP5A 2Q0OA 2UV0E 5L10A 4LFUA 3QP2A 4NG2A 3QP1A 3IX8A 5L09A 1H0MA 5L07A 4Y15A 3QP8A 3SZTA 2AVXA 3IX3A 3JPUA 3QP6A 3QP4A 4Y13A 4Y17A
chains in the Genus database with same CATH superfamily
1FCMA 2XGNA 3LIEA 1H3QA 5DKLA 1PRQA 4Y7PA 4R0QA 5CTMA 1E3UA 4QPRA 4DN0A 3A0SA 3MZEA 4RX3A 4ETZA 3RH8B 5IHVA 1P9WA 3G34A 4M4XA 2BLSA 2VK3A 3HLGA 1KE3A 4HOIA 3IBRA 4JF6A 2K7SA 3E4OA 3OPLA 4LV3A 3LIDA 1M6KA 2V9AA 3EOIA 5TBMB 4X6TA 4KQRA 2L4RA 2A24A 4OOLA 3CPTA 1NY0A 2D01A 3HREA 3CG5A 2GDNA 1OTEA 3ZG0A 3UMEA 2EX2A 1Y4OA 1ODVA 3K3CA 1SCWA 5FAPA 5AJGA 4R70A 3G4PA 4K91A 1C3BA 4Y0OA 1ALQA 2HP6A 2XD5A 1F5MA 4EQ1A 3E4PA 2OLUA 5HDSA 2KDKA 2I72A 4KENB 3JVVA 4JXVA 1HZOA 1P9RA 5DTSA 3BY8A 3MZFA 4R23A 2ZBBA 4WELA 5F68A 4E3IA 2W27A 1KDSA 3QP6A 4UHUA 1KDWA 4HQAA 1FIKA 1F98A 4HH3A 4LV1A 3LO7A 2Y2QA 1SKOB 4KZ3A 4R3BA 3VP3A 3GV9A 1PYYA 4NK3A 2ZQ7A 4KZ9A 5CTNA 3D9YA 4WZ5C 4NG2A 4R4SA 4HH2A 1CF0A 1MPLA 4KQDA 4MMNA 4BQMA 4DJ3A 3VMAA 3F1NA 2PBDP 1W5DA 3BY9A 3TJZC 3IH9A 2A49A 4X68A 3GECA 2O9AA 4H6JB 4WLAA 3NY4A 2ZL1B 4WZ4A 1T19A 3O3VA 1HLUP 4NXFA 4S2NA 1DP9A 4RYEA 1OMEA 2PU2A 2DRWA 3UY6A 4X69A 3TRCA 2XSSA 2Q9MA 4NXEA 2H28A 2J3WA 2V8CA 3SH9A 3NI9A 3KSIA 3UE0A 2QYBA 2V0UA 4CLCA 3F1OA 4II7A 3EEHA 4HJ4A 5DF8A 3WS2A 3F1PB 1OTAA 5HWVA 1YLTA 1AXBA 1L0FA 1ESIA 2DNSA 2H0YA 1TS0A 3S1YA 3H7WB 3ZQ5A 4HY8A 1NXYA 1UWPX 3B47A 3IX4A 2Y2JA 4KZ4A 2W3EA 1WYCA 4GCZA 5KSHA 5F1GA 4HBTA 1GHIA 3S7NA 4Q0HA 3FV7A 2IWDA 1S1YA 3HLFA 1S67L 1KVLA 1LT0A 2ZM8A 1L0GA 4A5RA 1K6SA 1S6RA 4OPRA 3MXRA 4R3JA 4IUHA 2HZ5A 4IBRA 3T1XA 5KZHA 1EI5A 3BECA 1E3UD 3NJAA 4P85A 3WS5A 1H8YA 1K38A 3IX3A 5J8XA 1K55A 3PBSA 4RVAA 1JTGA 2PYPA 3VSLA 4BL3A 1VETA 4KUOA 4OLGA 4EV4A 2M7VA 3T1RA 1TDLA 2UV0E 4BD0A 3LEZA 5HD3A 3BJNA 1LHYA 4E3OA 4N92A 1DY6A 3O87A 3UB9A 2ZQAA 1GHMA 2VA0A 1CK3A 4YWZA 2Z2LB 4E3LA 4XUXA 1N9OA 2H0TA 4FD8A 3EWKA 4DE3A 4EUZA 2EWWA 4N1XA 3P98A 2MJ6A 2XLNA 4PKYG 4S2LA 4K08A 1XGIA 1YPRA 3CJMA 5JYOA 3T1SA 2LB9A 3MXSA 5AQ7A 3T4OA 2J7VA 4H8RA 5FDSA 2B02A 3R7WA 4O8GA 4I38A 3KYEA 2WGIA 3EQVA 2C5WB 5EPHA 1TS8A 4Z1WA 3TG9A 3V3RA 2Y2OA 1GSXA 1IKGA 3ZG9B 3DTKA 1SKOA 1YSQA 2QJ5A 3IS2A 1MWSA 5CXWA 2ZC5B 4QB8A 3DTEA 4GLQA 3V5MA 5KIZA 4X56A 1BLPA 2Y2GA 3ZFZA 3M6HA 1IYSA 4JPMA 4EUVA 1KOUA 1ZKJA 1NRFA 1IELA 2JC7A 2L0WA 3PXPA 1HVBA 2WAEA 4OVDA 4S2IA 1CI8A 2I9VA 3SOIA 3Q1FA 1MY8A 2GNXA 1NWZA 3S7OA 2KX6A 3IWQA 4LGWA 2BG1A 3VOZA 4YINA 1NJ4A 4GOGA 1Y54A 3MKFA 3CPTB 4EEUA 3BWLA 5M18A 3NOPC 4GB7A 5FQMA 3OBFA 4N9KA 3CAXA 1E25A 2JKTI 3UE3A 3IT9A 4O0PA 1G6OA 3PBRA 2EXBA 2R9WA 5HAPA 1CJFA 1W8YA 3QP5A 3NCKA 3S7PA 3ZYTA 3OPRA 3G2ZA 2VEAA 2PU4A 1ZHHB 3M6BA 4DXCA 4R38A 1WA9A 2FFYA 2V20A 3UDIA 2RL3A 3FWLA 4OPQA 3RJUA 2D02A 4PMAA 1S1ZA 1ES5A 1O07A 3FG8A 3Q7VB 2XD1A 4OPZA 4GDNA 4D60A 4OQ0A 4U3TA 3VP1A 3IF5A 3K2NA 4E6XA 4X53A 1CI9A 2EXAA 1LL8A 1YAXA 1YLWA 5EVIA 3IS2B 4QJGA 4P6ZM 1Q2PA 4C3QA 1PW1A 3Q82A 5DF7A 3G2YA 4E04A 3OLOA 4GKUA 3SH7A 3E2LA 2P74A 3CI6A 3MF0A 3LIBA 2Y8HA 2V1ZA 4X1LA 3BQ8A 5F6AA 5HW3A 3UPPA 4OOMA 2ZLYA 1N9LA 2P9VA 2B18A 3Q07A 1XXMA 3B33A 5CERA 1K0KA 2J9PA 4D2OA 1PI4A 1PWDA 5FSRA 3KSFA 1FR1A 1BLSA 2A3UA 5CRFA 1H0MA 1N4OA 4EBPA 4EW7A 2XFTA 5A90A 4NEED 2J8YA 2L1MA 3E98A 3MFXA 1LL5A 5F83A 3NDGA 3OPPA 2ZM0A 1D7EA 3BLSA 5IU1A 3N8RA 2HDRA 5DJTA 3DWZA 3T4TA 3HLWA 2Y2NA 1VETB 5HZHA 3DTIA 3LR0A 2VGLS 1XJ3A 2J80A 4WMCD 2XF3A 3WWXA 1XPBA 5CHMA 1LI9A 4OPYA 3ZG7B 1HTZA 2CMNA 4QY5A 3LCEA 3W2ZA 5A91A 1STZA 4CLCC 4UAAA 2Y2LA 3UDFA 2WADA 1YMSA 4MBFA 2W3DA 3H9WA 1IEMA 4XT2A 2PT7A 5KMWA 2QJ7A 1RGYA 4G3KA 2Y2HA 5F69A 1N9BA 1FSYA 2W1TA 2HDUA 4WBGA 1PI5A 5J4EA 2EX8A 4L9GA 2GX5A 3PHYA 2WKHA 2HPBA 1TVFA 3PBTA 2HJ9C 3IHBA 5TJJA 2W0NA 2XFSA 4HP9A 3VP2A 5F1FA 2PD7A 5L8MA 4ZJ2A 5HAQA 4RQ9A 5E43A 3NULA 5L09A 4F3LA 1VHMA 2FH5A 3VV4A 5M19A 1XFNA 2VZWA 4CLCB 1OTDA 3T12B 1EW0A 4DDYA 3EGXC 4DRTA 3KYZA 4OQIA 4OP8A 4CJNA 5A92A 3EGDC 2EX6A 3D72A 4MCWA 1I2SA 2E8IA 4CQHA 1GA0A 2ZQ8A 1SZVA 3ICYA 4MN5A 1I5QA 2PDRA 2ZL1A 3GSGA 1QMEA 3MR0A 2OLVA 1MWRA 4B88A 1PWCA 2Q9NA 3PBNA 2HV1A 2QPNA 3KSHA 4GD6A 4WEKA 2X01A 2BTFP 1IYPA 2E8JA 3MJQA 3IQAA 1J9MA 3HLCA 2J3TD 3VE4A 4OH0A 1BLCA 2ZC3B 2XR0A 5FQIA 4ZJ1A 1TDGA 1LL9A 5GL9A 4S2JA 2QKPA 5E2EA 3I7JA 4YOFA 4QWOA 4WUJA 4B9OA 4EQIA 5FQQA 2M7UA 3OC2A 4ZBEA 2XA7S 3A3JA 1XA1A 3Q7VA 2UWXA 4KQOA 1OJ5A 3C8CA 4PAUA 3T4JA 1GA9A 3LY3A 3NECA 1LSVA 4E3MA 1Q2QA 5G4ZA 2JCHA 1KE4A 4IEDA 3WRZA 1P97A 1U60A 2VGJA 4GDBA 5G4YA 3BEBA 4PKYA 1BTLA 1JWPA 1IYQA 4UEYA 3ZG8B 3V67A 3LICA 5A8BA 4JF4A 4EU0A 2Z2MB 5TFQA 4EERA 5HPIA 1JWZA 2Q0OA 4UA9A 3NIAA 2HGVA 3IH8A 3PBOA 4S2NC 4OP5A 1IYOA 3A0VA 3FKVA 1K55C 4MDZA 5GLDA 3P01A 1KGFA 1LI0A 2IWCA 2Y4AA 3OZHA 4JLFA 3LI8A 1L0DA 1ES4A 2JKFA 4WZ5A 2G2WA 2VJWA 3UMDA 4MBHA 4EXOA 3D3OA 3W4OA 4CPKA 4BLMA 3DAVA 1SDEA 2XH9A 3LI9A 4S2MA 3GDIA 5GHXA 2Y55A 1NLYA 3NBLA 1L2SA 3LUQA 3KYQA 3IWOA 3E4QA 1DJCA 2JN7A 4GHIB 3OOVA 2Z6DA 3DBAA 5CHJA 3VOLA 2ZC4B 5HWTA 4S2PA 3Q7ZA 4BENA 1MKMA 5LBRA 2HP5A 3CHWP 4K0XA 4M3KA 3C7VA 3W4QA 4EETB 4GD8A 3R7WB 4ARZA 1KVMA 4DJ2A 2JHEA 4FSFA 4E3NA 2PD8A 1W8QA 4I3IA 4OQHA 3SS3A 3LR4A 5HAIA 4UA6A 3BRMA 3S22A 4EESA 3QHYA 4LPZA 1DJAA 2ZQCA 5FI7A 4LENA 4PM9A 3CWFA 5HX9A 4FH4A 4FCFA 2OAQ1 4L9EA 1EWZA 2G7UA 5EUAA 3IXBA 2WGWA 1ES3A 1XJ6A 5FEFA 2OAP1 4MBKA 4BBUA 5G18A 1K56D 2XDMA 3SH8A 3MZDA 4P6ZS 1K56A 4DF6A 5BOHA 4E3KA 2YKHA 4KUKA 2B5RA 1MBLA 3GQZA 4X55A 5FQJA 1OTIA 4YNRA 2QZ6A 4KG2A 4C6YA 3A3EA 1FQGA 1FCOA 2QHKA 4K0WA 2RCXA 3A0RA 2Y2MA 3UB5P 4IVIA 4IBXA 2WZXA 2HDSA 2M1CA 2O0YA 2QMIA 1T1BA 4PM7A 1V9ZA 4F3LB 2O99A 1DRMA 4X25A 4HESA 1L3LA 3IXDA 5FEGA 1DP6A 4ETXA 3LEQA 3HUOA 1FILA 2EA9A 3VP4A 4WMCA 3WRTA 4ZDXA 3UB7A 3TOIA 4N9LA 4LV0A 2W1TB 3HL9A 1K25A 2EX9A 3E0YA 4Y17A 3UE1A 1N9NA 1PFLA 2EFUA 4G3WA 1ZG4A 2INWA 3HUNA 4BBVA 2H10A 4ARZB 3F1PA 4R4RA 1YSPA 3DW0A 3NDEA 5I94A 3HLBA 3ZHHA 5TGFA 1S66L 4KZAA 1GSVA 1J3WA 2K31A 1PW8A 3CMZA 2FFFB 5EM1A 4N1HA 2W1RA 1G68A 4WN5A 1MXOA 1YLYA 3RXWA 2VV7A 3GVBA 4LRYC 4QD4A 4NXBA 4BD1A 2P04A 2ZMVA 5FQKA 3JPUA 4PM6A 1O7EA 4QU3A 4RA7A 1MZUA 4JGRA 4OONA 2ACGA 4O01A 4RX2A 2WGWB 3MQOA 3W8KA 1K54C 1T1AA 3F1NB 1JTDA 5MC7A 2P7JA 1IFQA 3A3IA 1OJGA 4EEPA 4LCLA 2R78A 4JXWA 4Y15A 3UPOA 2WGVA 2X02A 3ITAA 3QP8A 1L0EA 3C5AA 4U0TA 2IWBA 4KZ7A 1RCJA 3S4XA 2KLIA 3T1QB 2QWSA 5EOOA 3G6OA 3MFDA 1ZC2A 4I3JA 4GZBA 1NLZA 3CLOA 1ACFA 2WKIA 2Y2IA 3EQUA 4DKIA 4I5SA 3BFEA 3K3DA 3U2AA 3MMHA 5CHUA 4QHCA 3FKWA 3A3DA 3BFFA 2W3GA 1ZG6A 3N7WA 5FAQA 2EFXA 1F2KA 3MQ0A 4KZ8A 4XUZA 5GLBA 2PYRA 1PZPA 3IHAA 2XEPA 5EM0A 1CQAA 2VGLM 2ZOHA 1GCEA 4ZAMA 4U0XA 1QMFA 3N8LA 3C30A 1VB6A 3QNCA 4L0LA 1KGGA 1F9IA 3T4SA 3C4PA 4IJGA 1G5UA 3RFBA 2VV8A 5EV0A 2WKPA 4LV2A 5L2FA 3CITA 5IS1A 1M40A 3UDXA 1T18A 5DTTA 1FOFA 4FUWA 1K57C 2CC1A 1CEGA 3VFHA 2JKGA 4ME4A 3L7HA 4UA7A 5EFWA 2V2FF 4WL9A 3OCNA 5CEDA 2VGKA 3M2JA 3N4IA 5EVLA 2C6WB 2VLGA 3LFVA 5FI6A 5HPFA 4EBLA 2Y2PA 5CECA 5HARA 3AGEA 1WYBA 2ZJ9A 1GHPA 1ONHA 3HLDA 2XQZA 3BYDA 3UB8A 1LSXA 4WF0A 1ES2A 5E2HA 3BLMA 3T4QA 3RXXA 4MNRA 3B42A 4YFMA 2WYXA 3FC7A 5HDDA 3SZTA 1YLZA 4LCMA 2A2LA 4B4ZA 5AVEA 2WZZA 2JKRM 1UWNX 4KZ5A 3NOUC 3HUMA 1MWUA 4C75A 4XXRA 2K2NA 5U47A 1XGJA 4LFUA 4R3AA 2OV5A 3IX8A 3MS6A 2W3FA 4JGOA 3ITBA 4OKPA 1K4FA 3V50A 3KSGA 4XT2B 1XJ2A 1YMXA 1PWGA 3IF6B 1W7FA 1BZAA 5E2GA 5EECA 3L9KA 3G32A 2VV6A 1V9YA 2H5SA 1W63Q 3FPWA 1ONGA 2WKEA 1NYYA 3G30A 5DKKA 3KO6A 4GS9B 1PZOA 2O9CA 2DCFA 4FTXA 3TW8A 4BL2A 3VE3A 3GMWA 5HDCA 4FOFA 4HI4A 1E4DA 3TSGA 1VEUB 5FL3A 4X1MA 2PBYA 4HP4A 2ZD8A 3BFGA 5EVEA 2HF6A 1TF1A 2LB5A 2ZOIA 3HCYA 2J9OA 4NETA 1XFQA 1CEFA 4JF5A 5HL6A 3C2WA 3VOYA 4HIAA 4LLOB 3A3FA 5GLCA 3NC8A 5EOEA 2PR5A 1A0KA 2JE5A 1UGUA 5CX7A 3ULFA 3BQAA 5HFOA 5EVIC 1Z09A 3UN7A 1T1CA 2HJEA 4CLCD 1VQQA 5FQ9A 3TE8A 1BUEA 2AVXA 1IKIA 4PM5A 4JBFA 4DMZA 3ZGAB 1MWTA 1YT4A 2KOIA 1RGZA 5GLAA 3O86A 3HJIA 2NUPC 1BYWA 1XKZA 3NHQA 1SHVA 3CUEA 4ZRRA 1TEMA 3ISGA 5KSCA 3HVFA 1W79A 2PAVP 4FH2A 2XK1A 1MC0A 3ZG5A 1SKFA 4Y3IA 4DE0A 2PRFA 3SS4A 1OPXA 4MLLA 1ESUA 3IF6C 3F1OB 4WYYA 4JXGA 1VM1A 2GJ3A 1FCNA 4BJPA 2Y59A 5TR7A 3DTMA 1OTBA 3V39A 2WK0A 5F5YA 4Y13A 3DWKA 3FZCA 2P08A 5FASA 3Q81A 3ZCZA 1JNUA 3CUEC 1K4EA 4LRXC 3ZDJA 2P9VB 3P09A 4S2OA 3GTCA 4H6JA 5IT5A 2IA2A 5M1AA 4Q0IA 5JYPA 3G31A 5CGWA 4Y0TA 4L9FA 4R6LA 4NXGA 2JKRI 5AQAA 3H82A 5J7EA 3UNWA 2JKTM 3ZVWA 1HD8A 4PHTA 1P0ZA 4DDSA 4DE2A 3P7NA 3C38A 3CZDA 3MKEA 5E2FA 3FPVA 3LIAA 4GN2A 2ZM2A 5L07A 2HDQA 4DE1A 3AGFA 3SW1A 4OLDA 2ZC7A 4JGPA 1BLHA 3BFDA 2WAFA 4GNUA 3N8SA 1K57A 3WS4A 4KQQA 4OQGA 5CEBA 3UO9A 3ZNYA 3U4LP 5AQ9A 2YKFA 4MN6A 1K54A 1PIOA 3SS5A 3UB6A 3PBQA 5F82A 1ERQA 3H82B 3R4KA 3W4PA 4WEJA 3PAEA 1XA7A 3C4OA 3OCLA 4GHIA 5DFYA 1IOUA 5DFXA 2ZC6B 5HL1A 3O88A 4R1GA 3T4KA 1YQSA 4DXBA 5I5LA 2VKSA 5TBMA 1XP4A 1YM1A 4GJ4A 3G35A 4P87A 3UPNA 3D4FA 4UQIS 2V8FA 3IXHA 1FSWA 4Y2FA 2B95A 2NUTC 1K6RA 3ZNTA 4S2KA 3GRJA 1I2WA 5AVFA 3HJKA 1PNEA 1TS7A 2OWHA 3QP1A 5CGSA 5HSQA 5AQBA 1H8MA 4Z9QA 1NZOA 1JVJA 5HWWA 1OT9A 1H8ZA 3B3XA 2Y91A 3WS1A 4B93A 5D3OA 4HEFA 5GHZA 4I39A 1TD5A 4LRZE 2ZMFA 5DF9A 1WE4A 1AWIA 2ZQ9A 5HD5A 1X0OA 2BASA 1LSWA 1NRJA 1H5XA 2V0WA 3N6IA 5CGXA 5A93A 1W63M 3C7UA 2OWJA 5FA7A 4KZ6A 3LY4A 3O5YA 3T4LA 2R9XA 3KX0X 2O9BA 2PR6A 5K5BA 4Q0JA 5FATA 4JXSA 2PHYA 5C5KA 2DMWA 3JVUA 3IXGA 3VSKA 4JKTA 3EEAA 4PPRA 1JWVA 5DTKA 3VP0A 3LR3A 3BW6A 4E3JA 5FAOA 2X71A 2FZ0A 2VX8A 1FR6A 1S4SA 4MN7A 4QY6A 1XJ4A 1EROA 1SDNA 2EWVA 4ID4A 4OOYA 2WKQA 1ERMA 3NOTC 4O7DA 4IVKA 2J3TC 3V3SA 3HBRA 5DJUA 3MQQA 3H7WA 3ZVTA 1Z6FA 3MSHA 1KGEA 3IBJA 1ZTUA 3RTYA 3M2KA 3QP2A 4WM9A 1NZUA 4Y5FA 4HBUA 2OSUA 2XROA 3PTEA 5FI2A 4GW9A 4F94A 4BMWA 4JGQA 3LIFA 5EVID 3QP4A 3LGOA 3T50A 4B4XA 4GS9A 2XA7M 2JBFA 4EBNA 4EWFA 5L10A 3IWIA 1BULA 3PYPA 2V1AA 1G6AA 4HJ6A 1MKIA 4CLCE 4ESPA 3BFCA 3JYIA 1BT5A 1YLJA 2GZAA 5J3WA 4NKPA 3LYXA 4KZBA 4HJ3A 1D1JA 2HP9A 5EE8A 3FYZA 3QNBA 1VEUA 2OOLA 4Q8IA 3MXQA 3PAGA 2WUQA 2Z6CA 4IUKA 3MBZA 4MEZA 3BM6A 2W3HA 4P6BA 1DJBA 4I3AA 1OT6A 1RP5A 2Y2KA 4G3VA 4HHDA 4KG5A 4ZJ3A 1KE0A 2ZMAA 1YLPA 4P0MA 3S7QA 4HNBA 3GR2A 3IF6A 4Y0UA 3OPHA 4IHQA 5DVAA 1XX2A 2V1BA 4AFIA 1S4RA 3AGDA 1DP8A 4BWIA 1BSGA 2Y79A 2ZQDA 3PR6A 2WKRA 4PM8A 4UQIM 3LR5A 1GSWA 2G2UA 3E2KA 1LLBA 1NYMA 5FDHA 3HLEA 1TS6A 1D06A 4KG6A 3UE6A 3VFFA 5EVIB 4ZTKA 5GHYA 2A24B 4BBTA 1G28A 4E6WA 1YKDA 1S0WA 3WS0A 2XRNA 1Y28A
chains in the Genus database with same CATH topology
1L3LA 4LGWA 3IX4A 3QP5A 2Q0OA 2UV0E 5L10A 4LFUA 3QP2A 4NG2A 3QP1A 3IX8A 5L09A 1H0MA 5L07A 4Y15A 3QP8A 3SZTA 2AVXA 3IX3A 3JPUA 3QP6A 3QP4A 4Y13A 4Y17A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L3L A;  4LGW A;  3IX4 A;  3QP5 A;  2Q0O A;  2UV0 E;  5L10 A;  4LFU A;  3QP2 A;  4NG2 A;  3QP1 A;  3IX8 A;  5L09 A;  1H0M A;  5L07 A;  4Y15 A;  3QP8 A;  3SZT A;  2AVX A;  3IX3 A;  3JPU A;  3QP6 A;  3QP4 A;  4Y13 A;  4Y17 A; 
#chains in the Genus database with same CATH topology
 1FCM A;  2XGN A;  3LIE A;  1H3Q A;  5DKL A;  1PRQ A;  4Y7P A;  4R0Q A;  5CTM A;  1E3U A;  4QPR A;  4DN0 A;  3A0S A;  3MZE A;  4RX3 A;  4ETZ A;  3RH8 B;  5IHV A;  1P9W A;  3G34 A;  4M4X A;  2BLS A;  2VK3 A;  3HLG A;  1KE3 A;  4HOI A;  3IBR A;  4JF6 A;  2K7S A;  3E4O A;  3OPL A;  4LV3 A;  3LID A;  1M6K A;  2V9A A;  3EOI A;  5TBM B;  4X6T A;  4KQR A;  2L4R A;  2A24 A;  4OOL A;  3CPT A;  1NY0 A;  2D01 A;  3HRE A;  3CG5 A;  2GDN A;  1OTE A;  3ZG0 A;  3UME A;  2EX2 A;  1Y4O A;  1ODV A;  3K3C A;  1SCW A;  5FAP A;  5AJG A;  4R70 A;  3G4P A;  4K91 A;  1C3B A;  4Y0O A;  1ALQ A;  2HP6 A;  2XD5 A;  1F5M A;  4EQ1 A;  3E4P A;  2OLU A;  5HDS A;  2KDK A;  2I72 A;  4KEN B;  3JVV A;  4JXV A;  1HZO A;  1P9R A;  5DTS A;  3BY8 A;  3MZF A;  4R23 A;  2ZBB A;  4WEL A;  5F68 A;  4E3I A;  2W27 A;  1KDS A;  3QP6 A;  4UHU A;  1KDW A;  4HQA A;  1FIK A;  1F98 A;  4HH3 A;  4LV1 A;  3LO7 A;  2Y2Q A;  1SKO B;  4KZ3 A;  4R3B A;  3VP3 A;  3GV9 A;  1PYY A;  4NK3 A;  2ZQ7 A;  4KZ9 A;  5CTN A;  3D9Y A;  4WZ5 C;  4NG2 A;  4R4S A;  4HH2 A;  1CF0 A;  1MPL A;  4KQD A;  4MMN A;  4BQM A;  4DJ3 A;  3VMA A;  3F1N A;  2PBD P;  1W5D A;  3BY9 A;  3TJZ C;  3IH9 A;  2A49 A;  4X68 A;  3GEC A;  2O9A A;  4H6J B;  4WLA A;  3NY4 A;  2ZL1 B;  4WZ4 A;  1T19 A;  3O3V A;  1HLU P;  4NXF A;  4S2N A;  1DP9 A;  4RYE A;  1OME A;  2PU2 A;  2DRW A;  3UY6 A;  4X69 A;  3TRC A;  2XSS A;  2Q9M A;  4NXE A;  2H28 A;  2J3W A;  2V8C A;  3SH9 A;  3NI9 A;  3KSI A;  3UE0 A;  2QYB A;  2V0U A;  4CLC A;  3F1O A;  4II7 A;  3EEH A;  4HJ4 A;  5DF8 A;  3WS2 A;  3F1P B;  1OTA A;  5HWV A;  1YLT A;  1AXB A;  1L0F A;  1ESI A;  2DNS A;  2H0Y A;  1TS0 A;  3S1Y A;  3H7W B;  3ZQ5 A;  4HY8 A;  1NXY A;  1UWP X;  3B47 A;  3IX4 A;  2Y2J A;  4KZ4 A;  2W3E A;  1WYC A;  4GCZ A;  5KSH A;  5F1G A;  4HBT A;  1GHI A;  3S7N A;  4Q0H A;  3FV7 A;  2IWD A;  1S1Y A;  3HLF A;  1S67 L;  1KVL A;  1LT0 A;  2ZM8 A;  1L0G A;  4A5R A;  1K6S A;  1S6R A;  4OPR A;  3MXR A;  4R3J A;  4IUH A;  2HZ5 A;  4IBR A;  3T1X A;  5KZH A;  1EI5 A;  3BEC A;  1E3U D;  3NJA A;  4P85 A;  3WS5 A;  1H8Y A;  1K38 A;  3IX3 A;  5J8X A;  1K55 A;  3PBS A;  4RVA A;  1JTG A;  2PYP A;  3VSL A;  4BL3 A;  1VET A;  4KUO A;  4OLG A;  4EV4 A;  2M7V A;  3T1R A;  1TDL A;  2UV0 E;  4BD0 A;  3LEZ A;  5HD3 A;  3BJN A;  1LHY A;  4E3O A;  4N92 A;  1DY6 A;  3O87 A;  3UB9 A;  2ZQA A;  1GHM A;  2VA0 A;  1CK3 A;  4YWZ A;  2Z2L B;  4E3L A;  4XUX A;  1N9O A;  2H0T A;  4FD8 A;  3EWK A;  4DE3 A;  4EUZ A;  2EWW A;  4N1X A;  3P98 A;  2MJ6 A;  2XLN A;  4PKY G;  4S2L A;  4K08 A;  1XGI A;  1YPR A;  3CJM A;  5JYO A;  3T1S A;  2LB9 A;  3MXS A;  5AQ7 A;  3T4O A;  2J7V A;  4H8R A;  5FDS A;  2B02 A;  3R7W A;  4O8G A;  4I38 A;  3KYE A;  2WGI A;  3EQV A;  2C5W B;  5EPH A;  1TS8 A;  4Z1W A;  3TG9 A;  3V3R A;  2Y2O A;  1GSX A;  1IKG A;  3ZG9 B;  3DTK A;  1SKO A;  1YSQ A;  2QJ5 A;  3IS2 A;  1MWS A;  5CXW A;  2ZC5 B;  4QB8 A;  3DTE A;  4GLQ A;  3V5M A;  5KIZ A;  4X56 A;  1BLP A;  2Y2G A;  3ZFZ A;  3M6H A;  1IYS A;  4JPM A;  4EUV A;  1KOU A;  1ZKJ A;  1NRF A;  1IEL A;  2JC7 A;  2L0W A;  3PXP A;  1HVB A;  2WAE A;  4OVD A;  4S2I A;  1CI8 A;  2I9V A;  3SOI A;  3Q1F A;  1MY8 A;  2GNX A;  1NWZ A;  3S7O A;  2KX6 A;  3IWQ A;  4LGW A;  2BG1 A;  3VOZ A;  4YIN A;  1NJ4 A;  4GOG A;  1Y54 A;  3MKF A;  3CPT B;  4EEU A;  3BWL A;  5M18 A;  3NOP C;  4GB7 A;  5FQM A;  3OBF A;  4N9K A;  3CAX A;  1E25 A;  2JKT I;  3UE3 A;  3IT9 A;  4O0P A;  1G6O A;  3PBR A;  2EXB A;  2R9W A;  5HAP A;  1CJF A;  1W8Y A;  3QP5 A;  3NCK A;  3S7P A;  3ZYT A;  3OPR A;  3G2Z A;  2VEA A;  2PU4 A;  1ZHH B;  3M6B A;  4DXC A;  4R38 A;  1WA9 A;  2FFY A;  2V20 A;  3UDI A;  2RL3 A;  3FWL A;  4OPQ A;  3RJU A;  2D02 A;  4PMA A;  1S1Z A;  1ES5 A;  1O07 A;  3FG8 A;  3Q7V B;  2XD1 A;  4OPZ A;  4GDN A;  4D60 A;  4OQ0 A;  4U3T A;  3VP1 A;  3IF5 A;  3K2N A;  4E6X A;  4X53 A;  1CI9 A;  2EXA A;  1LL8 A;  1YAX A;  1YLW A;  5EVI A;  3IS2 B;  4QJG A;  4P6Z M;  1Q2P A;  4C3Q A;  1PW1 A;  3Q82 A;  5DF7 A;  3G2Y A;  4E04 A;  3OLO A;  4GKU A;  3SH7 A;  3E2L A;  2P74 A;  3CI6 A;  3MF0 A;  3LIB A;  2Y8H A;  2V1Z A;  4X1L A;  3BQ8 A;  5F6A A;  5HW3 A;  3UPP A;  4OOM A;  2ZLY A;  1N9L A;  2P9V A;  2B18 A;  3Q07 A;  1XXM A;  3B33 A;  5CER A;  1K0K A;  2J9P A;  4D2O A;  1PI4 A;  1PWD A;  5FSR A;  3KSF A;  1FR1 A;  1BLS A;  2A3U A;  5CRF A;  1H0M A;  1N4O A;  4EBP A;  4EW7 A;  2XFT A;  5A90 A;  4NEE D;  2J8Y A;  2L1M A;  3E98 A;  3MFX A;  1LL5 A;  5F83 A;  3NDG A;  3OPP A;  2ZM0 A;  1D7E A;  3BLS A;  5IU1 A;  3N8R A;  2HDR A;  5DJT A;  3DWZ A;  3T4T A;  3HLW A;  2Y2N A;  1VET B;  5HZH A;  3DTI A;  3LR0 A;  2VGL S;  1XJ3 A;  2J80 A;  4WMC D;  2XF3 A;  3WWX A;  1XPB A;  5CHM A;  1LI9 A;  4OPY A;  3ZG7 B;  1HTZ A;  2CMN A;  4QY5 A;  3LCE A;  3W2Z A;  5A91 A;  1STZ A;  4CLC C;  4UAA A;  2Y2L A;  3UDF A;  2WAD A;  1YMS A;  4MBF A;  2W3D A;  3H9W A;  1IEM A;  4XT2 A;  2PT7 A;  5KMW A;  2QJ7 A;  1RGY A;  4G3K A;  2Y2H A;  5F69 A;  1N9B A;  1FSY A;  2W1T A;  2HDU A;  4WBG A;  1PI5 A;  5J4E A;  2EX8 A;  4L9G A;  2GX5 A;  3PHY A;  2WKH A;  2HPB A;  1TVF A;  3PBT A;  2HJ9 C;  3IHB A;  5TJJ A;  2W0N A;  2XFS A;  4HP9 A;  3VP2 A;  5F1F A;  2PD7 A;  5L8M A;  4ZJ2 A;  5HAQ A;  4RQ9 A;  5E43 A;  3NUL A;  5L09 A;  4F3L A;  1VHM A;  2FH5 A;  3VV4 A;  5M19 A;  1XFN A;  2VZW A;  4CLC B;  1OTD A;  3T12 B;  1EW0 A;  4DDY A;  3EGX C;  4DRT A;  3KYZ A;  4OQI A;  4OP8 A;  4CJN A;  5A92 A;  3EGD C;  2EX6 A;  3D72 A;  4MCW A;  1I2S A;  2E8I A;  4CQH A;  1GA0 A;  2ZQ8 A;  1SZV A;  3ICY A;  4MN5 A;  1I5Q A;  2PDR A;  2ZL1 A;  3GSG A;  1QME A;  3MR0 A;  2OLV A;  1MWR A;  4B88 A;  1PWC A;  2Q9N A;  3PBN A;  2HV1 A;  2QPN A;  3KSH A;  4GD6 A;  4WEK A;  2X01 A;  2BTF P;  1IYP A;  2E8J A;  3MJQ A;  3IQA A;  1J9M A;  3HLC A;  2J3T D;  3VE4 A;  4OH0 A;  1BLC A;  2ZC3 B;  2XR0 A;  5FQI A;  4ZJ1 A;  1TDG A;  1LL9 A;  5GL9 A;  4S2J A;  2QKP A;  5E2E A;  3I7J A;  4YOF A;  4QWO A;  4WUJ A;  4B9O A;  4EQI A;  5FQQ A;  2M7U A;  3OC2 A;  4ZBE A;  2XA7 S;  3A3J A;  1XA1 A;  3Q7V A;  2UWX A;  4KQO A;  1OJ5 A;  3C8C A;  4PAU A;  3T4J A;  1GA9 A;  3LY3 A;  3NEC A;  1LSV A;  4E3M A;  1Q2Q A;  5G4Z A;  2JCH A;  1KE4 A;  4IED A;  3WRZ A;  1P97 A;  1U60 A;  2VGJ A;  4GDB A;  5G4Y A;  3BEB A;  4PKY A;  1BTL A;  1JWP A;  1IYQ A;  4UEY A;  3ZG8 B;  3V67 A;  3LIC A;  5A8B A;  4JF4 A;  4EU0 A;  2Z2M B;  5TFQ A;  4EER A;  5HPI A;  1JWZ A;  2Q0O A;  4UA9 A;  3NIA A;  2HGV A;  3IH8 A;  3PBO A;  4S2N C;  4OP5 A;  1IYO A;  3A0V A;  3FKV A;  1K55 C;  4MDZ A;  5GLD A;  3P01 A;  1KGF A;  1LI0 A;  2IWC A;  2Y4A A;  3OZH A;  4JLF A;  3LI8 A;  1L0D A;  1ES4 A;  2JKF A;  4WZ5 A;  2G2W A;  2VJW A;  3UMD A;  4MBH A;  4EXO A;  3D3O A;  3W4O A;  4CPK A;  4BLM A;  3DAV A;  1SDE A;  2XH9 A;  3LI9 A;  4S2M A;  3GDI A;  5GHX A;  2Y55 A;  1NLY A;  3NBL A;  1L2S A;  3LUQ A;  3KYQ A;  3IWO A;  3E4Q A;  1DJC A;  2JN7 A;  4GHI B;  3OOV A;  2Z6D A;  3DBA A;  5CHJ A;  3VOL A;  2ZC4 B;  5HWT A;  4S2P A;  3Q7Z A;  4BEN A;  1MKM A;  5LBR A;  2HP5 A;  3CHW P;  4K0X A;  4M3K A;  3C7V A;  3W4Q A;  4EET B;  4GD8 A;  3R7W B;  4ARZ A;  1KVM A;  4DJ2 A;  2JHE A;  4FSF A;  4E3N A;  2PD8 A;  1W8Q A;  4I3I A;  4OQH A;  3SS3 A;  3LR4 A;  5HAI A;  4UA6 A;  3BRM A;  3S22 A;  4EES A;  3QHY A;  4LPZ A;  1DJA A;  2ZQC A;  5FI7 A;  4LEN A;  4PM9 A;  3CWF A;  5HX9 A;  4FH4 A;  4FCF A;  2OAQ 1;  4L9E A;  1EWZ A;  2G7U A;  5EUA A;  3IXB A;  2WGW A;  1ES3 A;  1XJ6 A;  5FEF A;  2OAP 1;  4MBK A;  4BBU A;  5G18 A;  1K56 D;  2XDM A;  3SH8 A;  3MZD A;  4P6Z S;  1K56 A;  4DF6 A;  5BOH A;  4E3K A;  2YKH A;  4KUK A;  2B5R A;  1MBL A;  3GQZ A;  4X55 A;  5FQJ A;  1OTI A;  4YNR A;  2QZ6 A;  4KG2 A;  4C6Y A;  3A3E A;  1FQG A;  1FCO A;  2QHK A;  4K0W A;  2RCX A;  3A0R A;  2Y2M A;  3UB5 P;  4IVI A;  4IBX A;  2WZX A;  2HDS A;  2M1C A;  2O0Y A;  2QMI A;  1T1B A;  4PM7 A;  1V9Z A;  4F3L B;  2O99 A;  1DRM A;  4X25 A;  4HES A;  1L3L A;  3IXD A;  5FEG A;  1DP6 A;  4ETX A;  3LEQ A;  3HUO A;  1FIL A;  2EA9 A;  3VP4 A;  4WMC A;  3WRT A;  4ZDX A;  3UB7 A;  3TOI A;  4N9L A;  4LV0 A;  2W1T B;  3HL9 A;  1K25 A;  2EX9 A;  3E0Y A;  4Y17 A;  3UE1 A;  1N9N A;  1PFL A;  2EFU A;  4G3W A;  1ZG4 A;  2INW A;  3HUN A;  4BBV A;  2H10 A;  4ARZ B;  3F1P A;  4R4R A;  1YSP A;  3DW0 A;  3NDE A;  5I94 A;  3HLB A;  3ZHH A;  5TGF A;  1S66 L;  4KZA A;  1GSV A;  1J3W A;  2K31 A;  1PW8 A;  3CMZ A;  2FFF B;  5EM1 A;  4N1H A;  2W1R A;  1G68 A;  4WN5 A;  1MXO A;  1YLY A;  3RXW A;  2VV7 A;  3GVB A;  4LRY C;  4QD4 A;  4NXB A;  4BD1 A;  2P04 A;  2ZMV A;  5FQK A;  3JPU A;  4PM6 A;  1O7E A;  4QU3 A;  4RA7 A;  1MZU A;  4JGR A;  4OON A;  2ACG A;  4O01 A;  4RX2 A;  2WGW B;  3MQO A;  3W8K A;  1K54 C;  1T1A A;  3F1N B;  1JTD A;  5MC7 A;  2P7J A;  1IFQ A;  3A3I A;  1OJG A;  4EEP A;  4LCL A;  2R78 A;  4JXW A;  4Y15 A;  3UPO A;  2WGV A;  2X02 A;  3ITA A;  3QP8 A;  1L0E A;  3C5A A;  4U0T A;  2IWB A;  4KZ7 A;  1RCJ A;  3S4X A;  2KLI A;  3T1Q B;  2QWS A;  5EOO A;  3G6O A;  3MFD A;  1ZC2 A;  4I3J A;  4GZB A;  1NLZ A;  3CLO A;  1ACF A;  2WKI A;  2Y2I A;  3EQU A;  4DKI A;  4I5S A;  3BFE A;  3K3D A;  3U2A A;  3MMH A;  5CHU A;  4QHC A;  3FKW A;  3A3D A;  3BFF A;  2W3G A;  1ZG6 A;  3N7W A;  5FAQ A;  2EFX A;  1F2K A;  3MQ0 A;  4KZ8 A;  4XUZ A;  5GLB A;  2PYR A;  1PZP A;  3IHA A;  2XEP A;  5EM0 A;  1CQA A;  2VGL M;  2ZOH A;  1GCE A;  4ZAM A;  4U0X A;  1QMF A;  3N8L A;  3C30 A;  1VB6 A;  3QNC A;  4L0L A;  1KGG A;  1F9I A;  3T4S A;  3C4P A;  4IJG A;  1G5U A;  3RFB A;  2VV8 A;  5EV0 A;  2WKP A;  4LV2 A;  5L2F A;  3CIT A;  5IS1 A;  1M40 A;  3UDX A;  1T18 A;  5DTT A;  1FOF A;  4FUW A;  1K57 C;  2CC1 A;  1CEG A;  3VFH A;  2JKG A;  4ME4 A;  3L7H A;  4UA7 A;  5EFW A;  2V2F F;  4WL9 A;  3OCN A;  5CED A;  2VGK A;  3M2J A;  3N4I A;  5EVL A;  2C6W B;  2VLG A;  3LFV A;  5FI6 A;  5HPF A;  4EBL A;  2Y2P A;  5CEC A;  5HAR A;  3AGE A;  1WYB A;  2ZJ9 A;  1GHP A;  1ONH A;  3HLD A;  2XQZ A;  3BYD A;  3UB8 A;  1LSX A;  4WF0 A;  1ES2 A;  5E2H A;  3BLM A;  3T4Q A;  3RXX A;  4MNR A;  3B42 A;  4YFM A;  2WYX A;  3FC7 A;  5HDD A;  3SZT A;  1YLZ A;  4LCM A;  2A2L A;  4B4Z A;  5AVE A;  2WZZ A;  2JKR M;  1UWN X;  4KZ5 A;  3NOU C;  3HUM A;  1MWU A;  4C75 A;  4XXR A;  2K2N A;  5U47 A;  1XGJ A;  4LFU A;  4R3A A;  2OV5 A;  3IX8 A;  3MS6 A;  2W3F A;  4JGO A;  3ITB A;  4OKP A;  1K4F A;  3V50 A;  3KSG A;  4XT2 B;  1XJ2 A;  1YMX A;  1PWG A;  3IF6 B;  1W7F A;  1BZA A;  5E2G A;  5EEC A;  3L9K A;  3G32 A;  2VV6 A;  1V9Y A;  2H5S A;  1W63 Q;  3FPW A;  1ONG A;  2WKE A;  1NYY A;  3G30 A;  5DKK A;  3KO6 A;  4GS9 B;  1PZO A;  2O9C A;  2DCF A;  4FTX A;  3TW8 A;  4BL2 A;  3VE3 A;  3GMW A;  5HDC A;  4FOF A;  4HI4 A;  1E4D A;  3TSG A;  1VEU B;  5FL3 A;  4X1M A;  2PBY A;  4HP4 A;  2ZD8 A;  3BFG A;  5EVE A;  2HF6 A;  1TF1 A;  2LB5 A;  2ZOI A;  3HCY A;  2J9O A;  4NET A;  1XFQ A;  1CEF A;  4JF5 A;  5HL6 A;  3C2W A;  3VOY A;  4HIA A;  4LLO B;  3A3F A;  5GLC A;  3NC8 A;  5EOE A;  2PR5 A;  1A0K A;  2JE5 A;  1UGU A;  5CX7 A;  3ULF A;  3BQA A;  5HFO A;  5EVI C;  1Z09 A;  3UN7 A;  1T1C A;  2HJE A;  4CLC D;  1VQQ A;  5FQ9 A;  3TE8 A;  1BUE A;  2AVX A;  1IKI A;  4PM5 A;  4JBF A;  4DMZ A;  3ZGA B;  1MWT A;  1YT4 A;  2KOI A;  1RGZ A;  5GLA A;  3O86 A;  3HJI A;  2NUP C;  1BYW A;  1XKZ A;  3NHQ A;  1SHV A;  3CUE A;  4ZRR A;  1TEM A;  3ISG A;  5KSC A;  3HVF A;  1W79 A;  2PAV P;  4FH2 A;  2XK1 A;  1MC0 A;  3ZG5 A;  1SKF A;  4Y3I A;  4DE0 A;  2PRF A;  3SS4 A;  1OPX A;  4MLL A;  1ESU A;  3IF6 C;  3F1O B;  4WYY A;  4JXG A;  1VM1 A;  2GJ3 A;  1FCN A;  4BJP A;  2Y59 A;  5TR7 A;  3DTM A;  1OTB A;  3V39 A;  2WK0 A;  5F5Y A;  4Y13 A;  3DWK A;  3FZC A;  2P08 A;  5FAS A;  3Q81 A;  3ZCZ A;  1JNU A;  3CUE C;  1K4E A;  4LRX C;  3ZDJ A;  2P9V B;  3P09 A;  4S2O A;  3GTC A;  4H6J A;  5IT5 A;  2IA2 A;  5M1A A;  4Q0I A;  5JYP A;  3G31 A;  5CGW A;  4Y0T A;  4L9F A;  4R6L A;  4NXG A;  2JKR I;  5AQA A;  3H82 A;  5J7E A;  3UNW A;  2JKT M;  3ZVW A;  1HD8 A;  4PHT A;  1P0Z A;  4DDS A;  4DE2 A;  3P7N A;  3C38 A;  3CZD A;  3MKE A;  5E2F A;  3FPV A;  3LIA A;  4GN2 A;  2ZM2 A;  5L07 A;  2HDQ A;  4DE1 A;  3AGF A;  3SW1 A;  4OLD A;  2ZC7 A;  4JGP A;  1BLH A;  3BFD A;  2WAF A;  4GNU A;  3N8S A;  1K57 A;  3WS4 A;  4KQQ A;  4OQG A;  5CEB A;  3UO9 A;  3ZNY A;  3U4L P;  5AQ9 A;  2YKF A;  4MN6 A;  1K54 A;  1PIO A;  3SS5 A;  3UB6 A;  3PBQ A;  5F82 A;  1ERQ A;  3H82 B;  3R4K A;  3W4P A;  4WEJ A;  3PAE A;  1XA7 A;  3C4O A;  3OCL A;  4GHI A;  5DFY A;  1IOU A;  5DFX A;  2ZC6 B;  5HL1 A;  3O88 A;  4R1G A;  3T4K A;  1YQS A;  4DXB A;  5I5L A;  2VKS A;  5TBM A;  1XP4 A;  1YM1 A;  4GJ4 A;  3G35 A;  4P87 A;  3UPN A;  3D4F A;  4UQI S;  2V8F A;  3IXH A;  1FSW A;  4Y2F A;  2B95 A;  2NUT C;  1K6R A;  3ZNT A;  4S2K A;  3GRJ A;  1I2W A;  5AVF A;  3HJK A;  1PNE A;  1TS7 A;  2OWH A;  3QP1 A;  5CGS A;  5HSQ A;  5AQB A;  1H8M A;  4Z9Q A;  1NZO A;  1JVJ A;  5HWW A;  1OT9 A;  1H8Z A;  3B3X A;  2Y91 A;  3WS1 A;  4B93 A;  5D3O A;  4HEF A;  5GHZ A;  4I39 A;  1TD5 A;  4LRZ E;  2ZMF A;  5DF9 A;  1WE4 A;  1AWI A;  2ZQ9 A;  5HD5 A;  1X0O A;  2BAS A;  1LSW A;  1NRJ A;  1H5X A;  2V0W A;  3N6I A;  5CGX A;  5A93 A;  1W63 M;  3C7U A;  2OWJ A;  5FA7 A;  4KZ6 A;  3LY4 A;  3O5Y A;  3T4L A;  2R9X A;  3KX0 X;  2O9B A;  2PR6 A;  5K5B A;  4Q0J A;  5FAT A;  4JXS A;  2PHY A;  5C5K A;  2DMW A;  3JVU A;  3IXG A;  3VSK A;  4JKT A;  3EEA A;  4PPR A;  1JWV A;  5DTK A;  3VP0 A;  3LR3 A;  3BW6 A;  4E3J A;  5FAO A;  2X71 A;  2FZ0 A;  2VX8 A;  1FR6 A;  1S4S A;  4MN7 A;  4QY6 A;  1XJ4 A;  1ERO A;  1SDN A;  2EWV A;  4ID4 A;  4OOY A;  2WKQ A;  1ERM A;  3NOT C;  4O7D A;  4IVK A;  2J3T C;  3V3S A;  3HBR A;  5DJU A;  3MQQ A;  3H7W A;  3ZVT A;  1Z6F A;  3MSH A;  1KGE A;  3IBJ A;  1ZTU A;  3RTY A;  3M2K A;  3QP2 A;  4WM9 A;  1NZU A;  4Y5F A;  4HBU A;  2OSU A;  2XRO A;  3PTE A;  5FI2 A;  4GW9 A;  4F94 A;  4BMW A;  4JGQ A;  3LIF A;  5EVI D;  3QP4 A;  3LGO A;  3T50 A;  4B4X A;  4GS9 A;  2XA7 M;  2JBF A;  4EBN A;  4EWF A;  5L10 A;  3IWI A;  1BUL A;  3PYP A;  2V1A A;  1G6A A;  4HJ6 A;  1MKI A;  4CLC E;  4ESP A;  3BFC A;  3JYI A;  1BT5 A;  1YLJ A;  2GZA A;  5J3W A;  4NKP A;  3LYX A;  4KZB A;  4HJ3 A;  1D1J A;  2HP9 A;  5EE8 A;  3FYZ A;  3QNB A;  1VEU A;  2OOL A;  4Q8I A;  3MXQ A;  3PAG A;  2WUQ A;  2Z6C A;  4IUK A;  3MBZ A;  4MEZ A;  3BM6 A;  2W3H A;  4P6B A;  1DJB A;  4I3A A;  1OT6 A;  1RP5 A;  2Y2K A;  4G3V A;  4HHD A;  4KG5 A;  4ZJ3 A;  1KE0 A;  2ZMA A;  1YLP A;  4P0M A;  3S7Q A;  4HNB A;  3GR2 A;  3IF6 A;  4Y0U A;  3OPH A;  4IHQ A;  5DVA A;  1XX2 A;  2V1B A;  4AFI A;  1S4R A;  3AGD A;  1DP8 A;  4BWI A;  1BSG A;  2Y79 A;  2ZQD A;  3PR6 A;  2WKR A;  4PM8 A;  4UQI M;  3LR5 A;  1GSW A;  2G2U A;  3E2K A;  1LLB A;  1NYM A;  5FDH A;  3HLE A;  1TS6 A;  1D06 A;  4KG6 A;  3UE6 A;  3VFF A;  5EVI B;  4ZTK A;  5GHY A;  2A24 B;  4BBT A;  1G28 A;  4E6W A;  1YKD A;  1S0W A;  3WS0 A;  2XRN A;  1Y28 A; 
#chains in the Genus database with same CATH homology
 1L3L A;  4LGW A;  3IX4 A;  3QP5 A;  2Q0O A;  2UV0 E;  5L10 A;  4LFU A;  3QP2 A;  4NG2 A;  3QP1 A;  3IX8 A;  5L09 A;  1H0M A;  5L07 A;  4Y15 A;  3QP8 A;  3SZT A;  2AVX A;  3IX3 A;  3JPU A;  3QP6 A;  3QP4 A;  4Y13 A;  4Y17 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...