4NGGA

Structure of human dicer platform-paz-connector helix cassette in complex with 13-mer sirna having 5'-a and uu-3' ends (2.6 angstrom resolution)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
298
structure length
267
Chain Sequence
QPCYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFGILTAKPIPQIPHFPVYTRSGEVTISIELAASGFMLSLQMLELITRLHQYIFSHILRLEYCVLPLNVVNDSTLDIDFKFMEDIEKSEARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLHC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endoribonuclease Dicer
publication title A Phosphate-Binding Pocket within the Platform-PAZ-Connector Helix Cassette of Human Dicer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/rna
total genus 65
structure length 267
sequence length 298
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2013-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02170 PAZ PAZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.260.10 Mainly Beta Beta Complex paz domain paz domain 4nggA02
3QIRA 2XFMA 1VYNA 4NH5A 5KI6A 3MJ0A 4Z4HA 4KREA 4W5RA 4W5NA 4W5TA 3O7VX 2L5CA 3O3IX 5T7BA 4NGCA 4F3TA 4W5OA 4NH3A 5JS2A 3O6EX 4NGBA 4Z4IA 3O7XA 4NHAA 4NGGA 4Z4CA 5JS1A 4W5QA 1SI3A 1T2RA 4NH6A 1R6ZA 2FFLA 1R4KA 1T2SA 4OLBA 4NGFA 2L5DA 4Z4FA 4OLAA 4Z4GA 1SI2A 4KRFA 4NGDA 4Z4EA 2QVWA
chains in the Genus database with same CATH superfamily
3QIRA 1U04A 2XFMA 1VYNA 4NH5A 3HJFA 5KI6A 3MJ0A 4Z4HA 4KREA 4W5RA 4W5NA 3U1UA 4W5TA 3HVRA 3O7VX 2L5CA 3O3IX 3HM9A 2BZEA 5T7BA 4NGCA 4F3TA 4W5OA 4NH3A 5JS2A 3DA5A 3O6EX 4NGBA 1Z26A 3O7XA 4L1PA 4Z4IA 3F73A 3HO1A 4Z4CA 4NHAA 4NGGA 5JS1A 4W5QA 1SI3A 1T2RA 4NH6A 3DLBA 1R6ZA 2DB9A 2FFLA 1R4KA 3HK2A 1T2SA 4OLBA 4NGFA 2L5DA 4Z4FA 1Z25A 4L1UA 3DLHA 4OLAA 4Z4GA 1SI2A 4KRFA 4NGDA 4Z4EA 2QVWA
chains in the Genus database with same CATH topology
3QIRA 1U04A 2XFMA 1VYNA 4NH5A 3HJFA 5KI6A 3MJ0A 4Z4HA 4KREA 4W5RA 4W5NA 3U1UA 4W5TA 3HVRA 3O7VX 2L5CA 3O3IX 3HM9A 2BZEA 5T7BA 4NGCA 4F3TA 4W5OA 4NH3A 5JS2A 3DA5A 3O6EX 4NGBA 1Z26A 3O7XA 4L1PA 4Z4IA 3F73A 3HO1A 4Z4CA 4NHAA 4NGGA 5JS1A 4W5QA 1SI3A 1T2RA 4NH6A 3DLBA 1R6ZA 2DB9A 2FFLA 1R4KA 3HK2A 1T2SA 4OLBA 4NGFA 2L5DA 4Z4FA 1Z25A 4L1UA 3DLHA 4OLAA 4Z4GA 1SI2A 4KRFA 4NGDA 4Z4EA 2QVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QIR A;  2XFM A;  1VYN A;  4NH5 A;  5KI6 A;  3MJ0 A;  4Z4H A;  4KRE A;  4W5R A;  4W5N A;  4W5T A;  3O7V X;  2L5C A;  3O3I X;  5T7B A;  4NGC A;  4F3T A;  4W5O A;  4NH3 A;  5JS2 A;  3O6E X;  4NGB A;  4Z4I A;  3O7X A;  4NHA A;  4NGG A;  4Z4C A;  5JS1 A;  4W5Q A;  1SI3 A;  1T2R A;  4NH6 A;  1R6Z A;  2FFL A;  1R4K A;  1T2S A;  4OLB A;  4NGF A;  2L5D A;  4Z4F A;  4OLA A;  4Z4G A;  1SI2 A;  4KRF A;  4NGD A;  4Z4E A;  2QVW A; 
#chains in the Genus database with same CATH topology
 3QIR A;  1U04 A;  2XFM A;  1VYN A;  4NH5 A;  3HJF A;  5KI6 A;  3MJ0 A;  4Z4H A;  4KRE A;  4W5R A;  4W5N A;  3U1U A;  4W5T A;  3HVR A;  3O7V X;  2L5C A;  3O3I X;  3HM9 A;  2BZE A;  5T7B A;  4NGC A;  4F3T A;  4W5O A;  4NH3 A;  5JS2 A;  3DA5 A;  3O6E X;  4NGB A;  1Z26 A;  3O7X A;  4L1P A;  4Z4I A;  3F73 A;  3HO1 A;  4Z4C A;  4NHA A;  4NGG A;  5JS1 A;  4W5Q A;  1SI3 A;  1T2R A;  4NH6 A;  3DLB A;  1R6Z A;  2DB9 A;  2FFL A;  1R4K A;  3HK2 A;  1T2S A;  4OLB A;  4NGF A;  2L5D A;  4Z4F A;  1Z25 A;  4L1U A;  3DLH A;  4OLA A;  4Z4G A;  1SI2 A;  4KRF A;  4NGD A;  4Z4E A;  2QVW A; 
#chains in the Genus database with same CATH homology
 3QIR A;  1U04 A;  2XFM A;  1VYN A;  4NH5 A;  3HJF A;  5KI6 A;  3MJ0 A;  4Z4H A;  4KRE A;  4W5R A;  4W5N A;  3U1U A;  4W5T A;  3HVR A;  3O7V X;  2L5C A;  3O3I X;  3HM9 A;  2BZE A;  5T7B A;  4NGC A;  4F3T A;  4W5O A;  4NH3 A;  5JS2 A;  3DA5 A;  3O6E X;  4NGB A;  1Z26 A;  3O7X A;  4L1P A;  4Z4I A;  3F73 A;  3HO1 A;  4Z4C A;  4NHA A;  4NGG A;  5JS1 A;  4W5Q A;  1SI3 A;  1T2R A;  4NH6 A;  3DLB A;  1R6Z A;  2DB9 A;  2FFL A;  1R4K A;  3HK2 A;  1T2S A;  4OLB A;  4NGF A;  2L5D A;  4Z4F A;  1Z25 A;  4L1U A;  3DLH A;  4OLA A;  4Z4G A;  1SI2 A;  4KRF A;  4NGD A;  4Z4E A;  2QVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...