4NGPA

Crystal structure of glutamate carboxypeptidase ii in a complex with urea-based inhibitor
Total Genus 262
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
262
sequence length
696
structure length
695
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Rational design of urea-based glutamate carboxypeptidase II (GCPII) inhibitors as versatile tools for specific drug targeting and delivery
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 262
structure length 695
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4ngpA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4ngpA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4ngpA02
4A39A 4CDJA 4JZ0A 1TKHA 4ZX8A 1Y9ZA 1VHEA 3S9NA 3V38A 1ARMA 2EK9A 4C8FA 4OIWA 3SJGA 4FUUA 2PJ9A 4IK2A 1Y0YA 4MRIA 4A94A 4R76A 3B3CA 1FNOA 2PCUA 4UEZA 4MCPA 3DLJA 4A37A 2V8DA 3FMCA 4ONWA 4UF4A 4TJXA 2ANPA 1OBRA 4JYWA 4OC5A 4F9VA 4UEFA 5D8NA 3PBBA 1Q7LA 1CPXA 4OC1A 1NSAA 2VL1A 2PVWA 3GUXA 2AFOA 1XJOA 1EE3P 3HUVA 3VH9A 4DYOA 2ZOFA 3JRUA 3D7FA 2PJBA 1IGBA 1H8LA 3D68A 4NGPA 2PE3A 4IAVA 1Z2LA 2PJ2A 2HB6A 3CT9A 1RTQA 2ZOGA 4PXCA 2QVPA 3I74A 4AXVA 3FEEA 3KR4A 5CPAA 1TF9A 3FJUA 1PYTB 3B7IA 2G9DA 4P44A 4DJLA 4CPAA 3FECA 5HVGA 1CP7A 3V7ZA 4C85A 4K3NA 2AFUA 4P10A 3FEDA 1HEEA 2ZENA 2XEJA 5HVFA 3KZWA 1BAVA 1R3NA 2CTCA 1YW4A 4EWTA 2ZELA 4C9VA 4ZY2A 1TKJA 4IHMA 4ZYQA 5JM6A 2IJZA 5LRJA 3PFEA 1DE4C 2PJ3A 4MXUA 2C6GA 1CBXA 4MHZA 3NFZA 1F57A 2PVVA 1LAPA 4MHPA 2PRQA 1YSJA 4ZY1A 1F2PA 2GU2A 3PRTA 2I3CA 4MCRA 2O4HA 2PJ1A 3RBUA 4MMOA 5ELYA 3PB6X 4TWEA 6CPAA 4NJRA 3B3SA 1TF8A 4F9UA 2CIJA 4B6ZA 2ZEPA 1ZG8A 1AYEA 1QQ9A 1IY7A 3NH4A 1KWMA 2BCOA 2V8VA 2HC9A 4NGRA 3LMSA 4WWVA 4NGMA 2XEFA 3NH8A 2V77A 2ZEOA 2C6CA 4Z65A 2ZEDA 1VIXA 4OC2A 3SJXA 1Z8LA 3D7DA 3SJEA 4H2KA 2C6PA 2ABZA 5LYLA 2ZEEA 4PXDA 2GLFA 5LYIA 4FWUA 2BOAA 3SJFA 3FH4A 1Y0RA 2QYVA 2WZNA 2Q4ZA 2RFHA 3D67A 3I6SA 4C9AA 2F8HA 1WVMA 2V8HA 4MHYA 4C8CA 5LYDA 5JH9A 2PJ4A 2OR4A 1CPSA 4YU9A 3CPAA 4FBEA 4WJBA 4P6YA 3H8GA 5J1QA 8CPAA 4P4IA 3QNVA 4KNGE 5K8OA 3ISXA 4C99A 3SI0A 4C8TA 4W9YA 1BLLE 3KASA 1CX8A 2IMOA 4ZY0A 4UIAA 2ZEMA 5IB9A 4NGSA 4G1PA 4PXBA 4R7MA 2PJCA 4X3RA 2F7VA 2PIYA 1V6CA 3ISZA 4DUKA 4NGQA 1XFOA 3KR5A 3IO1A 1LCPA 4NGTA 4YWYA 3RZAA 3WABA 5F09A 4MCQA 2J9AA 2AFMA 3K2KA 3PB9X 3SI1A 3IIBA 1XF1A 3IFEA 1BPMA 3MN8A 2POKA 2V8GA 3S9MA 5LYFA 3IEHA 1F2OA 3CPXA 4P45A 1BPNA 2QJ8A 3IWWA 1Z5RA 2AFWA 4P4JA 2Q43A 4PPZA 4BD9A 2AFXA 4OC3A 3BI1A 2Q51A 3KI9A 4LQGA 4C9RA 2JBJA 4C8UA 3KQXA 1FT7A 1YMEA 3EIFA 3KL9A 3BXMA 4NJQA 4MHNA 5LRGA 1YLOA 2PJ7A 3RAMA 4C86A 5JGFA 2FVGA 3K9TA 4X2TA 2OOTA 1HDQA 3HLPA 2GREA 4OKOA 4X8IA 1ZG9A 4PXEA 1TKFA 5I4MA 4O23A 3L2NA 2AFZA 4C8PA 4ZI6A 2XEIA 3H8FA 2PJ6A 3B3WA 1LAMA 1GYTA 4CDKA 7CPAA 1ZLIA 4OC0A 1ARLA 3D66A 4YN3A 5LRKA 1ELMP 1TXRA 3B3TA 3BI0A 1ELLP 1PCAA 3NA6A 3I1UA 1CP6A 3S9LA 2JBKA 4P4BA 1Y7EA 3TC8A 2CF4A 2XEGA 2EK8A 3B3VA 5K8NA 4TNUA 3WC7A 4UEEA 2ZEFA 2AFSA 2CTBA 3PBEA 2NSMA 1ZLHA 4OIDA 4C9UA 2PJ8A 3KQZA 1XBUA 3VATA 4PQAA 4C84A 4EFDA 3VTAA 3D4UA 2PJ0A 3FX6A 4FAIA 3T8WA 3GLJA 1UWYA 1LANA 1YW6A 3CDXA 2RB7A 1CG2A 4NGNA 4NFRA 4P4DA 3WT4A 1HDUA 3B35A 3BHXA 2PIZA 3PB7X 3PEIA 3IC1A 5D29A 2ZEGA 5CBMA 5HVHA 3VARA 5HXDA 4R6TA 1R43A 4TJVA 2ZEHA 3PFOA 1XMBA 3NH5A 4C8AA 1LFWA 4P4EA 2PJ5A 4RUHA 1XRYA 3SI2A 3TX8A 4UIBA 1ZG7A 2JEWA 4R8FA 5K8PA 1VGYA 3LWUA 4OC4A 1DTDA 3MRUA 3IJ3A 3B2YA 3D7GA 3KHZA 3WC6A 1QMUA 2O53A 2PJAA 3ICUA 2EWBA 4OP4A 1JQGA 3DGVA 3FF3A 1AMPA 2DEAA 5THWA 1VHOA 3WC5A 4ZX9A 3PB4X 3D7HA 2GLJA 1M4LA 3KGQA 4P4FA 4GM5A 4A38A 5DS0A 4Q7AA 3GB0A 4C9EA 2C1CA 2BO9A 2WYRA 4MCSA 4EMEA 1LOKA 4OMEA 5K8MA 2NYQA 4KSIA 3H8EA 2IQ6A 3PB8X 3KHXA 3FVLA 3N5FA 4F8ZA
chains in the Genus database with same CATH superfamily
2IL4A 4IUSA 4A39A 4JZ0A 1TKHA 2GANA 4ZX8A 5KTDA 4II9A 1Y9ZA 3F8KA 2DIKA 1VHEA 1JWQA 2PR8A 3S9NA 1SQHA 2Z10A 4B5PA 3V38A 3PGPA 1ARMA 2EK9A 2JLMA 4C2XA 1NBWA 2PCNA 4C8FA 2FIAA 2OZUA 4OIWA 2DF5A 4KSFA 1ZL0A 3SJGA 4FUUA 2PJ9A 4IK2A 2HQYA 2PR1A 1Y0YA 2EVNA 4AVBA 4MRIA 2ZW7A 4A94A 4R76A 2Y0MA 1FNOA 2PCUA 3B3CA 1XOVA 2B4BA 3CXSA 4UEZA 4MCPA 1UFHA 2CBLA 3DLJA 3FIXA 2V8DA 3FMCA 3P2FA 4ONWA 4A37A 4UF4A 3K4IA 4TJXA 4R9MA 1MJ9A 1OBRA 4JYWA 2ANPA 2OU2A 1IU8A 4FD4A 3D8PA 4KVOE 4OC5A 2I79A 2G0BA 4NEXA 4UEFA 4F9VA 3EFAA 1YR0A 3G23A 2I00A 3PBBA 1Q7LA 4BPUB 1Q2CA 5D8NA 5G21A 1CPXA 3OP0A 1Q2DA 4CO9A 4KOVA 4OC1A 5F13A 4E8OA 1NSAA 2FXFA 2PVWA 2VL1A 5HMNA 3GUXA 2AFOA 2ZXVA 1XJOA 1EE3P 3HUVA 1QSOA 4H6UA 3VH9A 2ZOFA 3JRUA 3D7FA 4LX9A 1IICA 4DYOA 2PJBA 4ONUA 1JDBC 1PU9A 2WPWA 1IGBA 1IOIA 1H8LA 4MFKA 3D68A 4NGPA 5J8CA 2PE3A 4M8DA 4IAVA 1Z2LA 2PJ2A 4CDJA 1M4GA 2HB6A 4KVME 4Q36A 3CT9A 1A9XB 4PSWA 1RTQA 3TFYA 1NE9A 2ZOGA 1XMTA 4PXCA 4AB7A 2QVPA 3FYNA 2OZHA 3OAKA 1I1DA 2Q0YA 4CGOA 3I74A 4AXVA 3FEEA 5K99A 2FSRA 2EZCA 3TLEA 2BUEA 3KR4A 5CPAA 1TF9A 3FJUA 1PYTB 3B7IA 2G9DA 3S6KA 4P44A 4DJLA 2Z11A 5EC4A 1YK3A 2Q7BA 2X0SA 1CM0A 1S3ZA 4C7HA 1XEBA 3F5BA 1Z4EA 1EO0A 4ORFA 5GCNA 3SHPA 1MK4A 4PK3A 2D4PA 3FECA 4M3SA 4CPAA 5HVGA 1CP7A 3DR8A 5F1YA 2VKZG 3S6FA 2YNCC 4L89A 2HV2A 2RC4A 3V7ZA 1VI4A 4B12A 2D4OA 1PUAA 4MI1A 4C85A 4K3NA 2AFUA 1CJWA 4B5PB 4QBJA 4P10A 3VRPA 3FEDA 1HEEA 2ZENA 3N7ZA 2XEJA 2DLAA 4J3GA 5HVFA 3T07A 2VXKA 1XE4A 3KZWA 1BAVA 1R3NA 3R96A 4KOSA 2ZW4A 3R9FA 5IV0A 2E28A 4B10A 2JDDA 2CTCA 1YW4A 2P6FA 4EWTA 3VGOA 2ZELA 2EZBA 4JXRA 2YJTA 3JTKA 4C9VA 3TLGB 4ZY2A 4QVTA 1TKJA 4IHMA 4MI4A 1TIQA 5G20A 4A32A 4B14A 4ZYQA 4HNYB 2D0OA 2VZZA 3C8OA 3BUWB 3EZEA 5JM6A 1LRZA 3D2PA 4CS0B 3HPGG 5F46A 3E0KA 3EY5A 5A28A 2QIRA 1BOBA 2IJZA 3EZAA 1QSTA 4MFQA 3VWDA 5LRJA 2XPNA 1Y9WA 3PFEA 2N3AB 4GXHA 1YQEA 2AJ6A 1DE4C 2G3TA 2QMLA 2PJ3A 1YX0A 3GY9A 4MXUA 1NSLA 4A33A 4LQ6A 4XNHC 2C6GA 1CBXA 4XNHB 4MHZA 4CYNA 3NFZA 1F57A 2PVVA 2NMTA 5AG6A 1LAPA 3R1KA 4MHPA 4UCPA 1C30B 2Y1MA 2PRQA 4CRYB 1ZRSA 3JVNA 1YSJA 4ZY1A 3TCVA 5KTAA 1F2PA 1Q2YA 2GU2A 2I3CA 3FXTA 3PRTA 4MCRA 2O4HA 1Y9KA 2PJ1A 3P2HA 1GHEA 3RBUA 4MMOA 5AXIA 5ELYA 5HH1A 2F5IA 3PB6X 4JJXA 1V0CA 2VI7A 4TWEA 5FD8A 6CPAA 4NJRA 3B3SA 4KOXA 1TF8A 2B3UA 4R57A 2HI6A 4H6ZA 4HKFA 2PQ8A 4COGA 3GYAA 4BPXB 5AG5A 1KUYA 2CIJA 4B6ZA 4F9UA 2WSAA 2ZEPA 2C27A 1ZG8A 3NE8A 1AYEA 1QQ9A 3KKWA 1IY7A 3NH4A 1KWMA 2BCOA 2V8VA 2YNDA 2HC9A 5I0CA 4NGRA 3B8GA 3ZNIA 4AG9A 3OB1B 3LMSA 5G1ZA 4WWVA 3ZZIA 4NGMA 5FVJA 1P4NA 2XEFA 2J8MA 2B5GA 2XPLA 2Q04A 2FT0A 2V77A 2ZEOA 3IGRA 3NH8A 3QB8A 4MFJA 1VBHA 2C6CA 3DNSA 4CAVA 5DWNA 2B58A 4Z65A 2ZEDA 1VIXA 5DWMA 2K5TA 4OC2A 3SJXA 5F47A 4UFWA 2R98A 4IIXA 3JUWA 3BUNB 1Z8LA 3D7DA 3SJEA 1S5KA 3KRVA 1IYKA 3NOJA 4A2ZA 3O8ZA 1X10A 4H2KA 3VRRA 1VBGA 3T5MA 2C6PA 3HMJG 2CXAA 2ABZA 1WJTA 1M6VB 5LYLA 4A4BA 2ZEEA 3IU1A 4PXDA 2GLFA 4CGLA 3T9YA 1J4JA 4QC6A 4EYSA 1FY7A 1KUVA 5LYIA 1DIKA 4XPKA 2HWGA 4JVOA 1KUXA 3TLYA 3HPHE 1Y7RA 4FWUA 2Z3OA 2JDCA 2REFA 4M85A 5EBVA 2BOAA 1AUGA 2FIWA 2D0PA 3SJFA 4PSXA 3FH4A 1Y0RA 2QYVA 3GJZA 3EZBA 4A4CA 2WZNA 1M1DA 2AUMA 3TLCA 2Q4ZA 2ODFA 2RFHA 3D67A 4PK2A 3I6SA 4CYOA 2EO8A 1Q5XA 1B47A 2F8HA 2P6GA 4C9AA 1YREA 2FE7A 2R7HA 1WVMA 2V8HA 4MHYA 4C8CA 5LYDA 1EZBA 5JH9A 2PJ4A 1L0CA 5KTCA 2OR4A 4J0NA 1CPSA 2OZGA 4YU9A 4E2AA 4Q38A 3CPAA 4FBEA 4WJBA 5EMIA 3RYOA 4P6YA 3SXOA 2ATRA 3H8GA 4BPWB 1I12A 2WUUA 4FD5A 3K9UA 4MFZA 4CRZB 8CPAA 4HNWB 5J1QA 4MFLA 4AVAA 1QSNA 4P4IA 1NMTA 3QNVA 4KOWA 4KNGE 3S6GA 4Y49C 5K8OA 3ISXA 4A30A 2OLSA 4C99A 1C3OB 1RXTA 3SI0A 4W9YA 1BLLE 4QUSA 4C8TA 3KASA 3BUMB 4XPDC 5AGEA 1CX8A 2IMOA 4XPDB 4C7IA 4C2YA 2CY2A 4ZY0A 3TLAA 4UIAA 2R82A 1M4DA 2G3AA 3MGDA 2Z3MA 4CGNA 4COBA 2DPSA 1T36B 2ZEMA 5IB9A 4E5SA 4NGSA 4G1PA 2Q4YA 3QAHA 4PV6A 5HKZA 4K30A 3R95A 2DPTA 4OADA 4PXBA 3UY5A 3WR7A 4R7MA 2PJCA 4UFVA 2YNEA 4X3RA 2PDOA 3RNZA 2F7VA 2P0WA 2PIYA 2B3VA 4HNXB 1Z9UA 4KLVA 1V6CA 1YVHA 3ISZA 4R3LA 4JLYA 4U9ZA 2JEVA 4DUKA 4NGQA 1XFOA 3IO1A 3KR5A 4AVCA 1LCPA 5IX3A 2BEIA 4NGTA 4CAWA 2Z0ZA 4YWYA 1S7NA 2Z3KA 1IOFA 1A2ZA 3CXQA 5IB0A 3RZAA 3WABA 2PSWA 5F09A 2EZAA 4MCQA 2J9AA 1K4JA 2AFMA 3K2KA 5A27A 3ZJ0A 4H1HA 1R61A 3PB9X 5JVLA 3SI1A 4CZ1A 4A95A 5C82A 3IIBA 1S60A 1XF1A 1BO4A 3IFEA 3VWEA 1BPMA 3VRNA 3TLBA 2GFQA 2DXQA 1KBLA 3MN8A 1N71A 3EXNA 2HUZA 2POKA 2V8GA 3S9MA 3RO0A 5LYFA 2GP4A 2Z3PA 5F48A 4XPLA 2ZW5A 5H84A 3IEHA 4BINA 1F2OA 3CPXA 2YJVA 4P45A 2HROA 1BPNA 3R9EA 3IWGA 2QJ8A 3IWWA 3LODA 1Z5RA 2AFWA 4P4JA 2Q43A 4KOYA 5G22A 4ZBGA 4PPZA 4B13A 5AG4A 4BD9A 2AFXA 3OWCA 4OC3A 3T05A 3BI1A 2Q44A 3GIUA 4RS2A 1ON0A 2CNMA 2VBQA 2YGWA 4IIYA 1RO5A 3I9SA 2Q51A 2Z3LA 2KCWA 4YFJA 3KI9A 3BUXB 4LQGA 4X5KA 1GGOA 2JBJA 4C9RA 2ARHA 4C8UA 4BMHA 3KQXA 1FT7A 1YMEA 3EIFA 3GKRA 2GE3A 4F0YA 3KL9A 3BXMA 4NJQA 4MHNA 2B4DA 4NXYA 4L8AA 4UCNA 4UWJA 1Z8WA 4NSQA 4GS4A 4UA3A 1BXRB 5LRGA 1YLOA 2PJ7A 3RAMA 3TO9A 4C86A 3U1BA 4MJ8A 2FVGA 5JGFA 4QB9A 1NXJA 3DDDA 3K9TA 5J3XA 3G8WA 4X2TA 2EUIA 5HKYA 1B6BA 4CAEA 3FNCA 2OOTA 1HDQA 3HLPA 3LACA 4KZTA 2GREA 4OKOA 4KOUA 4RI1A 2Q7SA 3U88C 1ZG9A 4PXEA 1TKFA 4X8IA 5F49A 4DNCA 5I4MA 3I3GA 2X7BA 3L2NA 3NE7A 4O23A 2AFZA 4C8PA 2FL4A 2VZYA 1CS0B 4ZI6A 4EVYA 2XEIA 3H8FA 1Z9EA 2PJ6A 5H86A 2FCKA 2OB0A 3B3WA 2YNCA 1LAMA 1GYTA 4CDKA 7CPAA 2FM4A 3PLFB 1ZLIA 4OC0A 1ARLA 3BJ8A 3D66A 3VRQA 2P6EA 3FRMA 1IYLA 4KS9A 3W6SA 4GPLB 4CAFA 3IWEA 1I21A 1XF8A 4MHDA 5LRKA 1ELMP 1TXRA 4I49A 1Z8TA 1S7FA 3B3TA 3QAYA 4KVXA 4AG7A 3BI0A 1ELLP 3SXNA 1PCAA 1MJBA 1VKCA 3NA6A 3I1UA 1CP6A 3TLGA 3S9LA 2JBKA 4P4BA 4A31A 5JQ4A 2ZPAA 4H89A 4RR2B 1Y7EA 4MFPA 3TC8A 2B0AA 2CF4A 1MJAA 2XEGA 3W6XA 2EK8A 3TOAA 3TO6A 3NFQA 1M4IA 3B3VA 3G3SA 4NCZA 4TNUA 3WC7A 5K8NA 5ISVA 3OB2B 3DSBA 2ZEFA 4UEEA 2AFSA 4OLLA 1EZAA 2CTBA 4FD7A 3BJ7A 3PBEA 1JDEA 2NSMA 3EO4A 3SR3A 1ZLHA 4OIDA 4MJXA 5JYBA 4C9UA 2PJ8A 3KQZA 1XBUA 3VATA 2XPOA 4PQAA 3TTHA 5BWAB 2C5QA 4C84A 3PZJA 3D3SA 4EFDA 3VTAA 3D4UA 2PJ0A 3FX6A 4FAIA 2H5MA 3T8WA 3GLJA 1UWYA 2EBJA 3D2MA 2AUNA 1WK4A 4CGPA 1LANA 1YW6A 2VQYA 4UCMA 3H4QA 4E94A 2VEZA 3CDXA 2RB7A 4Y49B 5BY0A 1CG2A 3F9KC 1Z8XA 4NF1A 1R57A 4F0XA 3PFVA 4NGNA 1S7LA 4KUAA 4NFRA 2PRBA 3V8IA 4P4DA 1YVKA 2B4DB 3LD2A 3WT4A 1HDUA 3B35A 3A9LA 3BHXA 2PIZA 3PB7X 3PEIA 4FD6A 4MY0A 4F6AA 4MY3A 3IC1A 5D29A 2ZEGA 3R9GA 1XIXA 1IB1E 2B5GB 5CBMA 5HVHA 1ZYMA 1J3LA 2AE6A 3IU2A 1OZPA 1Z4RA 3VARA 4R6TA 1R43A 5HXDA 2UV8G 4HPSA 4TJVA 2ZEHA 2WPXA 1B87A 3PFOA 4JWPA 4JD6A 1XMBA 1YVOA 3NH5A 1QSRA 4C8AA 2Z3NA 1LFWA 3H5ZA 4P4EA 4M6HA 4M6IA 2PJ5A 4RUHA 1XRYA 4KOTA 4CYQA 3FBUA 3SI2A 3BLNA 3TX8A 4UIBA 4UBRA 5AG7A 1ZO0A 2MP0A 4M6GA 3T0TA 1YLEA 4UWIA 2BL1A 2PC1A 4YN3A 1ZG7A 4KUBA 4CGMA 3TO7A 2JEWA 4R8FA 4OAEA 4BBHA 1WWZA 2B4JC 3VROA 5F9MA 5K8PA 5C88A 1KC7A 1VGYA 5JPHA 2XPPA 2OH1A 3LWUA 4MBUA 2J8RA 3S6HA 4OC4A 3TLZA 3W91A 1DTDA 3MRUA 3IJ3A 3B2YA 3D7GA 3KHZA 3WC6A 1S7KA 1YGHA 1QMUA 2O53A 2PJAA 4U9YA 2GIVA 2EWBA 3ICUA 1FBVA 4OP4A 3T90A 1JQGA 3DGVA 1X12A 3FF3A 4CAXA 2A4NA 1AMPA 2DEAA 2R1IA 4YRHA 5THWA 1VHOA 2Y1NA 3WC5A 4ZX9A 4UFXA 4R3KA 4B5OA 3TT2A 2REEA 3PB4X 3D7HA 4B11A 1IIDA 1M4LA 2GLJA 4P4FA 3DR6A 3KGQA 4GM5A 4A38A 3PT1A 3TYXA 2CNSA 1U6MA 5DS0A 3EC4A 4E0AA 3FB3A 4LUAA 2BSWA 4Q7AA 5IR2A 3GB0A 4C9EA 2C1CA 2BO9A 3PP9A 4KORA 4YGOA 1KEEB 2R8VA 4KLWA 1M44A 2WYRA 3TOBA 5F5XA 4MCSA 2ZW6A 4EMEA 4U5YA 2Q4VA 1LOKA 2QECA 2J8NA 4OMEA 2FS5A 3F0AA 1CE8B 5J8FA 4CYPA 4C68A 4KSAA 3CZXA 1P0HA 1VHSA 5HKWA 3TE4A 3C26A 5E96A 5K8MA 2NYQA 4BTFA 4R87A 2CNTA 3CXPA 4INJA 2O28A 4KSIA 4C2ZA 3H8EA 5CNPA 2IQ6A 3PB8X 1KZFA 4IF5A 3KHXA 3BUOB 4RN7A 3FVLA 1QSMA 3N5FA 4JXQA 4F8ZA 4ZGYB
chains in the Genus database with same CATH topology
4A39A 4CDJA 4JZ0A 1TKHA 4ZX8A 1Y9ZA 1VHEA 3S9NA 3V38A 1ARMA 2EK9A 4C8FA 4OIWA 3SJGA 4FUUA 2PJ9A 4IK2A 1Y0YA 4MRIA 4A94A 4R76A 3B3CA 1FNOA 2PCUA 4UEZA 4MCPA 3DLJA 4A37A 2V8DA 3FMCA 4ONWA 4UF4A 4TJXA 2ANPA 1OBRA 4JYWA 4OC5A 4F9VA 4UEFA 5D8NA 3PBBA 1Q7LA 1CPXA 4OC1A 1NSAA 2VL1A 2PVWA 3GUXA 2AFOA 1XJOA 1EE3P 3HUVA 3VH9A 4DYOA 2ZOFA 3JRUA 3D7FA 2PJBA 1IGBA 1H8LA 3D68A 4NGPA 2PE3A 4IAVA 1Z2LA 2PJ2A 2HB6A 3CT9A 1RTQA 2ZOGA 4PXCA 2QVPA 3I74A 4AXVA 3FEEA 3KR4A 5CPAA 1TF9A 3FJUA 1PYTB 3B7IA 2G9DA 4P44A 4DJLA 4CPAA 3FECA 5HVGA 1CP7A 3V7ZA 4C85A 4K3NA 2AFUA 4P10A 3FEDA 1HEEA 2ZENA 2XEJA 5HVFA 3KZWA 1BAVA 1R3NA 2CTCA 1YW4A 4EWTA 2ZELA 4C9VA 4ZY2A 1TKJA 4IHMA 4ZYQA 5JM6A 2IJZA 5LRJA 3PFEA 1DE4C 2PJ3A 4MXUA 2C6GA 1CBXA 4MHZA 3NFZA 1F57A 2PVVA 1LAPA 4MHPA 2PRQA 1YSJA 4ZY1A 1F2PA 2GU2A 3PRTA 2I3CA 4MCRA 2O4HA 2PJ1A 3RBUA 4MMOA 5ELYA 3PB6X 4TWEA 6CPAA 4NJRA 3B3SA 1TF8A 4F9UA 2CIJA 4B6ZA 2ZEPA 1ZG8A 1AYEA 1QQ9A 1IY7A 3NH4A 1KWMA 2BCOA 2V8VA 2HC9A 4NGRA 3LMSA 4WWVA 4NGMA 2XEFA 3NH8A 2V77A 2ZEOA 2C6CA 4Z65A 2ZEDA 1VIXA 4OC2A 3SJXA 1Z8LA 3D7DA 3SJEA 4H2KA 2C6PA 2ABZA 5LYLA 2ZEEA 4PXDA 2GLFA 5LYIA 4FWUA 2BOAA 3SJFA 3FH4A 1Y0RA 2QYVA 2WZNA 2Q4ZA 2RFHA 3D67A 3I6SA 4C9AA 2F8HA 1WVMA 2V8HA 4MHYA 4C8CA 5LYDA 5JH9A 2PJ4A 2OR4A 1CPSA 4YU9A 3CPAA 4FBEA 4WJBA 4P6YA 3H8GA 5J1QA 8CPAA 4P4IA 3QNVA 4KNGE 5K8OA 3ISXA 4C99A 3SI0A 4C8TA 4W9YA 1BLLE 3KASA 1CX8A 2IMOA 4ZY0A 4UIAA 2ZEMA 5IB9A 4NGSA 4G1PA 4PXBA 4R7MA 2PJCA 4X3RA 2F7VA 2PIYA 1V6CA 3ISZA 4DUKA 4NGQA 1XFOA 3KR5A 3IO1A 1LCPA 4NGTA 4YWYA 3RZAA 3WABA 5F09A 4MCQA 2J9AA 2AFMA 3K2KA 3PB9X 3SI1A 3IIBA 1XF1A 3IFEA 1BPMA 3MN8A 2POKA 2V8GA 3S9MA 5LYFA 2GP4A 3IEHA 1F2OA 3CPXA 4P45A 1BPNA 2QJ8A 3IWWA 1Z5RA 2AFWA 4P4JA 2Q43A 4PPZA 4BD9A 2AFXA 4OC3A 3BI1A 2Q51A 3KI9A 4LQGA 4C9RA 2JBJA 4C8UA 3KQXA 1FT7A 1YMEA 3EIFA 3KL9A 3BXMA 4NJQA 4MHNA 5LRGA 1YLOA 2PJ7A 3RAMA 4C86A 5JGFA 2FVGA 3K9TA 4X2TA 2OOTA 1HDQA 3HLPA 2GREA 4OKOA 4X8IA 1ZG9A 4PXEA 1TKFA 5I4MA 4O23A 3L2NA 2AFZA 4C8PA 4ZI6A 2XEIA 3H8FA 2PJ6A 3B3WA 1LAMA 1GYTA 4CDKA 7CPAA 1ZLIA 4OC0A 1ARLA 3D66A 4YN3A 5LRKA 1ELMP 1TXRA 3B3TA 3BI0A 1ELLP 1PCAA 3NA6A 3I1UA 1CP6A 3S9LA 2JBKA 4P4BA 1Y7EA 3TC8A 2CF4A 2XEGA 2EK8A 3B3VA 5K8NA 4TNUA 3WC7A 4UEEA 2ZEFA 2AFSA 2CTBA 3PBEA 2NSMA 1ZLHA 4OIDA 4C9UA 2PJ8A 3KQZA 1XBUA 3VATA 4PQAA 4C84A 2C5QA 4EFDA 3VTAA 3D4UA 2PJ0A 3FX6A 4FAIA 3T8WA 3GLJA 1UWYA 1LANA 1YW6A 3CDXA 2RB7A 1CG2A 4NGNA 4NFRA 4P4DA 3WT4A 1HDUA 3B35A 3BHXA 2PIZA 3PB7X 3PEIA 3IC1A 5D29A 2ZEGA 5CBMA 5HVHA 3VARA 5HXDA 4R6TA 1R43A 4TJVA 2ZEHA 3PFOA 1XMBA 3NH5A 4C8AA 1LFWA 4P4EA 2PJ5A 4RUHA 1XRYA 3SI2A 3TX8A 4UIBA 1ZG7A 2JEWA 4R8FA 5K8PA 1VGYA 3LWUA 4OC4A 1DTDA 3MRUA 3IJ3A 3B2YA 3D7GA 3KHZA 3WC6A 1QMUA 2O53A 2PJAA 3ICUA 2EWBA 4OP4A 1JQGA 3DGVA 3FF3A 1AMPA 2DEAA 5THWA 1VHOA 3WC5A 4ZX9A 3PB4X 3D7HA 2GLJA 1M4LA 3KGQA 4P4FA 4GM5A 4A38A 5DS0A 4Q7AA 5IR2A 3GB0A 4C9EA 2C1CA 2BO9A 2WYRA 4MCSA 4EMEA 1LOKA 4OMEA 5K8MA 2NYQA 4KSIA 3H8EA 2IQ6A 3PB8X 3KHXA 3FVLA 3N5FA 4F8ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A39 A;  4CDJ A;  4JZ0 A;  1TKH A;  4ZX8 A;  1Y9Z A;  1VHE A;  3S9N A;  3V38 A;  1ARM A;  2EK9 A;  4C8F A;  4OIW A;  3SJG A;  4FUU A;  2PJ9 A;  4IK2 A;  1Y0Y A;  4MRI A;  4A94 A;  4R76 A;  3B3C A;  1FNO A;  2PCU A;  4UEZ A;  4MCP A;  3DLJ A;  4A37 A;  2V8D A;  3FMC A;  4ONW A;  4UF4 A;  4TJX A;  2ANP A;  1OBR A;  4JYW A;  4OC5 A;  4F9V A;  4UEF A;  5D8N A;  3PBB A;  1Q7L A;  1CPX A;  4OC1 A;  1NSA A;  2VL1 A;  2PVW A;  3GUX A;  2AFO A;  1XJO A;  1EE3 P;  3HUV A;  3VH9 A;  4DYO A;  2ZOF A;  3JRU A;  3D7F A;  2PJB A;  1IGB A;  1H8L A;  3D68 A;  4NGP A;  2PE3 A;  4IAV A;  1Z2L A;  2PJ2 A;  2HB6 A;  3CT9 A;  1RTQ A;  2ZOG A;  4PXC A;  2QVP A;  3I74 A;  4AXV A;  3FEE A;  3KR4 A;  5CPA A;  1TF9 A;  3FJU A;  1PYT B;  3B7I A;  2G9D A;  4P44 A;  4DJL A;  4CPA A;  3FEC A;  5HVG A;  1CP7 A;  3V7Z A;  4C85 A;  4K3N A;  2AFU A;  4P10 A;  3FED A;  1HEE A;  2ZEN A;  2XEJ A;  5HVF A;  3KZW A;  1BAV A;  1R3N A;  2CTC A;  1YW4 A;  4EWT A;  2ZEL A;  4C9V A;  4ZY2 A;  1TKJ A;  4IHM A;  4ZYQ A;  5JM6 A;  2IJZ A;  5LRJ A;  3PFE A;  1DE4 C;  2PJ3 A;  4MXU A;  2C6G A;  1CBX A;  4MHZ A;  3NFZ A;  1F57 A;  2PVV A;  1LAP A;  4MHP A;  2PRQ A;  1YSJ A;  4ZY1 A;  1F2P A;  2GU2 A;  3PRT A;  2I3C A;  4MCR A;  2O4H A;  2PJ1 A;  3RBU A;  4MMO A;  5ELY A;  3PB6 X;  4TWE A;  6CPA A;  4NJR A;  3B3S A;  1TF8 A;  4F9U A;  2CIJ A;  4B6Z A;  2ZEP A;  1ZG8 A;  1AYE A;  1QQ9 A;  1IY7 A;  3NH4 A;  1KWM A;  2BCO A;  2V8V A;  2HC9 A;  4NGR A;  3LMS A;  4WWV A;  4NGM A;  2XEF A;  3NH8 A;  2V77 A;  2ZEO A;  2C6C A;  4Z65 A;  2ZED A;  1VIX A;  4OC2 A;  3SJX A;  1Z8L A;  3D7D A;  3SJE A;  4H2K A;  2C6P A;  2ABZ A;  5LYL A;  2ZEE A;  4PXD A;  2GLF A;  5LYI A;  4FWU A;  2BOA A;  3SJF A;  3FH4 A;  1Y0R A;  2QYV A;  2WZN A;  2Q4Z A;  2RFH A;  3D67 A;  3I6S A;  4C9A A;  2F8H A;  1WVM A;  2V8H A;  4MHY A;  4C8C A;  5LYD A;  5JH9 A;  2PJ4 A;  2OR4 A;  1CPS A;  4YU9 A;  3CPA A;  4FBE A;  4WJB A;  4P6Y A;  3H8G A;  5J1Q A;  8CPA A;  4P4I A;  3QNV A;  4KNG E;  5K8O A;  3ISX A;  4C99 A;  3SI0 A;  4C8T A;  4W9Y A;  1BLL E;  3KAS A;  1CX8 A;  2IMO A;  4ZY0 A;  4UIA A;  2ZEM A;  5IB9 A;  4NGS A;  4G1P A;  4PXB A;  4R7M A;  2PJC A;  4X3R A;  2F7V A;  2PIY A;  1V6C A;  3ISZ A;  4DUK A;  4NGQ A;  1XFO A;  3KR5 A;  3IO1 A;  1LCP A;  4NGT A;  4YWY A;  3RZA A;  3WAB A;  5F09 A;  4MCQ A;  2J9A A;  2AFM A;  3K2K A;  3PB9 X;  3SI1 A;  3IIB A;  1XF1 A;  3IFE A;  1BPM A;  3MN8 A;  2POK A;  2V8G A;  3S9M A;  5LYF A;  3IEH A;  1F2O A;  3CPX A;  4P45 A;  1BPN A;  2QJ8 A;  3IWW A;  1Z5R A;  2AFW A;  4P4J A;  2Q43 A;  4PPZ A;  4BD9 A;  2AFX A;  4OC3 A;  3BI1 A;  2Q51 A;  3KI9 A;  4LQG A;  4C9R A;  2JBJ A;  4C8U A;  3KQX A;  1FT7 A;  1YME A;  3EIF A;  3KL9 A;  3BXM A;  4NJQ A;  4MHN A;  5LRG A;  1YLO A;  2PJ7 A;  3RAM A;  4C86 A;  5JGF A;  2FVG A;  3K9T A;  4X2T A;  2OOT A;  1HDQ A;  3HLP A;  2GRE A;  4OKO A;  4X8I A;  1ZG9 A;  4PXE A;  1TKF A;  5I4M A;  4O23 A;  3L2N A;  2AFZ A;  4C8P A;  4ZI6 A;  2XEI A;  3H8F A;  2PJ6 A;  3B3W A;  1LAM A;  1GYT A;  4CDK A;  7CPA A;  1ZLI A;  4OC0 A;  1ARL A;  3D66 A;  4YN3 A;  5LRK A;  1ELM P;  1TXR A;  3B3T A;  3BI0 A;  1ELL P;  1PCA A;  3NA6 A;  3I1U A;  1CP6 A;  3S9L A;  2JBK A;  4P4B A;  1Y7E A;  3TC8 A;  2CF4 A;  2XEG A;  2EK8 A;  3B3V A;  5K8N A;  4TNU A;  3WC7 A;  4UEE A;  2ZEF A;  2AFS A;  2CTB A;  3PBE A;  2NSM A;  1ZLH A;  4OID A;  4C9U A;  2PJ8 A;  3KQZ A;  1XBU A;  3VAT A;  4PQA A;  4C84 A;  4EFD A;  3VTA A;  3D4U A;  2PJ0 A;  3FX6 A;  4FAI A;  3T8W A;  3GLJ A;  1UWY A;  1LAN A;  1YW6 A;  3CDX A;  2RB7 A;  1CG2 A;  4NGN A;  4NFR A;  4P4D A;  3WT4 A;  1HDU A;  3B35 A;  3BHX A;  2PIZ A;  3PB7 X;  3PEI A;  3IC1 A;  5D29 A;  2ZEG A;  5CBM A;  5HVH A;  3VAR A;  5HXD A;  4R6T A;  1R43 A;  4TJV A;  2ZEH A;  3PFO A;  1XMB A;  3NH5 A;  4C8A A;  1LFW A;  4P4E A;  2PJ5 A;  4RUH A;  1XRY A;  3SI2 A;  3TX8 A;  4UIB A;  1ZG7 A;  2JEW A;  4R8F A;  5K8P A;  1VGY A;  3LWU A;  4OC4 A;  1DTD A;  3MRU A;  3IJ3 A;  3B2Y A;  3D7G A;  3KHZ A;  3WC6 A;  1QMU A;  2O53 A;  2PJA A;  3ICU A;  2EWB A;  4OP4 A;  1JQG A;  3DGV A;  3FF3 A;  1AMP A;  2DEA A;  5THW A;  1VHO A;  3WC5 A;  4ZX9 A;  3PB4 X;  3D7H A;  2GLJ A;  1M4L A;  3KGQ A;  4P4F A;  4GM5 A;  4A38 A;  5DS0 A;  4Q7A A;  3GB0 A;  4C9E A;  2C1C A;  2BO9 A;  2WYR A;  4MCS A;  4EME A;  1LOK A;  4OME A;  5K8M A;  2NYQ A;  4KSI A;  3H8E A;  2IQ6 A;  3PB8 X;  3KHX A;  3FVL A;  3N5F A;  4F8Z A; 
#chains in the Genus database with same CATH topology
 2IL4 A;  4IUS A;  4A39 A;  4JZ0 A;  1TKH A;  2GAN A;  4ZX8 A;  5KTD A;  4II9 A;  1Y9Z A;  3F8K A;  2DIK A;  1VHE A;  1JWQ A;  2PR8 A;  3S9N A;  1SQH A;  2Z10 A;  4B5P A;  3V38 A;  3PGP A;  1ARM A;  2EK9 A;  2JLM A;  4C2X A;  1NBW A;  2PCN A;  4C8F A;  2FIA A;  2OZU A;  4OIW A;  2DF5 A;  4KSF A;  1ZL0 A;  3SJG A;  4FUU A;  2PJ9 A;  4IK2 A;  2HQY A;  2PR1 A;  1Y0Y A;  2EVN A;  4AVB A;  4MRI A;  2ZW7 A;  4A94 A;  4R76 A;  2Y0M A;  1FNO A;  2PCU A;  3B3C A;  1XOV A;  2B4B A;  3CXS A;  4UEZ A;  4MCP A;  1UFH A;  2CBL A;  3DLJ A;  3FIX A;  2V8D A;  3FMC A;  3P2F A;  4ONW A;  4A37 A;  4UF4 A;  3K4I A;  4TJX A;  4R9M A;  1MJ9 A;  1OBR A;  4JYW A;  2ANP A;  2OU2 A;  1IU8 A;  4FD4 A;  3D8P A;  4KVO E;  4OC5 A;  2I79 A;  2G0B A;  4NEX A;  4UEF A;  4F9V A;  3EFA A;  1YR0 A;  3G23 A;  2I00 A;  3PBB A;  1Q7L A;  4BPU B;  1Q2C A;  5D8N A;  5G21 A;  1CPX A;  3OP0 A;  1Q2D A;  4CO9 A;  4KOV A;  4OC1 A;  5F13 A;  4E8O A;  1NSA A;  2FXF A;  2PVW A;  2VL1 A;  5HMN A;  3GUX A;  2AFO A;  2ZXV A;  1XJO A;  1EE3 P;  3HUV A;  1QSO A;  4H6U A;  3VH9 A;  2ZOF A;  3JRU A;  3D7F A;  4LX9 A;  1IIC A;  4DYO A;  2PJB A;  4ONU A;  1JDB C;  1PU9 A;  2WPW A;  1IGB A;  1IOI A;  1H8L A;  4MFK A;  3D68 A;  4NGP A;  5J8C A;  2PE3 A;  4M8D A;  4IAV A;  1Z2L A;  2PJ2 A;  4CDJ A;  1M4G A;  2HB6 A;  4KVM E;  4Q36 A;  3CT9 A;  1A9X B;  4PSW A;  1RTQ A;  3TFY A;  1NE9 A;  2ZOG A;  1XMT A;  4PXC A;  4AB7 A;  2QVP A;  3FYN A;  2OZH A;  3OAK A;  1I1D A;  2Q0Y A;  4CGO A;  3I74 A;  4AXV A;  3FEE A;  5K99 A;  2FSR A;  2EZC A;  3TLE A;  2BUE A;  3KR4 A;  5CPA A;  1TF9 A;  3FJU A;  1PYT B;  3B7I A;  2G9D A;  3S6K A;  4P44 A;  4DJL A;  2Z11 A;  5EC4 A;  1YK3 A;  2Q7B A;  2X0S A;  1CM0 A;  1S3Z A;  4C7H A;  1XEB A;  3F5B A;  1Z4E A;  1EO0 A;  4ORF A;  5GCN A;  3SHP A;  1MK4 A;  4PK3 A;  2D4P A;  3FEC A;  4M3S A;  4CPA A;  5HVG A;  1CP7 A;  3DR8 A;  5F1Y A;  2VKZ G;  3S6F A;  2YNC C;  4L89 A;  2HV2 A;  2RC4 A;  3V7Z A;  1VI4 A;  4B12 A;  2D4O A;  1PUA A;  4MI1 A;  4C85 A;  4K3N A;  2AFU A;  1CJW A;  4B5P B;  4QBJ A;  4P10 A;  3VRP A;  3FED A;  1HEE A;  2ZEN A;  3N7Z A;  2XEJ A;  2DLA A;  4J3G A;  5HVF A;  3T07 A;  2VXK A;  1XE4 A;  3KZW A;  1BAV A;  1R3N A;  3R96 A;  4KOS A;  2ZW4 A;  3R9F A;  5IV0 A;  2E28 A;  4B10 A;  2JDD A;  2CTC A;  1YW4 A;  2P6F A;  4EWT A;  3VGO A;  2ZEL A;  2EZB A;  4JXR A;  2YJT A;  3JTK A;  4C9V A;  3TLG B;  4ZY2 A;  4QVT A;  1TKJ A;  4IHM A;  4MI4 A;  1TIQ A;  5G20 A;  4A32 A;  4B14 A;  4ZYQ A;  4HNY B;  2D0O A;  2VZZ A;  3C8O A;  3BUW B;  3EZE A;  5JM6 A;  1LRZ A;  3D2P A;  4CS0 B;  3HPG G;  5F46 A;  3E0K A;  3EY5 A;  5A28 A;  2QIR A;  1BOB A;  2IJZ A;  3EZA A;  1QST A;  4MFQ A;  3VWD A;  5LRJ A;  2XPN A;  1Y9W A;  3PFE A;  2N3A B;  4GXH A;  1YQE A;  2AJ6 A;  1DE4 C;  2G3T A;  2QML A;  2PJ3 A;  1YX0 A;  3GY9 A;  4MXU A;  1NSL A;  4A33 A;  4LQ6 A;  4XNH C;  2C6G A;  1CBX A;  4XNH B;  4MHZ A;  4CYN A;  3NFZ A;  1F57 A;  2PVV A;  2NMT A;  5AG6 A;  1LAP A;  3R1K A;  4MHP A;  4UCP A;  1C30 B;  2Y1M A;  2PRQ A;  4CRY B;  1ZRS A;  3JVN A;  1YSJ A;  4ZY1 A;  3TCV A;  5KTA A;  1F2P A;  1Q2Y A;  2GU2 A;  2I3C A;  3FXT A;  3PRT A;  4MCR A;  2O4H A;  1Y9K A;  2PJ1 A;  3P2H A;  1GHE A;  3RBU A;  4MMO A;  5AXI A;  5ELY A;  5HH1 A;  2F5I A;  3PB6 X;  4JJX A;  1V0C A;  2VI7 A;  4TWE A;  5FD8 A;  6CPA A;  4NJR A;  3B3S A;  4KOX A;  1TF8 A;  2B3U A;  4R57 A;  2HI6 A;  4H6Z A;  4HKF A;  2PQ8 A;  4COG A;  3GYA A;  4BPX B;  5AG5 A;  1KUY A;  2CIJ A;  4B6Z A;  4F9U A;  2WSA A;  2ZEP A;  2C27 A;  1ZG8 A;  3NE8 A;  1AYE A;  1QQ9 A;  3KKW A;  1IY7 A;  3NH4 A;  1KWM A;  2BCO A;  2V8V A;  2YND A;  2HC9 A;  5I0C A;  4NGR A;  3B8G A;  3ZNI A;  4AG9 A;  3OB1 B;  3LMS A;  5G1Z A;  4WWV A;  3ZZI A;  4NGM A;  5FVJ A;  1P4N A;  2XEF A;  2J8M A;  2B5G A;  2XPL A;  2Q04 A;  2FT0 A;  2V77 A;  2ZEO A;  3IGR A;  3NH8 A;  3QB8 A;  4MFJ A;  1VBH A;  2C6C A;  3DNS A;  4CAV A;  5DWN A;  2B58 A;  4Z65 A;  2ZED A;  1VIX A;  5DWM A;  2K5T A;  4OC2 A;  3SJX A;  5F47 A;  4UFW A;  2R98 A;  4IIX A;  3JUW A;  3BUN B;  1Z8L A;  3D7D A;  3SJE A;  1S5K A;  3KRV A;  1IYK A;  3NOJ A;  4A2Z A;  3O8Z A;  1X10 A;  4H2K A;  3VRR A;  1VBG A;  3T5M A;  2C6P A;  3HMJ G;  2CXA A;  2ABZ A;  1WJT A;  1M6V B;  5LYL A;  4A4B A;  2ZEE A;  3IU1 A;  4PXD A;  2GLF A;  4CGL A;  3T9Y A;  1J4J A;  4QC6 A;  4EYS A;  1FY7 A;  1KUV A;  5LYI A;  1DIK A;  4XPK A;  2HWG A;  4JVO A;  1KUX A;  3TLY A;  3HPH E;  1Y7R A;  4FWU A;  2Z3O A;  2JDC A;  2REF A;  4M85 A;  5EBV A;  2BOA A;  1AUG A;  2FIW A;  2D0P A;  3SJF A;  4PSX A;  3FH4 A;  1Y0R A;  2QYV A;  3GJZ A;  3EZB A;  4A4C A;  2WZN A;  1M1D A;  2AUM A;  3TLC A;  2Q4Z A;  2ODF A;  2RFH A;  3D67 A;  4PK2 A;  3I6S A;  4CYO A;  2EO8 A;  1Q5X A;  1B47 A;  2F8H A;  2P6G A;  4C9A A;  1YRE A;  2FE7 A;  2R7H A;  1WVM A;  2V8H A;  4MHY A;  4C8C A;  5LYD A;  1EZB A;  5JH9 A;  2PJ4 A;  1L0C A;  5KTC A;  2OR4 A;  4J0N A;  1CPS A;  2OZG A;  4YU9 A;  4E2A A;  4Q38 A;  3CPA A;  4FBE A;  4WJB A;  5EMI A;  3RYO A;  4P6Y A;  3SXO A;  2ATR A;  3H8G A;  4BPW B;  1I12 A;  2WUU A;  4FD5 A;  3K9U A;  4MFZ A;  4CRZ B;  8CPA A;  4HNW B;  5J1Q A;  4MFL A;  4AVA A;  1QSN A;  4P4I A;  1NMT A;  3QNV A;  4KOW A;  4KNG E;  3S6G A;  4Y49 C;  5K8O A;  3ISX A;  4A30 A;  2OLS A;  4C99 A;  1C3O B;  1RXT A;  3SI0 A;  4W9Y A;  1BLL E;  4QUS A;  4C8T A;  3KAS A;  3BUM B;  4XPD C;  5AGE A;  1CX8 A;  2IMO A;  4XPD B;  4C7I A;  4C2Y A;  2CY2 A;  4ZY0 A;  3TLA A;  4UIA A;  2R82 A;  1M4D A;  2G3A A;  3MGD A;  2Z3M A;  4CGN A;  4COB A;  2DPS A;  1T36 B;  2ZEM A;  5IB9 A;  4E5S A;  4NGS A;  4G1P A;  2Q4Y A;  3QAH A;  4PV6 A;  5HKZ A;  4K30 A;  3R95 A;  2DPT A;  4OAD A;  4PXB A;  3UY5 A;  3WR7 A;  4R7M A;  2PJC A;  4UFV A;  2YNE A;  4X3R A;  2PDO A;  3RNZ A;  2F7V A;  2P0W A;  2PIY A;  2B3V A;  4HNX B;  1Z9U A;  4KLV A;  1V6C A;  1YVH A;  3ISZ A;  4R3L A;  4JLY A;  4U9Z A;  2JEV A;  4DUK A;  4NGQ A;  1XFO A;  3IO1 A;  3KR5 A;  4AVC A;  1LCP A;  5IX3 A;  2BEI A;  4NGT A;  4CAW A;  2Z0Z A;  4YWY A;  1S7N A;  2Z3K A;  1IOF A;  1A2Z A;  3CXQ A;  5IB0 A;  3RZA A;  3WAB A;  2PSW A;  5F09 A;  2EZA A;  4MCQ A;  2J9A A;  1K4J A;  2AFM A;  3K2K A;  5A27 A;  3ZJ0 A;  4H1H A;  1R61 A;  3PB9 X;  5JVL A;  3SI1 A;  4CZ1 A;  4A95 A;  5C82 A;  3IIB A;  1S60 A;  1XF1 A;  1BO4 A;  3IFE A;  3VWE A;  1BPM A;  3VRN A;  3TLB A;  2GFQ A;  2DXQ A;  1KBL A;  3MN8 A;  1N71 A;  3EXN A;  2HUZ A;  2POK A;  2V8G A;  3S9M A;  3RO0 A;  5LYF A;  2GP4 A;  2Z3P A;  5F48 A;  4XPL A;  2ZW5 A;  5H84 A;  3IEH A;  4BIN A;  1F2O A;  3CPX A;  2YJV A;  4P45 A;  2HRO A;  1BPN A;  3R9E A;  3IWG A;  2QJ8 A;  3IWW A;  3LOD A;  1Z5R A;  2AFW A;  4P4J A;  2Q43 A;  4KOY A;  5G22 A;  4ZBG A;  4PPZ A;  4B13 A;  5AG4 A;  4BD9 A;  2AFX A;  3OWC A;  4OC3 A;  3T05 A;  3BI1 A;  2Q44 A;  3GIU A;  4RS2 A;  1ON0 A;  2CNM A;  2VBQ A;  2YGW A;  4IIY A;  1RO5 A;  3I9S A;  2Q51 A;  2Z3L A;  2KCW A;  4YFJ A;  3KI9 A;  3BUX B;  4LQG A;  4X5K A;  1GGO A;  2JBJ A;  4C9R A;  2ARH A;  4C8U A;  4BMH A;  3KQX A;  1FT7 A;  1YME A;  3EIF A;  3GKR A;  2GE3 A;  4F0Y A;  3KL9 A;  3BXM A;  4NJQ A;  4MHN A;  2B4D A;  4NXY A;  4L8A A;  4UCN A;  4UWJ A;  1Z8W A;  4NSQ A;  4GS4 A;  4UA3 A;  1BXR B;  5LRG A;  1YLO A;  2PJ7 A;  3RAM A;  3TO9 A;  4C86 A;  3U1B A;  4MJ8 A;  2FVG A;  5JGF A;  4QB9 A;  1NXJ A;  3DDD A;  3K9T A;  5J3X A;  3G8W A;  4X2T A;  2EUI A;  5HKY A;  1B6B A;  4CAE A;  3FNC A;  2OOT A;  1HDQ A;  3HLP A;  3LAC A;  4KZT A;  2GRE A;  4OKO A;  4KOU A;  4RI1 A;  2Q7S A;  3U88 C;  1ZG9 A;  4PXE A;  1TKF A;  4X8I A;  5F49 A;  4DNC A;  5I4M A;  3I3G A;  2X7B A;  3L2N A;  3NE7 A;  4O23 A;  2AFZ A;  4C8P A;  2FL4 A;  2VZY A;  1CS0 B;  4ZI6 A;  4EVY A;  2XEI A;  3H8F A;  1Z9E A;  2PJ6 A;  5H86 A;  2FCK A;  2OB0 A;  3B3W A;  2YNC A;  1LAM A;  1GYT A;  4CDK A;  7CPA A;  2FM4 A;  3PLF B;  1ZLI A;  4OC0 A;  1ARL A;  3BJ8 A;  3D66 A;  3VRQ A;  2P6E A;  3FRM A;  1IYL A;  4KS9 A;  3W6S A;  4GPL B;  4CAF A;  3IWE A;  1I21 A;  1XF8 A;  4MHD A;  5LRK A;  1ELM P;  1TXR A;  4I49 A;  1Z8T A;  1S7F A;  3B3T A;  3QAY A;  4KVX A;  4AG7 A;  3BI0 A;  1ELL P;  3SXN A;  1PCA A;  1MJB A;  1VKC A;  3NA6 A;  3I1U A;  1CP6 A;  3TLG A;  3S9L A;  2JBK A;  4P4B A;  4A31 A;  5JQ4 A;  2ZPA A;  4H89 A;  4RR2 B;  1Y7E A;  4MFP A;  3TC8 A;  2B0A A;  2CF4 A;  1MJA A;  2XEG A;  3W6X A;  2EK8 A;  3TOA A;  3TO6 A;  3NFQ A;  1M4I A;  3B3V A;  3G3S A;  4NCZ A;  4TNU A;  3WC7 A;  5K8N A;  5ISV A;  3OB2 B;  3DSB A;  2ZEF A;  4UEE A;  2AFS A;  4OLL A;  1EZA A;  2CTB A;  4FD7 A;  3BJ7 A;  3PBE A;  1JDE A;  2NSM A;  3EO4 A;  3SR3 A;  1ZLH A;  4OID A;  4MJX A;  5JYB A;  4C9U A;  2PJ8 A;  3KQZ A;  1XBU A;  3VAT A;  2XPO A;  4PQA A;  3TTH A;  5BWA B;  2C5Q A;  4C84 A;  3PZJ A;  3D3S A;  4EFD A;  3VTA A;  3D4U A;  2PJ0 A;  3FX6 A;  4FAI A;  2H5M A;  3T8W A;  3GLJ A;  1UWY A;  2EBJ A;  3D2M A;  2AUN A;  1WK4 A;  4CGP A;  1LAN A;  1YW6 A;  2VQY A;  4UCM A;  3H4Q A;  4E94 A;  2VEZ A;  3CDX A;  2RB7 A;  4Y49 B;  5BY0 A;  1CG2 A;  3F9K C;  1Z8X A;  4NF1 A;  1R57 A;  4F0X A;  3PFV A;  4NGN A;  1S7L A;  4KUA A;  4NFR A;  2PRB A;  3V8I A;  4P4D A;  1YVK A;  2B4D B;  3LD2 A;  3WT4 A;  1HDU A;  3B35 A;  3A9L A;  3BHX A;  2PIZ A;  3PB7 X;  3PEI A;  4FD6 A;  4MY0 A;  4F6A A;  4MY3 A;  3IC1 A;  5D29 A;  2ZEG A;  3R9G A;  1XIX A;  1IB1 E;  2B5G B;  5CBM A;  5HVH A;  1ZYM A;  1J3L A;  2AE6 A;  3IU2 A;  1OZP A;  1Z4R A;  3VAR A;  4R6T A;  1R43 A;  5HXD A;  2UV8 G;  4HPS A;  4TJV A;  2ZEH A;  2WPX A;  1B87 A;  3PFO A;  4JWP A;  4JD6 A;  1XMB A;  1YVO A;  3NH5 A;  1QSR A;  4C8A A;  2Z3N A;  1LFW A;  3H5Z A;  4P4E A;  4M6H A;  4M6I A;  2PJ5 A;  4RUH A;  1XRY A;  4KOT A;  4CYQ A;  3FBU A;  3SI2 A;  3BLN A;  3TX8 A;  4UIB A;  4UBR A;  5AG7 A;  1ZO0 A;  2MP0 A;  4M6G A;  3T0T A;  1YLE A;  4UWI A;  2BL1 A;  2PC1 A;  4YN3 A;  1ZG7 A;  4KUB A;  4CGM A;  3TO7 A;  2JEW A;  4R8F A;  4OAE A;  4BBH A;  1WWZ A;  2B4J C;  3VRO A;  5F9M A;  5K8P A;  5C88 A;  1KC7 A;  1VGY A;  5JPH A;  2XPP A;  2OH1 A;  3LWU A;  4MBU A;  2J8R A;  3S6H A;  4OC4 A;  3TLZ A;  3W91 A;  1DTD A;  3MRU A;  3IJ3 A;  3B2Y A;  3D7G A;  3KHZ A;  3WC6 A;  1S7K A;  1YGH A;  1QMU A;  2O53 A;  2PJA A;  4U9Y A;  2GIV A;  2EWB A;  3ICU A;  1FBV A;  4OP4 A;  3T90 A;  1JQG A;  3DGV A;  1X12 A;  3FF3 A;  4CAX A;  2A4N A;  1AMP A;  2DEA A;  2R1I A;  4YRH A;  5THW A;  1VHO A;  2Y1N A;  3WC5 A;  4ZX9 A;  4UFX A;  4R3K A;  4B5O A;  3TT2 A;  2REE A;  3PB4 X;  3D7H A;  4B11 A;  1IID A;  1M4L A;  2GLJ A;  4P4F A;  3DR6 A;  3KGQ A;  4GM5 A;  4A38 A;  3PT1 A;  3TYX A;  2CNS A;  1U6M A;  5DS0 A;  3EC4 A;  4E0A A;  3FB3 A;  4LUA A;  2BSW A;  4Q7A A;  5IR2 A;  3GB0 A;  4C9E A;  2C1C A;  2BO9 A;  3PP9 A;  4KOR A;  4YGO A;  1KEE B;  2R8V A;  4KLW A;  1M44 A;  2WYR A;  3TOB A;  5F5X A;  4MCS A;  2ZW6 A;  4EME A;  4U5Y A;  2Q4V A;  1LOK A;  2QEC A;  2J8N A;  4OME A;  2FS5 A;  3F0A A;  1CE8 B;  5J8F A;  4CYP A;  4C68 A;  4KSA A;  3CZX A;  1P0H A;  1VHS A;  5HKW A;  3TE4 A;  3C26 A;  5E96 A;  5K8M A;  2NYQ A;  4BTF A;  4R87 A;  2CNT A;  3CXP A;  4INJ A;  2O28 A;  4KSI A;  4C2Z A;  3H8E A;  5CNP A;  2IQ6 A;  3PB8 X;  1KZF A;  4IF5 A;  3KHX A;  3BUO B;  4RN7 A;  3FVL A;  1QSM A;  3N5F A;  4JXQ A;  4F8Z A;  4ZGY B; 
#chains in the Genus database with same CATH homology
 4A39 A;  4CDJ A;  4JZ0 A;  1TKH A;  4ZX8 A;  1Y9Z A;  1VHE A;  3S9N A;  3V38 A;  1ARM A;  2EK9 A;  4C8F A;  4OIW A;  3SJG A;  4FUU A;  2PJ9 A;  4IK2 A;  1Y0Y A;  4MRI A;  4A94 A;  4R76 A;  3B3C A;  1FNO A;  2PCU A;  4UEZ A;  4MCP A;  3DLJ A;  4A37 A;  2V8D A;  3FMC A;  4ONW A;  4UF4 A;  4TJX A;  2ANP A;  1OBR A;  4JYW A;  4OC5 A;  4F9V A;  4UEF A;  5D8N A;  3PBB A;  1Q7L A;  1CPX A;  4OC1 A;  1NSA A;  2VL1 A;  2PVW A;  3GUX A;  2AFO A;  1XJO A;  1EE3 P;  3HUV A;  3VH9 A;  4DYO A;  2ZOF A;  3JRU A;  3D7F A;  2PJB A;  1IGB A;  1H8L A;  3D68 A;  4NGP A;  2PE3 A;  4IAV A;  1Z2L A;  2PJ2 A;  2HB6 A;  3CT9 A;  1RTQ A;  2ZOG A;  4PXC A;  2QVP A;  3I74 A;  4AXV A;  3FEE A;  3KR4 A;  5CPA A;  1TF9 A;  3FJU A;  1PYT B;  3B7I A;  2G9D A;  4P44 A;  4DJL A;  4CPA A;  3FEC A;  5HVG A;  1CP7 A;  3V7Z A;  4C85 A;  4K3N A;  2AFU A;  4P10 A;  3FED A;  1HEE A;  2ZEN A;  2XEJ A;  5HVF A;  3KZW A;  1BAV A;  1R3N A;  2CTC A;  1YW4 A;  4EWT A;  2ZEL A;  4C9V A;  4ZY2 A;  1TKJ A;  4IHM A;  4ZYQ A;  5JM6 A;  2IJZ A;  5LRJ A;  3PFE A;  1DE4 C;  2PJ3 A;  4MXU A;  2C6G A;  1CBX A;  4MHZ A;  3NFZ A;  1F57 A;  2PVV A;  1LAP A;  4MHP A;  2PRQ A;  1YSJ A;  4ZY1 A;  1F2P A;  2GU2 A;  3PRT A;  2I3C A;  4MCR A;  2O4H A;  2PJ1 A;  3RBU A;  4MMO A;  5ELY A;  3PB6 X;  4TWE A;  6CPA A;  4NJR A;  3B3S A;  1TF8 A;  4F9U A;  2CIJ A;  4B6Z A;  2ZEP A;  1ZG8 A;  1AYE A;  1QQ9 A;  1IY7 A;  3NH4 A;  1KWM A;  2BCO A;  2V8V A;  2HC9 A;  4NGR A;  3LMS A;  4WWV A;  4NGM A;  2XEF A;  3NH8 A;  2V77 A;  2ZEO A;  2C6C A;  4Z65 A;  2ZED A;  1VIX A;  4OC2 A;  3SJX A;  1Z8L A;  3D7D A;  3SJE A;  4H2K A;  2C6P A;  2ABZ A;  5LYL A;  2ZEE A;  4PXD A;  2GLF A;  5LYI A;  4FWU A;  2BOA A;  3SJF A;  3FH4 A;  1Y0R A;  2QYV A;  2WZN A;  2Q4Z A;  2RFH A;  3D67 A;  3I6S A;  4C9A A;  2F8H A;  1WVM A;  2V8H A;  4MHY A;  4C8C A;  5LYD A;  5JH9 A;  2PJ4 A;  2OR4 A;  1CPS A;  4YU9 A;  3CPA A;  4FBE A;  4WJB A;  4P6Y A;  3H8G A;  5J1Q A;  8CPA A;  4P4I A;  3QNV A;  4KNG E;  5K8O A;  3ISX A;  4C99 A;  3SI0 A;  4C8T A;  4W9Y A;  1BLL E;  3KAS A;  1CX8 A;  2IMO A;  4ZY0 A;  4UIA A;  2ZEM A;  5IB9 A;  4NGS A;  4G1P A;  4PXB A;  4R7M A;  2PJC A;  4X3R A;  2F7V A;  2PIY A;  1V6C A;  3ISZ A;  4DUK A;  4NGQ A;  1XFO A;  3KR5 A;  3IO1 A;  1LCP A;  4NGT A;  4YWY A;  3RZA A;  3WAB A;  5F09 A;  4MCQ A;  2J9A A;  2AFM A;  3K2K A;  3PB9 X;  3SI1 A;  3IIB A;  1XF1 A;  3IFE A;  1BPM A;  3MN8 A;  2POK A;  2V8G A;  3S9M A;  5LYF A;  2GP4 A;  3IEH A;  1F2O A;  3CPX A;  4P45 A;  1BPN A;  2QJ8 A;  3IWW A;  1Z5R A;  2AFW A;  4P4J A;  2Q43 A;  4PPZ A;  4BD9 A;  2AFX A;  4OC3 A;  3BI1 A;  2Q51 A;  3KI9 A;  4LQG A;  4C9R A;  2JBJ A;  4C8U A;  3KQX A;  1FT7 A;  1YME A;  3EIF A;  3KL9 A;  3BXM A;  4NJQ A;  4MHN A;  5LRG A;  1YLO A;  2PJ7 A;  3RAM A;  4C86 A;  5JGF A;  2FVG A;  3K9T A;  4X2T A;  2OOT A;  1HDQ A;  3HLP A;  2GRE A;  4OKO A;  4X8I A;  1ZG9 A;  4PXE A;  1TKF A;  5I4M A;  4O23 A;  3L2N A;  2AFZ A;  4C8P A;  4ZI6 A;  2XEI A;  3H8F A;  2PJ6 A;  3B3W A;  1LAM A;  1GYT A;  4CDK A;  7CPA A;  1ZLI A;  4OC0 A;  1ARL A;  3D66 A;  4YN3 A;  5LRK A;  1ELM P;  1TXR A;  3B3T A;  3BI0 A;  1ELL P;  1PCA A;  3NA6 A;  3I1U A;  1CP6 A;  3S9L A;  2JBK A;  4P4B A;  1Y7E A;  3TC8 A;  2CF4 A;  2XEG A;  2EK8 A;  3B3V A;  5K8N A;  4TNU A;  3WC7 A;  4UEE A;  2ZEF A;  2AFS A;  2CTB A;  3PBE A;  2NSM A;  1ZLH A;  4OID A;  4C9U A;  2PJ8 A;  3KQZ A;  1XBU A;  3VAT A;  4PQA A;  4C84 A;  2C5Q A;  4EFD A;  3VTA A;  3D4U A;  2PJ0 A;  3FX6 A;  4FAI A;  3T8W A;  3GLJ A;  1UWY A;  1LAN A;  1YW6 A;  3CDX A;  2RB7 A;  1CG2 A;  4NGN A;  4NFR A;  4P4D A;  3WT4 A;  1HDU A;  3B35 A;  3BHX A;  2PIZ A;  3PB7 X;  3PEI A;  3IC1 A;  5D29 A;  2ZEG A;  5CBM A;  5HVH A;  3VAR A;  5HXD A;  4R6T A;  1R43 A;  4TJV A;  2ZEH A;  3PFO A;  1XMB A;  3NH5 A;  4C8A A;  1LFW A;  4P4E A;  2PJ5 A;  4RUH A;  1XRY A;  3SI2 A;  3TX8 A;  4UIB A;  1ZG7 A;  2JEW A;  4R8F A;  5K8P A;  1VGY A;  3LWU A;  4OC4 A;  1DTD A;  3MRU A;  3IJ3 A;  3B2Y A;  3D7G A;  3KHZ A;  3WC6 A;  1QMU A;  2O53 A;  2PJA A;  3ICU A;  2EWB A;  4OP4 A;  1JQG A;  3DGV A;  3FF3 A;  1AMP A;  2DEA A;  5THW A;  1VHO A;  3WC5 A;  4ZX9 A;  3PB4 X;  3D7H A;  2GLJ A;  1M4L A;  3KGQ A;  4P4F A;  4GM5 A;  4A38 A;  5DS0 A;  4Q7A A;  5IR2 A;  3GB0 A;  4C9E A;  2C1C A;  2BO9 A;  2WYR A;  4MCS A;  4EME A;  1LOK A;  4OME A;  5K8M A;  2NYQ A;  4KSI A;  3H8E A;  2IQ6 A;  3PB8 X;  3KHX A;  3FVL A;  3N5F A;  4F8Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...