4NG9L

Factor viia in complex with the inhibitor (2r)-2-[(1-aminoisoquinolin-6-yl)amino]-2-[3-ethoxy-4-(propan-2-yloxy)phenyl]-n-(3-sulfamoylbenzyl)ethanamide
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
55
structure length
54
Chain Sequence
ICVNENGGCEQYCSDHTGKRSCRCHEGYSLLADGVSCTPTVEYPCGKIPILEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and Synthesis of Phenylpyrrolidine Phenylglycinamides As Highly Potent and Selective TF-FVIIa Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Factor VIIa (Heavy Chain)
total genus 12
structure length 54
sequence length 55
ec nomenclature ec 3.4.21.21: Coagulation factor VIIa.
pdb deposition date 2013-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 4ng9L00
3K9XA 1IQGL 4D0FA 1G1RA 2VVVL 2J2UB 1LMJA 3KK6A 4JYVL 1NFXB 2PUQL 3SOBB 2J4IB 3KQEL 2M74A 3POYA 1HX2A 1RFNB 5CKMA 2Y38A 1PXXA 4RUTA 1NZIA 1UZQA 1XKAL 1CVUA 2P3UA 4C16A 2XBXL 4X8VL 2VWNL 3QMOA 1NPEB 4RRXA 3HO4A 4MMXB 1IOEL 3C9AC 1COUA 1EPGA 2NPRA 2WG3C 1ZAQA 3KRKA 3TK5B 3BT1A 2BOXA 1FF7A 2RHPA 1HAEA 1KLIL 1IQLL 4Y71B 2PHBB 2K2TA 2Y5FL 3N8WA 2WPIE 1YUGA 2W3IB 2W26B 1K37A 2BQWA 1K36A 3M37L 1NFUB 1YO8A 2UWLB 2VWMK 4Y7BB 4PH9A 1BF9A 1LPGA 2WPJE 2AYLA 5F1AA 1NFWB 1CEJA 3LAQA 5JB9E 4ZHAB 1G1QA 4CUEA 1U8CB 1IGZA 5K0HB 1NQLB 5L30L 4M10A 4Y7AB 3HPTA 1IQIL 1L5GB 1LPKA 2J94B 2Y82B 3GCXE 3P5BL 2EI8B 1JV2B 3LTFB 3N8VA 1TPGA 1SZBA 1KLJL 5F19A 3KQDL 4LORA 3EGFA 2BO2A 1N7DA 1URKA 1IJQA 1P9JA 2P3TA 5JVYA 2YGPA 4NGAL 3N8YA 2UWPB 4X8UL 1HT5A 4NA9L 2BOUA 1IQHL 1IQKL 2WFTA 2TGFA 1GK5A 4BTIA 2VVUL 4D0EA 3KQBL 1HT8A 4XLWA 2CJIB 3TGFA 3PGHA 1EMOA 3F1SB 3LIWB 2Q1JB 5CKQA 2WPKE 2D1JB 2DDUA 2F9BL 2W2QE 1DIYA 4RRWA 3LTGD 2KL7A 3FBYA 2VVCK 3CFWA 1X7AL 2I9BA 5JBCE 3KCGL 1MQ6L 3ZYGA 2Y81B 2Y80B 1HJ7A 3MQEA 3V65B 4MMZB 2W2OE 3R05A 4ZXYL 3KQCL 3CA7A 1HCGB 4BDXA 4XL1A 1FJSL 1CX2A 1W7XL 3HS6A 1FAXL 1PRHA 1U67A 4XBMA 3FCSB 2VWOL 4CSYA 2Y5HL 1DX5I 1F0RB 3HS7A 2P95L 2I9AA 2WPHE 3U73A 3SW2A 1IOXA 4AQTA 1I0UA 4NG9L 2XBVL 2FLBL 1PFXL 1EMNA 2K2SB 3QCWA 3NTGA 2Y7XB 2VJ3A 2XBYL 2P3FL 1YUFA 4OTYA 1AUTL 1F7EA 1CCVA 4JZEL 2VH0B 4JZDL 1APQA 1IQML 4M11A 3TZIA 4Z0KB 5L2YL 1HRFA 4ZXXL 3LC3B 2P94L 2P26A 1TLEA 4D90A 1TOZA 5KN5C 2FLRL 1NT0A 3IITB 3BT2A 2G00L 4BDWA 1ATEA 4TGFA 2P28B 1N1IA 3HO5A 2VWLL 3ZYIB 1PTHA 4BXWA 2P16L 1JL9A 4Y6DB 5JB8E 2XC4L 1DDXA 1WHFA 1EAIC 3TH3L 4BTTA 2EI6B 4OTJA 2BMGA 2BQ6A 1Z6CA 3NJPC 1EPHA 3HO3A 3MDLA 2OYEP 2BOKL 2FLGA 1ATAA 1CQEA 1DVAL 4Z0LA 4COXA 1QFKL 2MHPA 1OB1C 1ADXA 1IQJL 1F0SB 3OLTA 3Q7DA 5FDQA 1F7MA 1EQGA 2PR3B 5EGMB 1G1TA 3CENL 5IKQA 4ZAEB 2FZZL 4Y79B 1Q4GA 1FAKL 1M1XB 1UZKA 3SOQA 1EPJA 1IQNL 1YGCL 2VH6B 2W2PE 2J38B 2W86A 2FD6A 2XC0L 4ISHL 5JBAE 3U7UG 3ASIA 3QH0A 4CUFA 1MQ5L 3LC5B 3TK6B 2MGPA 1EQHA 2P93L 2OYUP 3TBDA 3LN0A 2BQ7A 2W3KB 6COXA 3ELAL 1HZ8A 1XDTR 1LQDA 1L3YA 5IKRA 3KL6B 1P0SL 5L2ZL 1G2MB 4MMYB 2WPME 3BPSE 1FFMA 4RRYA 2UWOB 4JYUL 1IVOC 1CCFA 1KLOA 2Y7ZB 1C5MF 5IKTA 2P3FN 3NTBA 2WYJB 1WU1B 3DEMA 2EI7B 1UZPA 1FE2A 1UZJA 2J95B 4YT7L 2XC5L 5E8DA 1EGFA 2WG4B 1G2LB 2JKHL 3GCWE 4CUDA 1V3XB 4ZH8B 2J34B 3OLUA 4RRZA 4X8TL 1PGEA 1IQFL 1XFEA 4ISIL 3N8XA 3GISX 5COXA 1EZQB 1ATDA 1Z6EL 4Y76B 1NFYB 1IP0A 1KIGL 4YZUB 2Y5GL 4A7IA 1XKBA 3V64C 5KIRA 3HS5A 5JW1A 1CVWL 3RR3A 2H9EL 1ATBA 2MGRA 3ENSA 2KB9A 1YUKB 3M36L 3SOVA 2WFXB 1A3PA 1MOXC 2RNLA 4Z6AL 4X8SL 1FSBA 5I46L 4RS0A 2WYGB 4G1MB 1IQEL 3CS7L 3FFGL 2YGOA 2B7DL 5JVZA 1EPIA 3F6UL 4FM5A 1HAFA 1LPZA 2W2ME 5IKVA 1EBVA 3N8WB 1APOA 2WPLE 2GD4A 3H5CB 4BXSA 3NT1A 2KV4A 4O1ZA 3ZYJB 1O5DL 4O02B 5CKNA 3Q3KB 5JBBE 4LMFA 2ADXA 5CISA 1B9WA 4YT6L 3N8ZA 2XBWL 1G1SA 3IJEB 1DQBA 2BOHA 2RA0L 4E1GA 2BZ6L 3LN1A 1IGXA 1JBUL 1W8BL 3N8YB 4JZFL 4BTUA 2W2NE 1HREA 1KSNB 1WHEA 1J9CL
chains in the Genus database with same CATH superfamily
3K9XA 1IQGL 4D0FA 1G1RA 2VVVL 2J2UB 3S6XA 1LMJA 3KK6A 4JYVL 1NFXB 2PUQL 3SOBB 2J4IB 3KQEL 2M74A 3POYA 1HX2A 1RFNB 5CKMA 2Y38A 1PXXA 4RUTA 1NZIA 1UZQA 1XKAL 1CVUA 2P3UA 4C16A 2XBXL 4X8VL 2VWNL 3QMOA 1NPEB 4RRXA 3HO4A 4MMXB 1IOEL 3C9AC 1COUA 1EPGA 2NPRA 2WG3C 1ZAQA 2BSFA 3KRKA 3BT1A 3TK5B 2BOXA 1FF7A 2RHPA 1HAEA 1KLIL 1IQLL 4Y71B 2PHBB 2K2TA 2Y5FL 3N8WA 2WPIE 1YUGA 2W3IB 2W26B 1K37A 2BQWA 1K36A 3M37L 1NFUB 1YO8A 2BT8A 2UWLB 2VWMK 4Y7BB 4PH9A 1BF9A 1LPGA 2WPJE 2AYLA 5F1AA 1NFWB 1CEJA 3LAQA 5JB9E 4ZHAB 1G1QA 4CUEA 1U8CB 1IGZA 5K0HB 1NQLB 5L30L 4M10A 4Y7AB 3HPTA 1IQIL 1L5GB 1LPKA 2J94B 2Y82B 3GCXE 3P5BL 2EI8B 1JV2B 3LTFB 3N8VA 1TPGA 1SZBA 1KLJL 5F19A 3KQDL 4LORA 3EGFA 2BO2A 1N7DA 1URKA 1V1HA 1IJQA 1P9JA 2P3TA 5JVYA 2YGPA 4NGAL 3N8YA 2UWPB 4X8UL 1HT5A 4NA9L 2BOUA 1IQHL 1IQKL 2WFTA 2TGFA 1GK5A 4BTIA 2VVUL 4D0EA 3KQBL 1HT8A 1LMMA 4XLWA 2CJIB 3TGFA 3PGHA 1EMOA 3F1SB 3LIWB 2Q1JB 5CKQA 2WPKE 2D1JB 2DDUA 2F9BL 2W2QE 1DIYA 4RRWA 3LTGD 2KL7A 3FBYA 2WZPP 2VVCK 3CFWA 1X7AL 2I9BA 5JBCE 3KCGL 1MQ6L 3ZYGA 2Y81B 2Y80B 1HJ7A 3MQEA 3V65B 4MMZB 2W2OE 3R05A 4ZXYL 2YGQA 3KQCL 3CA7A 1HCGB 4BDXA 4XL1A 1FJSL 1CX2A 1W7XL 3HS6A 1FAXL 1PRHA 1U67A 4XBMA 3FCSB 2VWOL 4CSYA 2Y5HL 1DX5I 1F0RB 3HS7A 2P95L 2I9AA 2WPHE 3U73A 3SW2A 1IOXA 4AQTA 1I0UA 4NG9L 2XBVL 1V1IA 2FLBL 1PFXL 1EMNA 2K2SB 4GU4A 1LK9A 3QCWA 3NTGA 2Y7XB 2VJ3A 2XBYL 2P3FL 1YUFA 4OTYA 1AUTL 1F7EA 1CCVA 4JZEL 2VH0B 4JZDL 1APQA 1IQML 4M11A 3TZIA 4GU3A 2JJLA 4Z0KB 5L2YL 1HRFA 4ZXXL 3LC3B 2P94L 2P26A 1TLEA 1KKEA 1TOZA 4D90A 5KN5C 2FLRL 1NT0A 3IITB 3BT2A 2G00L 4BDWA 1ATEA 4TGFA 2P28B 1N1IA 3HO5A 2VWLL 3ZYIB 1PTHA 4BXWA 2P16L 1JL9A 4Y6DB 5JB8E 2XC4L 1DDXA 1WHFA 1EAIC 3TH3L 4BTTA 2EI6B 4OTJA 2BMGA 2BQ6A 1Z6CA 3NJPC 1EPHA 3HO3A 3MDLA 2OYEP 2BOKL 2BT7A 1ATAA 2FLGA 1CQEA 1DVAL 4Z0LA 4COXA 1QFKL 2MHPA 1OB1C 1ADXA 1IQJL 1F0SB 3OLTA 3Q7DA 5FDQA 1F7MA 1EQGA 2PR3B 5EGMB 1G1TA 3CENL 5IKQA 4ZAEB 2FZZL 4Y79B 1Q4GA 1FAKL 1M1XB 1UZKA 3SOQA 1EPJA 1IQNL 1YGCL 2VH6B 2W2PE 2J38B 2W86A 2FD6A 2XC0L 4ISHL 5JBAE 3U7UG 3ASIA 3QH0A 4CUFA 1MQ5L 3LC5B 3TK6B 2MGPA 1EQHA 2P93L 2OYUP 3TBDA 3LN0A 2BQ7A 2W3KB 6COXA 3ELAL 1HZ8A 1XDTR 1LQDA 1L3YA 5IKRA 3KL6B 1P0SL 5L2ZL 1G2MB 4MMYB 2WPME 3BPSE 1FFMA 4RRYA 2UWOB 4JYUL 4A94C 1IVOC 1CCFA 1KLOA 2H9EC 2Y7ZB 1C5MF 5IKTA 2P3FN 3NTBA 2WYJB 1WU1B 3DEMA 2EI7B 1UZPA 1FE2A 1UZJA 2J95B 4YT7L 2XC5L 5E8DA 1EGFA 2WG4B 1G2LB 2JKHL 3GCWE 4CUDA 1V3XB 4ZH8B 2J34B 3OLUA 4RRZA 4X8TL 1PGEA 1IQFL 1XFEA 4ISIL 3N8XA 3GISX 5COXA 1EZQB 1ATDA 1Z6EL 4Y76B 1NFYB 1IP0A 1KIGL 4YZUB 2Y5GL 4A7IA 1XKBA 3V64C 5KIRA 3HS5A 5JW1A 1CVWL 3RR3A 2H9EL 1ATBA 2MGRA 3ENSA 2KB9A 1YUKB 1QIUA 3M36L 3SOVA 2WFXB 1A3PA 1MOXC 2RNLA 4Z6AL 4X8SL 1FSBA 5I46L 4RS0A 2WYGB 2HOXA 4G1MB 1IQEL 2HORA 3CS7L 3FFGL 2YGOA 2B7DL 5JVZA 1EPIA 3F6UL 4FM5A 1HAFA 1LPZA 2W2ME 5IKVA 3N8WB 1EBVA 1APOA 2WPLE 2VRSA 2GD4A 3H5CB 2KNIA 4BXSA 3NT1A 2KV4A 4O1ZA 3ZYJB 1O5DL 4O02B 5CKNA 3Q3KB 5JBBE 4LMFA 2ADXA 5CISA 1B9WA 4YT6L 3N8ZA 2XBWL 1G1SA 3IJEB 1DQBA 2BOHA 2RA0L 4E1GA 2BZ6L 3LN1A 1IGXA 1JBUL 1W8BL 3N8YB 4JZFL 4BTUA 2W2NE 1HREA 1KSNB 1WHEA 1J9CL
chains in the Genus database with same CATH topology
3K9XA 1IQGL 4D0FA 1G1RA 2VVVL 2J2UB 3S6XA 1LMJA 3KK6A 4JYVL 1NFXB 2PUQL 3SOBB 2J4IB 3KQEL 2M74A 3POYA 1HX2A 1RFNB 5CKMA 2Y38A 1PXXA 4RUTA 1NZIA 1UZQA 1XKAL 1CVUA 2P3UA 4C16A 2XBXL 4X8VL 2VWNL 3QMOA 1NPEB 4RRXA 3HO4A 4MMXB 1IOEL 3C9AC 1COUA 1EPGA 2NPRA 2WG3C 1ZAQA 3KRKA 3TK5B 3BT1A 2BOXA 1FF7A 2RHPA 1HAEA 1KLIL 1IQLL 4Y71B 2PHBB 2K2TA 2Y5FL 3N8WA 2WPIE 1YUGA 2W3IB 2W26B 1K37A 2BQWA 1K36A 3M37L 1NFUB 1YO8A 2UWLB 2VWMK 4Y7BB 4PH9A 1BF9A 1LPGA 2WPJE 2AYLA 5F1AA 1NFWB 1CEJA 3LAQA 5JB9E 4ZHAB 1G1QA 4CUEA 1U8CB 1IGZA 5K0HB 1NQLB 5L30L 4M10A 4Y7AB 3HPTA 1IQIL 1L5GB 1LPKA 2J94B 2Y82B 3GCXE 3P5BL 2EI8B 1JV2B 3LTFB 3N8VA 1TPGA 1SZBA 1KLJL 5F19A 3KQDL 4LORA 3EGFA 2BO2A 1N7DA 1URKA 1IJQA 1P9JA 2P3TA 5JVYA 2YGPA 4NGAL 3N8YA 2UWPB 4X8UL 1HT5A 4NA9L 2BOUA 1IQHL 1IQKL 2WFTA 2TGFA 1GK5A 4BTIA 2VVUL 4D0EA 3KQBL 1HT8A 1LMMA 4XLWA 2CJIB 3TGFA 3PGHA 1EMOA 3F1SB 3LIWB 2Q1JB 5CKQA 2WPKE 2D1JB 2DDUA 2F9BL 2W2QE 1DIYA 4RRWA 3LTGD 2KL7A 3FBYA 2WZPP 2VVCK 3CFWA 1X7AL 2I9BA 5JBCE 3KCGL 1MQ6L 3ZYGA 2Y81B 2Y80B 1HJ7A 3MQEA 3V65B 4MMZB 2W2OE 3R05A 4ZXYL 2YGQA 3KQCL 3CA7A 1HCGB 4BDXA 4XL1A 1FJSL 1CX2A 1W7XL 3HS6A 1FAXL 1PRHA 1U67A 4XBMA 3FCSB 2VWOL 4CSYA 2Y5HL 1DX5I 1F0RB 3HS7A 2P95L 2I9AA 2WPHE 3U73A 3SW2A 1IOXA 4AQTA 1I0UA 4NG9L 2XBVL 2FLBL 1PFXL 1EMNA 2K2SB 3QCWA 3NTGA 2Y7XB 2VJ3A 2XBYL 2P3FL 1YUFA 4OTYA 1AUTL 1F7EA 1CCVA 4JZEL 2VH0B 4JZDL 1APQA 1IQML 4M11A 3TZIA 4Z0KB 5L2YL 1HRFA 4ZXXL 3LC3B 2P94L 2P26A 1TLEA 4D90A 1TOZA 5KN5C 2FLRL 1NT0A 3IITB 3BT2A 2G00L 4BDWA 1ATEA 4TGFA 2P28B 1N1IA 3HO5A 2VWLL 3ZYIB 1PTHA 4BXWA 2P16L 1JL9A 4Y6DB 5JB8E 2XC4L 1DDXA 1WHFA 1EAIC 3TH3L 4BTTA 2EI6B 4OTJA 2BMGA 2BQ6A 1Z6CA 3NJPC 1EPHA 3HO3A 3MDLA 2OYEP 2BOKL 2FLGA 1ATAA 1CQEA 1DVAL 4Z0LA 4COXA 1QFKL 2MHPA 1OB1C 1ADXA 1IQJL 1F0SB 3OLTA 3Q7DA 5FDQA 1F7MA 1EQGA 2PR3B 5EGMB 1G1TA 3CENL 5IKQA 4ZAEB 2FZZL 4Y79B 1Q4GA 1FAKL 1M1XB 1UZKA 3SOQA 1EPJA 1IQNL 1YGCL 2VH6B 2W2PE 2J38B 2W86A 2FD6A 2XC0L 4ISHL 5JBAE 3U7UG 3ASIA 3QH0A 4CUFA 1MQ5L 3LC5B 3TK6B 2MGPA 1EQHA 2P93L 2OYUP 3TBDA 3LN0A 2BQ7A 2W3KB 6COXA 3ELAL 1HZ8A 1XDTR 1LQDA 1L3YA 5IKRA 3KL6B 1P0SL 5L2ZL 1G2MB 4MMYB 2WPME 3BPSE 1FFMA 4RRYA 2UWOB 4JYUL 4A94C 1IVOC 1CCFA 1KLOA 2H9EC 2Y7ZB 1C5MF 5IKTA 2P3FN 3NTBA 2WYJB 1WU1B 3DEMA 2EI7B 1UZPA 1FE2A 1UZJA 2J95B 4YT7L 2XC5L 5E8DA 1EGFA 2WG4B 1G2LB 2JKHL 3GCWE 4CUDA 1V3XB 4ZH8B 2J34B 3OLUA 4RRZA 4X8TL 1PGEA 1IQFL 1XFEA 4ISIL 3N8XA 3GISX 5COXA 1EZQB 1ATDA 1Z6EL 4Y76B 1NFYB 1IP0A 1KIGL 4YZUB 2Y5GL 4A7IA 1XKBA 3V64C 5KIRA 3HS5A 5JW1A 1CVWL 3RR3A 2H9EL 1ATBA 2MGRA 3ENSA 2KB9A 1YUKB 3M36L 3SOVA 2WFXB 1A3PA 1MOXC 2RNLA 4Z6AL 4X8SL 1FSBA 5I46L 4RS0A 2WYGB 4G1MB 1IQEL 3CS7L 3FFGL 2YGOA 2B7DL 5JVZA 1EPIA 3F6UL 4FM5A 1HAFA 1LPZA 2W2ME 5IKVA 1EBVA 3N8WB 1APOA 2WPLE 2GD4A 3H5CB 2KNIA 4BXSA 3NT1A 2KV4A 4O1ZA 3ZYJB 1O5DL 4O02B 5CKNA 3Q3KB 5JBBE 4LMFA 2ADXA 5CISA 1B9WA 4YT6L 3N8ZA 2XBWL 1G1SA 3IJEB 1DQBA 2BOHA 2RA0L 4E1GA 2BZ6L 3LN1A 1IGXA 1JBUL 1W8BL 3N8YB 4JZFL 4BTUA 2W2NE 1HREA 1KSNB 1WHEA 1J9CL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K9X A;  1IQG L;  4D0F A;  1G1R A;  2VVV L;  2J2U B;  1LMJ A;  3KK6 A;  4JYV L;  1NFX B;  2PUQ L;  3SOB B;  2J4I B;  3KQE L;  2M74 A;  3POY A;  1HX2 A;  1RFN B;  5CKM A;  2Y38 A;  1PXX A;  4RUT A;  1NZI A;  1UZQ A;  1XKA L;  1CVU A;  2P3U A;  4C16 A;  2XBX L;  4X8V L;  2VWN L;  3QMO A;  1NPE B;  4RRX A;  3HO4 A;  4MMX B;  1IOE L;  3C9A C;  1COU A;  1EPG A;  2NPR A;  2WG3 C;  1ZAQ A;  3KRK A;  3TK5 B;  3BT1 A;  2BOX A;  1FF7 A;  2RHP A;  1HAE A;  1KLI L;  1IQL L;  4Y71 B;  2PHB B;  2K2T A;  2Y5F L;  3N8W A;  2WPI E;  1YUG A;  2W3I B;  2W26 B;  1K37 A;  2BQW A;  1K36 A;  3M37 L;  1NFU B;  1YO8 A;  2UWL B;  2VWM K;  4Y7B B;  4PH9 A;  1BF9 A;  1LPG A;  2WPJ E;  2AYL A;  5F1A A;  1NFW B;  1CEJ A;  3LAQ A;  5JB9 E;  4ZHA B;  1G1Q A;  4CUE A;  1U8C B;  1IGZ A;  5K0H B;  1NQL B;  5L30 L;  4M10 A;  4Y7A B;  3HPT A;  1IQI L;  1L5G B;  1LPK A;  2J94 B;  2Y82 B;  3GCX E;  3P5B L;  2EI8 B;  1JV2 B;  3LTF B;  3N8V A;  1TPG A;  1SZB A;  1KLJ L;  5F19 A;  3KQD L;  4LOR A;  3EGF A;  2BO2 A;  1N7D A;  1URK A;  1IJQ A;  1P9J A;  2P3T A;  5JVY A;  2YGP A;  4NGA L;  3N8Y A;  2UWP B;  4X8U L;  1HT5 A;  4NA9 L;  2BOU A;  1IQH L;  1IQK L;  2WFT A;  2TGF A;  1GK5 A;  4BTI A;  2VVU L;  4D0E A;  3KQB L;  1HT8 A;  4XLW A;  2CJI B;  3TGF A;  3PGH A;  1EMO A;  3F1S B;  3LIW B;  2Q1J B;  5CKQ A;  2WPK E;  2D1J B;  2DDU A;  2F9B L;  2W2Q E;  1DIY A;  4RRW A;  3LTG D;  2KL7 A;  3FBY A;  2VVC K;  3CFW A;  1X7A L;  2I9B A;  5JBC E;  3KCG L;  1MQ6 L;  3ZYG A;  2Y81 B;  2Y80 B;  1HJ7 A;  3MQE A;  3V65 B;  4MMZ B;  2W2O E;  3R05 A;  4ZXY L;  3KQC L;  3CA7 A;  1HCG B;  4BDX A;  4XL1 A;  1FJS L;  1CX2 A;  1W7X L;  3HS6 A;  1FAX L;  1PRH A;  1U67 A;  4XBM A;  3FCS B;  2VWO L;  4CSY A;  2Y5H L;  1DX5 I;  1F0R B;  3HS7 A;  2P95 L;  2I9A A;  2WPH E;  3U73 A;  3SW2 A;  1IOX A;  4AQT A;  1I0U A;  4NG9 L;  2XBV L;  2FLB L;  1PFX L;  1EMN A;  2K2S B;  3QCW A;  3NTG A;  2Y7X B;  2VJ3 A;  2XBY L;  2P3F L;  1YUF A;  4OTY A;  1AUT L;  1F7E A;  1CCV A;  4JZE L;  2VH0 B;  4JZD L;  1APQ A;  1IQM L;  4M11 A;  3TZI A;  4Z0K B;  5L2Y L;  1HRF A;  4ZXX L;  3LC3 B;  2P94 L;  2P26 A;  1TLE A;  4D90 A;  1TOZ A;  5KN5 C;  2FLR L;  1NT0 A;  3IIT B;  3BT2 A;  2G00 L;  4BDW A;  1ATE A;  4TGF A;  2P28 B;  1N1I A;  3HO5 A;  2VWL L;  3ZYI B;  1PTH A;  4BXW A;  2P16 L;  1JL9 A;  4Y6D B;  5JB8 E;  2XC4 L;  1DDX A;  1WHF A;  1EAI C;  3TH3 L;  4BTT A;  2EI6 B;  4OTJ A;  2BMG A;  2BQ6 A;  1Z6C A;  3NJP C;  1EPH A;  3HO3 A;  3MDL A;  2OYE P;  2BOK L;  2FLG A;  1ATA A;  1CQE A;  1DVA L;  4Z0L A;  4COX A;  1QFK L;  2MHP A;  1OB1 C;  1ADX A;  1IQJ L;  1F0S B;  3OLT A;  3Q7D A;  5FDQ A;  1F7M A;  1EQG A;  2PR3 B;  5EGM B;  1G1T A;  3CEN L;  5IKQ A;  4ZAE B;  2FZZ L;  4Y79 B;  1Q4G A;  1FAK L;  1M1X B;  1UZK A;  3SOQ A;  1EPJ A;  1IQN L;  1YGC L;  2VH6 B;  2W2P E;  2J38 B;  2W86 A;  2FD6 A;  2XC0 L;  4ISH L;  5JBA E;  3U7U G;  3ASI A;  3QH0 A;  4CUF A;  1MQ5 L;  3LC5 B;  3TK6 B;  2MGP A;  1EQH A;  2P93 L;  2OYU P;  3TBD A;  3LN0 A;  2BQ7 A;  2W3K B;  6COX A;  3ELA L;  1HZ8 A;  1XDT R;  1LQD A;  1L3Y A;  5IKR A;  3KL6 B;  1P0S L;  5L2Z L;  1G2M B;  4MMY B;  2WPM E;  3BPS E;  1FFM A;  4RRY A;  2UWO B;  4JYU L;  1IVO C;  1CCF A;  1KLO A;  2Y7Z B;  1C5M F;  5IKT A;  2P3F N;  3NTB A;  2WYJ B;  1WU1 B;  3DEM A;  2EI7 B;  1UZP A;  1FE2 A;  1UZJ A;  2J95 B;  4YT7 L;  2XC5 L;  5E8D A;  1EGF A;  2WG4 B;  1G2L B;  2JKH L;  3GCW E;  4CUD A;  1V3X B;  4ZH8 B;  2J34 B;  3OLU A;  4RRZ A;  4X8T L;  1PGE A;  1IQF L;  1XFE A;  4ISI L;  3N8X A;  3GIS X;  5COX A;  1EZQ B;  1ATD A;  1Z6E L;  4Y76 B;  1NFY B;  1IP0 A;  1KIG L;  4YZU B;  2Y5G L;  4A7I A;  1XKB A;  3V64 C;  5KIR A;  3HS5 A;  5JW1 A;  1CVW L;  3RR3 A;  2H9E L;  1ATB A;  2MGR A;  3ENS A;  2KB9 A;  1YUK B;  3M36 L;  3SOV A;  2WFX B;  1A3P A;  1MOX C;  2RNL A;  4Z6A L;  4X8S L;  1FSB A;  5I46 L;  4RS0 A;  2WYG B;  4G1M B;  1IQE L;  3CS7 L;  3FFG L;  2YGO A;  2B7D L;  5JVZ A;  1EPI A;  3F6U L;  4FM5 A;  1HAF A;  1LPZ A;  2W2M E;  5IKV A;  1EBV A;  3N8W B;  1APO A;  2WPL E;  2GD4 A;  3H5C B;  4BXS A;  3NT1 A;  2KV4 A;  4O1Z A;  3ZYJ B;  1O5D L;  4O02 B;  5CKN A;  3Q3K B;  5JBB E;  4LMF A;  2ADX A;  5CIS A;  1B9W A;  4YT6 L;  3N8Z A;  2XBW L;  1G1S A;  3IJE B;  1DQB A;  2BOH A;  2RA0 L;  4E1G A;  2BZ6 L;  3LN1 A;  1IGX A;  1JBU L;  1W8B L;  3N8Y B;  4JZF L;  4BTU A;  2W2N E;  1HRE A;  1KSN B;  1WHE A;  1J9C L; 
#chains in the Genus database with same CATH topology
 3K9X A;  1IQG L;  4D0F A;  1G1R A;  2VVV L;  2J2U B;  3S6X A;  1LMJ A;  3KK6 A;  4JYV L;  1NFX B;  2PUQ L;  3SOB B;  2J4I B;  3KQE L;  2M74 A;  3POY A;  1HX2 A;  1RFN B;  5CKM A;  2Y38 A;  1PXX A;  4RUT A;  1NZI A;  1UZQ A;  1XKA L;  1CVU A;  2P3U A;  4C16 A;  2XBX L;  4X8V L;  2VWN L;  3QMO A;  1NPE B;  4RRX A;  3HO4 A;  4MMX B;  1IOE L;  3C9A C;  1COU A;  1EPG A;  2NPR A;  2WG3 C;  1ZAQ A;  2BSF A;  3KRK A;  3BT1 A;  3TK5 B;  2BOX A;  1FF7 A;  2RHP A;  1HAE A;  1KLI L;  1IQL L;  4Y71 B;  2PHB B;  2K2T A;  2Y5F L;  3N8W A;  2WPI E;  1YUG A;  2W3I B;  2W26 B;  1K37 A;  2BQW A;  1K36 A;  3M37 L;  1NFU B;  1YO8 A;  2BT8 A;  2UWL B;  2VWM K;  4Y7B B;  4PH9 A;  1BF9 A;  1LPG A;  2WPJ E;  2AYL A;  5F1A A;  1NFW B;  1CEJ A;  3LAQ A;  5JB9 E;  4ZHA B;  1G1Q A;  4CUE A;  1U8C B;  1IGZ A;  5K0H B;  1NQL B;  5L30 L;  4M10 A;  4Y7A B;  3HPT A;  1IQI L;  1L5G B;  1LPK A;  2J94 B;  2Y82 B;  3GCX E;  3P5B L;  2EI8 B;  1JV2 B;  3LTF B;  3N8V A;  1TPG A;  1SZB A;  1KLJ L;  5F19 A;  3KQD L;  4LOR A;  3EGF A;  2BO2 A;  1N7D A;  1URK A;  1V1H A;  1IJQ A;  1P9J A;  2P3T A;  5JVY A;  2YGP A;  4NGA L;  3N8Y A;  2UWP B;  4X8U L;  1HT5 A;  4NA9 L;  2BOU A;  1IQH L;  1IQK L;  2WFT A;  2TGF A;  1GK5 A;  4BTI A;  2VVU L;  4D0E A;  3KQB L;  1HT8 A;  1LMM A;  4XLW A;  2CJI B;  3TGF A;  3PGH A;  1EMO A;  3F1S B;  3LIW B;  2Q1J B;  5CKQ A;  2WPK E;  2D1J B;  2DDU A;  2F9B L;  2W2Q E;  1DIY A;  4RRW A;  3LTG D;  2KL7 A;  3FBY A;  2WZP P;  2VVC K;  3CFW A;  1X7A L;  2I9B A;  5JBC E;  3KCG L;  1MQ6 L;  3ZYG A;  2Y81 B;  2Y80 B;  1HJ7 A;  3MQE A;  3V65 B;  4MMZ B;  2W2O E;  3R05 A;  4ZXY L;  2YGQ A;  3KQC L;  3CA7 A;  1HCG B;  4BDX A;  4XL1 A;  1FJS L;  1CX2 A;  1W7X L;  3HS6 A;  1FAX L;  1PRH A;  1U67 A;  4XBM A;  3FCS B;  2VWO L;  4CSY A;  2Y5H L;  1DX5 I;  1F0R B;  3HS7 A;  2P95 L;  2I9A A;  2WPH E;  3U73 A;  3SW2 A;  1IOX A;  4AQT A;  1I0U A;  4NG9 L;  2XBV L;  1V1I A;  2FLB L;  1PFX L;  1EMN A;  2K2S B;  4GU4 A;  1LK9 A;  3QCW A;  3NTG A;  2Y7X B;  2VJ3 A;  2XBY L;  2P3F L;  1YUF A;  4OTY A;  1AUT L;  1F7E A;  1CCV A;  4JZE L;  2VH0 B;  4JZD L;  1APQ A;  1IQM L;  4M11 A;  3TZI A;  4GU3 A;  2JJL A;  4Z0K B;  5L2Y L;  1HRF A;  4ZXX L;  3LC3 B;  2P94 L;  2P26 A;  1TLE A;  1KKE A;  1TOZ A;  4D90 A;  5KN5 C;  2FLR L;  1NT0 A;  3IIT B;  3BT2 A;  2G00 L;  4BDW A;  1ATE A;  4TGF A;  2P28 B;  1N1I A;  3HO5 A;  2VWL L;  3ZYI B;  1PTH A;  4BXW A;  2P16 L;  1JL9 A;  4Y6D B;  5JB8 E;  2XC4 L;  1DDX A;  1WHF A;  1EAI C;  3TH3 L;  4BTT A;  2EI6 B;  4OTJ A;  2BMG A;  2BQ6 A;  1Z6C A;  3NJP C;  1EPH A;  3HO3 A;  3MDL A;  2OYE P;  2BOK L;  2BT7 A;  1ATA A;  2FLG A;  1CQE A;  1DVA L;  4Z0L A;  4COX A;  1QFK L;  2MHP A;  1OB1 C;  1ADX A;  1IQJ L;  1F0S B;  3OLT A;  3Q7D A;  5FDQ A;  1F7M A;  1EQG A;  2PR3 B;  5EGM B;  1G1T A;  3CEN L;  5IKQ A;  4ZAE B;  2FZZ L;  4Y79 B;  1Q4G A;  1FAK L;  1M1X B;  1UZK A;  3SOQ A;  1EPJ A;  1IQN L;  1YGC L;  2VH6 B;  2W2P E;  2J38 B;  2W86 A;  2FD6 A;  2XC0 L;  4ISH L;  5JBA E;  3U7U G;  3ASI A;  3QH0 A;  4CUF A;  1MQ5 L;  3LC5 B;  3TK6 B;  2MGP A;  1EQH A;  2P93 L;  2OYU P;  3TBD A;  3LN0 A;  2BQ7 A;  2W3K B;  6COX A;  3ELA L;  1HZ8 A;  1XDT R;  1LQD A;  1L3Y A;  5IKR A;  3KL6 B;  1P0S L;  5L2Z L;  1G2M B;  4MMY B;  2WPM E;  3BPS E;  1FFM A;  4RRY A;  2UWO B;  4JYU L;  4A94 C;  1IVO C;  1CCF A;  1KLO A;  2H9E C;  2Y7Z B;  1C5M F;  5IKT A;  2P3F N;  3NTB A;  2WYJ B;  1WU1 B;  3DEM A;  2EI7 B;  1UZP A;  1FE2 A;  1UZJ A;  2J95 B;  4YT7 L;  2XC5 L;  5E8D A;  1EGF A;  2WG4 B;  1G2L B;  2JKH L;  3GCW E;  4CUD A;  1V3X B;  4ZH8 B;  2J34 B;  3OLU A;  4RRZ A;  4X8T L;  1PGE A;  1IQF L;  1XFE A;  4ISI L;  3N8X A;  3GIS X;  5COX A;  1EZQ B;  1ATD A;  1Z6E L;  4Y76 B;  1NFY B;  1IP0 A;  1KIG L;  4YZU B;  2Y5G L;  4A7I A;  1XKB A;  3V64 C;  5KIR A;  3HS5 A;  5JW1 A;  1CVW L;  3RR3 A;  2H9E L;  1ATB A;  2MGR A;  3ENS A;  2KB9 A;  1YUK B;  1QIU A;  3M36 L;  3SOV A;  2WFX B;  1A3P A;  1MOX C;  2RNL A;  4Z6A L;  4X8S L;  1FSB A;  5I46 L;  4RS0 A;  2WYG B;  2HOX A;  4G1M B;  1IQE L;  2HOR A;  3CS7 L;  3FFG L;  2YGO A;  2B7D L;  5JVZ A;  1EPI A;  3F6U L;  4FM5 A;  1HAF A;  1LPZ A;  2W2M E;  5IKV A;  3N8W B;  1EBV A;  1APO A;  2WPL E;  2VRS A;  2GD4 A;  3H5C B;  2KNI A;  4BXS A;  3NT1 A;  2KV4 A;  4O1Z A;  3ZYJ B;  1O5D L;  4O02 B;  5CKN A;  3Q3K B;  5JBB E;  4LMF A;  2ADX A;  5CIS A;  1B9W A;  4YT6 L;  3N8Z A;  2XBW L;  1G1S A;  3IJE B;  1DQB A;  2BOH A;  2RA0 L;  4E1G A;  2BZ6 L;  3LN1 A;  1IGX A;  1JBU L;  1W8B L;  3N8Y B;  4JZF L;  4BTU A;  2W2N E;  1HRE A;  1KSN B;  1WHE A;  1J9C L; 
#chains in the Genus database with same CATH homology
 3K9X A;  1IQG L;  4D0F A;  1G1R A;  2VVV L;  2J2U B;  3S6X A;  1LMJ A;  3KK6 A;  4JYV L;  1NFX B;  2PUQ L;  3SOB B;  2J4I B;  3KQE L;  2M74 A;  3POY A;  1HX2 A;  1RFN B;  5CKM A;  2Y38 A;  1PXX A;  4RUT A;  1NZI A;  1UZQ A;  1XKA L;  1CVU A;  2P3U A;  4C16 A;  2XBX L;  4X8V L;  2VWN L;  3QMO A;  1NPE B;  4RRX A;  3HO4 A;  4MMX B;  1IOE L;  3C9A C;  1COU A;  1EPG A;  2NPR A;  2WG3 C;  1ZAQ A;  3KRK A;  3TK5 B;  3BT1 A;  2BOX A;  1FF7 A;  2RHP A;  1HAE A;  1KLI L;  1IQL L;  4Y71 B;  2PHB B;  2K2T A;  2Y5F L;  3N8W A;  2WPI E;  1YUG A;  2W3I B;  2W26 B;  1K37 A;  2BQW A;  1K36 A;  3M37 L;  1NFU B;  1YO8 A;  2UWL B;  2VWM K;  4Y7B B;  4PH9 A;  1BF9 A;  1LPG A;  2WPJ E;  2AYL A;  5F1A A;  1NFW B;  1CEJ A;  3LAQ A;  5JB9 E;  4ZHA B;  1G1Q A;  4CUE A;  1U8C B;  1IGZ A;  5K0H B;  1NQL B;  5L30 L;  4M10 A;  4Y7A B;  3HPT A;  1IQI L;  1L5G B;  1LPK A;  2J94 B;  2Y82 B;  3GCX E;  3P5B L;  2EI8 B;  1JV2 B;  3LTF B;  3N8V A;  1TPG A;  1SZB A;  1KLJ L;  5F19 A;  3KQD L;  4LOR A;  3EGF A;  2BO2 A;  1N7D A;  1URK A;  1IJQ A;  1P9J A;  2P3T A;  5JVY A;  2YGP A;  4NGA L;  3N8Y A;  2UWP B;  4X8U L;  1HT5 A;  4NA9 L;  2BOU A;  1IQH L;  1IQK L;  2WFT A;  2TGF A;  1GK5 A;  4BTI A;  2VVU L;  4D0E A;  3KQB L;  1HT8 A;  1LMM A;  4XLW A;  2CJI B;  3TGF A;  3PGH A;  1EMO A;  3F1S B;  3LIW B;  2Q1J B;  5CKQ A;  2WPK E;  2D1J B;  2DDU A;  2F9B L;  2W2Q E;  1DIY A;  4RRW A;  3LTG D;  2KL7 A;  3FBY A;  2WZP P;  2VVC K;  3CFW A;  1X7A L;  2I9B A;  5JBC E;  3KCG L;  1MQ6 L;  3ZYG A;  2Y81 B;  2Y80 B;  1HJ7 A;  3MQE A;  3V65 B;  4MMZ B;  2W2O E;  3R05 A;  4ZXY L;  2YGQ A;  3KQC L;  3CA7 A;  1HCG B;  4BDX A;  4XL1 A;  1FJS L;  1CX2 A;  1W7X L;  3HS6 A;  1FAX L;  1PRH A;  1U67 A;  4XBM A;  3FCS B;  2VWO L;  4CSY A;  2Y5H L;  1DX5 I;  1F0R B;  3HS7 A;  2P95 L;  2I9A A;  2WPH E;  3U73 A;  3SW2 A;  1IOX A;  4AQT A;  1I0U A;  4NG9 L;  2XBV L;  2FLB L;  1PFX L;  1EMN A;  2K2S B;  3QCW A;  3NTG A;  2Y7X B;  2VJ3 A;  2XBY L;  2P3F L;  1YUF A;  4OTY A;  1AUT L;  1F7E A;  1CCV A;  4JZE L;  2VH0 B;  4JZD L;  1APQ A;  1IQM L;  4M11 A;  3TZI A;  4Z0K B;  5L2Y L;  1HRF A;  4ZXX L;  3LC3 B;  2P94 L;  2P26 A;  1TLE A;  4D90 A;  1TOZ A;  5KN5 C;  2FLR L;  1NT0 A;  3IIT B;  3BT2 A;  2G00 L;  4BDW A;  1ATE A;  4TGF A;  2P28 B;  1N1I A;  3HO5 A;  2VWL L;  3ZYI B;  1PTH A;  4BXW A;  2P16 L;  1JL9 A;  4Y6D B;  5JB8 E;  2XC4 L;  1DDX A;  1WHF A;  1EAI C;  3TH3 L;  4BTT A;  2EI6 B;  4OTJ A;  2BMG A;  2BQ6 A;  1Z6C A;  3NJP C;  1EPH A;  3HO3 A;  3MDL A;  2OYE P;  2BOK L;  2FLG A;  1ATA A;  1CQE A;  1DVA L;  4Z0L A;  4COX A;  1QFK L;  2MHP A;  1OB1 C;  1ADX A;  1IQJ L;  1F0S B;  3OLT A;  3Q7D A;  5FDQ A;  1F7M A;  1EQG A;  2PR3 B;  5EGM B;  1G1T A;  3CEN L;  5IKQ A;  4ZAE B;  2FZZ L;  4Y79 B;  1Q4G A;  1FAK L;  1M1X B;  1UZK A;  3SOQ A;  1EPJ A;  1IQN L;  1YGC L;  2VH6 B;  2W2P E;  2J38 B;  2W86 A;  2FD6 A;  2XC0 L;  4ISH L;  5JBA E;  3U7U G;  3ASI A;  3QH0 A;  4CUF A;  1MQ5 L;  3LC5 B;  3TK6 B;  2MGP A;  1EQH A;  2P93 L;  2OYU P;  3TBD A;  3LN0 A;  2BQ7 A;  2W3K B;  6COX A;  3ELA L;  1HZ8 A;  1XDT R;  1LQD A;  1L3Y A;  5IKR A;  3KL6 B;  1P0S L;  5L2Z L;  1G2M B;  4MMY B;  2WPM E;  3BPS E;  1FFM A;  4RRY A;  2UWO B;  4JYU L;  4A94 C;  1IVO C;  1CCF A;  1KLO A;  2H9E C;  2Y7Z B;  1C5M F;  5IKT A;  2P3F N;  3NTB A;  2WYJ B;  1WU1 B;  3DEM A;  2EI7 B;  1UZP A;  1FE2 A;  1UZJ A;  2J95 B;  4YT7 L;  2XC5 L;  5E8D A;  1EGF A;  2WG4 B;  1G2L B;  2JKH L;  3GCW E;  4CUD A;  1V3X B;  4ZH8 B;  2J34 B;  3OLU A;  4RRZ A;  4X8T L;  1PGE A;  1IQF L;  1XFE A;  4ISI L;  3N8X A;  3GIS X;  5COX A;  1EZQ B;  1ATD A;  1Z6E L;  4Y76 B;  1NFY B;  1IP0 A;  1KIG L;  4YZU B;  2Y5G L;  4A7I A;  1XKB A;  3V64 C;  5KIR A;  3HS5 A;  5JW1 A;  1CVW L;  3RR3 A;  2H9E L;  1ATB A;  2MGR A;  3ENS A;  2KB9 A;  1YUK B;  3M36 L;  3SOV A;  2WFX B;  1A3P A;  1MOX C;  2RNL A;  4Z6A L;  4X8S L;  1FSB A;  5I46 L;  4RS0 A;  2WYG B;  4G1M B;  1IQE L;  3CS7 L;  3FFG L;  2YGO A;  2B7D L;  5JVZ A;  1EPI A;  3F6U L;  4FM5 A;  1HAF A;  1LPZ A;  2W2M E;  5IKV A;  1EBV A;  3N8W B;  1APO A;  2WPL E;  2GD4 A;  3H5C B;  2KNI A;  4BXS A;  3NT1 A;  2KV4 A;  4O1Z A;  3ZYJ B;  1O5D L;  4O02 B;  5CKN A;  3Q3K B;  5JBB E;  4LMF A;  2ADX A;  5CIS A;  1B9W A;  4YT6 L;  3N8Z A;  2XBW L;  1G1S A;  3IJE B;  1DQB A;  2BOH A;  2RA0 L;  4E1G A;  2BZ6 L;  3LN1 A;  1IGX A;  1JBU L;  1W8B L;  3N8Y B;  4JZF L;  4BTU A;  2W2N E;  1HRE A;  1KSN B;  1WHE A;  1J9C L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...