4NGDA

Structure of human dicer platform-paz-connector helix cassette in complex with 12-mer sirna having 5'-p and uu-3' ends (1.95 angstrom resolution)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
298
structure length
280
Chain Sequence
QPCYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFGILTAKPIPQIPHFPVYTRSGEVTISIELAASGFMLSLQMLELITRLHQYIFSHILRLEKPALAYCVLPLNVVSSTLDIDFKFMEDIEKSEARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLHC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endoribonuclease Dicer
publication title A Phosphate-Binding Pocket within the Platform-PAZ-Connector Helix Cassette of Human Dicer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/rna
total genus 69
structure length 280
sequence length 298
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2013-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02170 PAZ PAZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.260.10 Mainly Beta Beta Complex paz domain paz domain 4ngdA02
3O7XA 1T2RA 4Z4CA 4W5TA 4W5NA 1R4KA 4OLBA 1SI3A 5T7BA 4Z4FA 2XFMA 4W5RA 4W5OA 4Z4HA 1SI2A 4NGDA 4NGBA 4Z4IA 4NHAA 4NH5A 4Z4GA 1VYNA 4NGGA 4NH3A 4Z4EA 4NH6A 5JS2A 4NGFA 4OLAA 5KI6A 4KRFA 4W5QA 4NGCA 5JS1A 2QVWA 3QIRA 3O6EX 3O7VX 2FFLA 3O3IX 4KREA 1R6ZA 2L5DA 2L5CA 4F3TA 1T2SA 3MJ0A
chains in the Genus database with same CATH superfamily
3O7XA 3U1UA 3HJFA 1T2RA 3HVRA 4Z4CA 4W5TA 4W5NA 2BZEA 3DLBA 1R4KA 4OLBA 1SI3A 5T7BA 3HK2A 4Z4FA 4L1UA 1Z26A 4W5RA 4W5OA 4Z4HA 2XFMA 3DLHA 1SI2A 3F73A 4NGBA 3HO1A 4NGDA 4Z4IA 4NHAA 4NH5A 2DB9A 4Z4GA 1VYNA 4NGGA 3DA5A 4Z4EA 4NH3A 4NH6A 5JS2A 4NGFA 4OLAA 5KI6A 1Z25A 4KRFA 4W5QA 4NGCA 5JS1A 1U04A 2QVWA 3QIRA 4L1PA 3O6EX 3O7VX 2FFLA 3O3IX 4KREA 3HM9A 1R6ZA 2L5DA 2L5CA 4F3TA 1T2SA 3MJ0A
chains in the Genus database with same CATH topology
3O7XA 3U1UA 3HJFA 1T2RA 3HVRA 4Z4CA 4W5TA 4W5NA 2BZEA 3DLBA 1R4KA 4OLBA 1SI3A 5T7BA 3HK2A 4Z4FA 4L1UA 1Z26A 4W5RA 4W5OA 4Z4HA 2XFMA 3DLHA 1SI2A 3F73A 4NGBA 3HO1A 4NGDA 4Z4IA 4NHAA 4NH5A 2DB9A 4Z4GA 1VYNA 4NGGA 3DA5A 4Z4EA 4NH3A 4NH6A 5JS2A 4NGFA 4OLAA 5KI6A 1Z25A 4KRFA 4W5QA 4NGCA 5JS1A 1U04A 2QVWA 3QIRA 4L1PA 3O6EX 3O7VX 2FFLA 3O3IX 4KREA 3HM9A 1R6ZA 2L5DA 2L5CA 4F3TA 1T2SA 3MJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O7X A;  1T2R A;  4Z4C A;  4W5T A;  4W5N A;  1R4K A;  4OLB A;  1SI3 A;  5T7B A;  4Z4F A;  2XFM A;  4W5R A;  4W5O A;  4Z4H A;  1SI2 A;  4NGD A;  4NGB A;  4Z4I A;  4NHA A;  4NH5 A;  4Z4G A;  1VYN A;  4NGG A;  4NH3 A;  4Z4E A;  4NH6 A;  5JS2 A;  4NGF A;  4OLA A;  5KI6 A;  4KRF A;  4W5Q A;  4NGC A;  5JS1 A;  2QVW A;  3QIR A;  3O6E X;  3O7V X;  2FFL A;  3O3I X;  4KRE A;  1R6Z A;  2L5D A;  2L5C A;  4F3T A;  1T2S A;  3MJ0 A; 
#chains in the Genus database with same CATH topology
 3O7X A;  3U1U A;  3HJF A;  1T2R A;  3HVR A;  4Z4C A;  4W5T A;  4W5N A;  2BZE A;  3DLB A;  1R4K A;  4OLB A;  1SI3 A;  5T7B A;  3HK2 A;  4Z4F A;  4L1U A;  1Z26 A;  4W5R A;  4W5O A;  4Z4H A;  2XFM A;  3DLH A;  1SI2 A;  3F73 A;  4NGB A;  3HO1 A;  4NGD A;  4Z4I A;  4NHA A;  4NH5 A;  2DB9 A;  4Z4G A;  1VYN A;  4NGG A;  3DA5 A;  4Z4E A;  4NH3 A;  4NH6 A;  5JS2 A;  4NGF A;  4OLA A;  5KI6 A;  1Z25 A;  4KRF A;  4W5Q A;  4NGC A;  5JS1 A;  1U04 A;  2QVW A;  3QIR A;  4L1P A;  3O6E X;  3O7V X;  2FFL A;  3O3I X;  4KRE A;  3HM9 A;  1R6Z A;  2L5D A;  2L5C A;  4F3T A;  1T2S A;  3MJ0 A; 
#chains in the Genus database with same CATH homology
 3O7X A;  3U1U A;  3HJF A;  1T2R A;  3HVR A;  4Z4C A;  4W5T A;  4W5N A;  2BZE A;  3DLB A;  1R4K A;  4OLB A;  1SI3 A;  5T7B A;  3HK2 A;  4Z4F A;  4L1U A;  1Z26 A;  4W5R A;  4W5O A;  4Z4H A;  2XFM A;  3DLH A;  1SI2 A;  3F73 A;  4NGB A;  3HO1 A;  4NGD A;  4Z4I A;  4NHA A;  4NH5 A;  2DB9 A;  4Z4G A;  1VYN A;  4NGG A;  3DA5 A;  4Z4E A;  4NH3 A;  4NH6 A;  5JS2 A;  4NGF A;  4OLA A;  5KI6 A;  1Z25 A;  4KRF A;  4W5Q A;  4NGC A;  5JS1 A;  1U04 A;  2QVW A;  3QIR A;  4L1P A;  3O6E X;  3O7V X;  2FFL A;  3O3I X;  4KRE A;  3HM9 A;  1R6Z A;  2L5D A;  2L5C A;  4F3T A;  1T2S A;  3MJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...