4NGBA

Structure of human dicer platform-paz-connector helix cassette in complex with 12-mer sirna having uu-3' ends (2.25 angstrom resolution)
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
298
structure length
276
Chain Sequence
QPCYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFGILTAKPIPQIPHFPVYTRSGEVTISIELAASGFMLSLQMLELITRLHQYIFSHILRLEKPALAYCVLPLNVVSSTLDIDFKFMEDIEKSEARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLHC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endoribonuclease Dicer
publication title A Phosphate-Binding Pocket within the Platform-PAZ-Connector Helix Cassette of Human Dicer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/rna
total genus 70
structure length 276
sequence length 298
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2013-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02170 PAZ PAZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.260.10 Mainly Beta Beta Complex paz domain paz domain 4ngbA02
2FFLA 4W5RA 5JS2A 4W5TA 1SI2A 4Z4GA 2XFMA 3QIRA 4Z4CA 4W5OA 2QVWA 4KRFA 4OLAA 4OLBA 5T7BA 4NH5A 4Z4EA 1R6ZA 4NHAA 3O7VX 5KI6A 4NGGA 4W5QA 2L5CA 3O6EX 4Z4FA 1T2RA 5JS1A 1R4KA 2L5DA 3O3IX 4Z4IA 3O7XA 4Z4HA 4NH3A 4NH6A 4NGFA 4W5NA 4NGCA 1VYNA 1T2SA 4NGBA 4F3TA 4NGDA 1SI3A 4KREA 3MJ0A
chains in the Genus database with same CATH superfamily
2FFLA 4W5RA 5JS2A 2DB9A 4W5TA 1SI2A 3DLBA 4L1PA 4Z4GA 2XFMA 4L1UA 3QIRA 4Z4CA 2QVWA 4W5OA 4NGDA 3DA5A 1U04A 1Z26A 4KRFA 4OLAA 4OLBA 5T7BA 4NH5A 4Z4EA 1R6ZA 3HM9A 3O7VX 4NHAA 5KI6A 4NGGA 3HVRA 4W5QA 3DLHA 2L5CA 3O6EX 4Z4FA 1T2RA 5JS1A 2BZEA 1R4KA 2L5DA 3O3IX 3U1UA 4Z4IA 1Z25A 3HJFA 3O7XA 4Z4HA 4NH3A 4NH6A 4NGFA 3HK2A 4W5NA 3F73A 4NGCA 1VYNA 1T2SA 4NGBA 4F3TA 3HO1A 1SI3A 4KREA 3MJ0A
chains in the Genus database with same CATH topology
2FFLA 4W5RA 5JS2A 2DB9A 4W5TA 1SI2A 3DLBA 4L1PA 4Z4GA 2XFMA 4L1UA 3QIRA 4Z4CA 2QVWA 4W5OA 4NGDA 3DA5A 1U04A 1Z26A 4KRFA 4OLAA 4OLBA 5T7BA 4NH5A 4Z4EA 1R6ZA 3HM9A 3O7VX 4NHAA 5KI6A 4NGGA 3HVRA 4W5QA 3DLHA 2L5CA 3O6EX 4Z4FA 1T2RA 5JS1A 2BZEA 1R4KA 2L5DA 3O3IX 3U1UA 4Z4IA 1Z25A 3HJFA 3O7XA 4Z4HA 4NH3A 4NH6A 4NGFA 3HK2A 4W5NA 3F73A 4NGCA 1VYNA 1T2SA 4NGBA 4F3TA 3HO1A 1SI3A 4KREA 3MJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FFL A;  4W5R A;  5JS2 A;  4W5T A;  1SI2 A;  4Z4G A;  2XFM A;  3QIR A;  4Z4C A;  4W5O A;  2QVW A;  4KRF A;  4OLA A;  4OLB A;  5T7B A;  4NH5 A;  4Z4E A;  1R6Z A;  4NHA A;  3O7V X;  5KI6 A;  4NGG A;  4W5Q A;  2L5C A;  3O6E X;  4Z4F A;  1T2R A;  5JS1 A;  1R4K A;  2L5D A;  3O3I X;  4Z4I A;  3O7X A;  4Z4H A;  4NH3 A;  4NH6 A;  4NGF A;  4W5N A;  4NGC A;  1VYN A;  1T2S A;  4NGB A;  4F3T A;  4NGD A;  1SI3 A;  4KRE A;  3MJ0 A; 
#chains in the Genus database with same CATH topology
 2FFL A;  4W5R A;  5JS2 A;  2DB9 A;  4W5T A;  1SI2 A;  3DLB A;  4L1P A;  4Z4G A;  2XFM A;  4L1U A;  3QIR A;  4Z4C A;  2QVW A;  4W5O A;  4NGD A;  3DA5 A;  1U04 A;  1Z26 A;  4KRF A;  4OLA A;  4OLB A;  5T7B A;  4NH5 A;  4Z4E A;  1R6Z A;  3HM9 A;  3O7V X;  4NHA A;  5KI6 A;  4NGG A;  3HVR A;  4W5Q A;  3DLH A;  2L5C A;  3O6E X;  4Z4F A;  1T2R A;  5JS1 A;  2BZE A;  1R4K A;  2L5D A;  3O3I X;  3U1U A;  4Z4I A;  1Z25 A;  3HJF A;  3O7X A;  4Z4H A;  4NH3 A;  4NH6 A;  4NGF A;  3HK2 A;  4W5N A;  3F73 A;  4NGC A;  1VYN A;  1T2S A;  4NGB A;  4F3T A;  3HO1 A;  1SI3 A;  4KRE A;  3MJ0 A; 
#chains in the Genus database with same CATH homology
 2FFL A;  4W5R A;  5JS2 A;  2DB9 A;  4W5T A;  1SI2 A;  3DLB A;  4L1P A;  4Z4G A;  2XFM A;  4L1U A;  3QIR A;  4Z4C A;  2QVW A;  4W5O A;  4NGD A;  3DA5 A;  1U04 A;  1Z26 A;  4KRF A;  4OLA A;  4OLB A;  5T7B A;  4NH5 A;  4Z4E A;  1R6Z A;  3HM9 A;  3O7V X;  4NHA A;  5KI6 A;  4NGG A;  3HVR A;  4W5Q A;  3DLH A;  2L5C A;  3O6E X;  4Z4F A;  1T2R A;  5JS1 A;  2BZE A;  1R4K A;  2L5D A;  3O3I X;  3U1U A;  4Z4I A;  1Z25 A;  3HJF A;  3O7X A;  4Z4H A;  4NH3 A;  4NH6 A;  4NGF A;  3HK2 A;  4W5N A;  3F73 A;  4NGC A;  1VYN A;  1T2S A;  4NGB A;  4F3T A;  3HO1 A;  1SI3 A;  4KRE A;  3MJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...