4NGPA

Crystal structure of glutamate carboxypeptidase ii in a complex with urea-based inhibitor
Total Genus 262
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
262
sequence length
696
structure length
695
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Rational design of urea-based glutamate carboxypeptidase II (GCPII) inhibitors as versatile tools for specific drug targeting and delivery
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 262
structure length 695
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4ngpA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4ngpA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4ngpA02
3BHXA 4FUUA 5LYIA 4P4FA 3H8EA 5LRGA 1WVMA 4ZYQA 1LFWA 3QNVA 1IY7A 1H8LA 1TKHA 5JH9A 2AFOA 3BXMA 5HVFA 3I74A 4ZX8A 4ZI6A 8CPAA 2ZELA 3KASA 2HC9A 5JM6A 4B6ZA 3IEHA 3D7HA 1TF9A 4C85A 4AXVA 4IK2A 4OIDA 4X3RA 4H2KA 3B3TA 1UWYA 2V8HA 4MCSA 4ONWA 4CDJA 2GLJA 4W9YA 2GU2A 4A38A 3B3CA 3SJXA 4P10A 3FX6A 1EE3P 5CBMA 5J1QA 2DEAA 4OC0A 3IWWA 4A37A 4CDKA 3KR4A 5LYDA 3LMSA 2ABZA 1LAMA 2PJCA 3KZWA 7CPAA 4P4JA 4YU9A 3D7GA 4C9UA 1XFOA 2XEIA 5I4MA 5IB9A 2ZEMA 1XMBA 2RFHA 4ZY2A 2PIYA 3WC6A 3BI0A 3SJGA 1PCAA 2PJ5A 2WYRA 4R76A 4P4IA 1CX8A 2POKA 4NFRA 3VATA 3HUVA 4C99A 3PEIA 3FVLA 2RB7A 1ZG9A 2HB6A 4Q7AA 4RUHA 4ZY0A 1ELLP 2QYVA 3KGQA 2JEWA 3LWUA 5D8NA 2JBJA 1XRYA 3IFEA 2PE3A 4NJQA 3B7IA 3NH5A 1HEEA 3N5FA 4C9EA 4X8IA 4F9VA 3B3WA 1ZG8A 3D7DA 1CP7A 2PRQA 1TKJA 3D68A 1FT7A 4X2TA 2PVWA 2ZEPA 3S9LA 3S9NA 4WWVA 3PB8X 1QMUA 4ZX9A 4OC1A 2BO9A 1ZG7A 2ZEFA 4PQAA 4OKOA 1Z5RA 1R43A 3KHZA 5D29A 1Y7EA 3WABA 3IO1A 2Q4ZA 3S9MA 4PXDA 4OC4A 4MRIA 4MCRA 1CPSA 3KHXA 3ISZA 3NH4A 2PJ8A 1LCPA 2ZOGA 4IHMA 3SJFA 3V7ZA 4EFDA 3BI1A 2PJ1A 4P4BA 2EWBA 1CBXA 4C8AA 3VARA 4NGPA 4GM5A 5K8PA 2EK8A 4DJLA 1CG2A 4KNGE 1VHEA 2QJ8A 4JYWA 4ZY1A 3VTAA 4DYOA 4MCQA 4LQGA 1TXRA 4O23A 1CP6A 4OC2A 2NYQA 2ZEOA 3B35A 3TC8A 2F7VA 3NA6A 4FWUA 2C6PA 2AFWA 2C1CA 1VHOA 4C9VA 3D4UA 2JBKA 2GREA 2Q43A 1Z2LA 2ZEHA 4F8ZA 4NJRA 3CPXA 4MMOA 4R6TA 2GLFA 3D67A 2PJ4A 3B3SA 3IJ3A 1FNOA 3ICUA 2CF4A 3ISXA 3D7FA 1JQGA 2AFSA 1F57A 1BPMA 4OC3A 1YMEA 3H8GA 4BD9A 4NGRA 1HDQA 2IQ6A 3CT9A 1V6CA 4YWYA 4A39A 3PBBA 5CPAA 2AFZA 1XF1A 4Z65A 3B3VA 2IMOA 4C86A 3WT4A 3K2KA 1OBRA 4NGSA 3T8WA 2ZENA 5K8OA 3EIFA 3B2YA 1TKFA 5LYLA 1KWMA 4MCPA 3FMCA 3FF3A 3FEDA 4A94A 2XEJA 1YW4A 3H8FA 3HLPA 2PJ9A 1F2OA 1LOKA 4IAVA 2PJBA 4C9RA 4DUKA 1DTDA 3PRTA 3PFEA 2V8VA 4C8FA 5K8NA 1HDUA 3PB4X 3DLJA 4C8CA 4TWEA 3CPAA 4PXBA 3VH9A 2F8HA 2PJ6A 4NGTA 3PBEA 2IJZA 2ZEDA 4MHNA 4C84A 5LRJA 4NGNA 4TJVA 4NGMA 2CIJA 1RTQA 4PPZA 3K9TA 1CPXA 1QQ9A 1F2PA 4EMEA 2ANPA 5HVHA 1R3NA 3KQZA 2PJ7A 4UF4A 2C6CA 3SI2A 3FEEA 1Y0YA 3FJUA 3IIBA 1Y9ZA 4KSIA 3KI9A 1BPNA 4TJXA 1Z8LA 2CTCA 3PB9X 3NFZA 2ZEGA 4G1PA 4FBEA 1BLLE 1ARLA 1XJOA 2PJAA 3TX8A 2PIZA 4MXUA 2C6GA 1ELMP 1BAVA 3PB6X 2V8DA 2ZOFA 1GYTA 3WC7A 1YW6A 4MHYA 2VL1A 5THWA 5HVGA 4EWTA 1LANA 1ARMA 3D66A 3I6SA 2PVVA 2AFXA 4OP4A 3GUXA 4YN3A 2PJ0A 3MN8A 1AMPA 5LRKA 1AYEA 4UEFA 1ZLHA 3GLJA 3L2NA 5K8MA 1YSJA 2NSMA 1NSAA 4K3NA 4C8UA 3SJEA 3NH8A 1VGYA 1ZLIA 4F9UA 5HXDA 1M4LA 2Q51A 3SI0A 3V38A 5DS0A 1IGBA 3FH4A 3WC5A 4P4EA 4C8PA 4TNUA 2FVGA 2V8GA 4WJBA 4P4DA 2PJ2A 2ZEEA 5JGFA 1Y0RA 1LAPA 5LYFA 3GB0A 4UIAA 4PXEA 5ELYA 1Q7LA 3PB7X 3PFOA 4R8FA 4FAIA 4P45A 2AFMA 4OIWA 4C9AA 1PYTB 4UIBA 2OOTA 3KL9A 3CDXA 2J9AA 2XEFA 4NGQA 4OMEA 3MRUA 4R7MA 1TF8A 2QVPA 2PCUA 1XBUA 4OC5A 4PXCA 2XEGA 2BOAA 3RBUA 2G9DA 3DGVA 3RAMA 3SI1A 6CPAA 4C8TA 3IC1A 5F09A 3KQXA 1DE4C 2BCOA 3FECA 1YLOA 2PJ3A 2WZNA 3I1UA 2O53A 1VIXA 2V77A 3KR5A 4MHPA 4UEEA 3RZAA 4MHZA 2AFUA 4CPAA 4UEZA 2CTBA 2OR4A 2I3CA 2EK9A 3JRUA 4P6YA 4P44A 2O4HA 4JZ0A
chains in the Genus database with same CATH superfamily
2WPXA 3BHXA 4FUUA 2Z3NA 5LYIA 4P4FA 3H8EA 1EZBA 3EO4A 5LRGA 1WVMA 3D8PA 1YLEA 2JLMA 1LFWA 2K5TA 2REFA 3QNVA 4ZYQA 1IY7A 2J8MA 1H8LA 1QSTA 3ICUA 1TKHA 5H86A 5J3XA 5JH9A 3VGOA 2AFOA 3BXMA 3P2FA 4KVOE 1C3OB 3H4QA 3DDDA 4RR2B 5HVFA 3I74A 3TFYA 4CAXA 1S7LA 1Q2CA 4ZX8A 3W91A 3WR7A 4ZI6A 2Q0YA 2R1IA 8CPAA 3OP0A 2X7BA 1M44A 2DPTA 2ZELA 4GPLB 1VKCA 3KASA 2HC9A 4YGOA 1A2ZA 5JM6A 1S3ZA 1YVKA 5BWAB 4M6IA 4B12A 4B6ZA 1Q5XA 3IEHA 3D7HA 1TF9A 1B87A 4C85A 3I3GA 4AXVA 4IK2A 2OB0A 1XMTA 2VXKA 4X3RA 2AE6A 2YNEA 4MJ8A 4OIDA 2Z3MA 4U9YA 4H2KA 3B3TA 1UWYA 2V8HA 4MCSA 4ONWA 4CDJA 4COBA 2GLJA 4W9YA 2GU2A 4NF1A 5F47A 4A38A 2VKZG 2FIAA 3B3CA 3SJXA 4UCNA 3KRVA 4P10A 2P6FA 2Z3KA 4R87A 3FX6A 5C88A 4GXHA 4LQ6A 5G21A 1VI4A 1EE3P 3LD2A 5HH1A 4DNCA 5CBMA 2DEAA 5J1QA 4KVXA 5IV0A 4OC0A 3IWWA 2WSAA 3S6GA 4A37A 4CDKA 4H6UA 3KR4A 3RNZA 3TO6A 5LYDA 4C7HA 2YGWA 3LMSA 5EBVA 4CYOA 2GFQA 3I9SA 3NE7A 4E8OA 2ABZA 1LAMA 2IL4A 4K30A 2PJCA 4KORA 2OZUA 3KZWA 7CPAA 3LODA 4P4JA 5DWNA 2BL1A 4CYQA 1MK4A 3A9LA 4F6AA 2EZCA 2B0AA 4YU9A 3CXQA 4QUSA 3EZEA 4RI1A 1BOBA 1GHEA 3V8IA 4II9A 4H1HA 3TTHA 4NEXA 4B13A 3F9KC 2ZPAA 3D7GA 3OWCA 4QBJA 5F5XA 4C9UA 4KVME 3BJ8A 1XFOA 2YNCC 1VBGA 5IR2A 2EVNA 2XEIA 5FVJA 5I4MA 1YVHA 5IB9A 2ZEMA 1XMBA 3K4IA 1IOIA 2RFHA 4ONUA 4UWJA 2OZGA 3U88C 2Q4VA 2FCKA 2PC1A 5HKZA 2PIYA 2PR8A 2B4DB 4JD6A 3BI0A 3WC6A 4IIYA 3SJGA 1PCAA 2PJ5A 2WYRA 2Z3LA 3F0AA 4R76A 3TLGB 3GY9A 3TLYA 4P4IA 1CM0A 1CX8A 2POKA 4NFRA 2HI6A 1IICA 5KTCA 4R3KA 5F49A 3VATA 1JDEA 1YGHA 4E5SA 2B5GB 3HUVA 4BPXB 4C99A 4UCMA 5JQ4A 2AUMA 2HV2A 2FL4A 4B10A 3PEIA 3CXSA 2GIVA 3FVLA 2RB7A 5AG4A 3VROA 4KOUA 1ZG9A 4RN7A 2HB6A 4KZTA 4Q7AA 2PSWA 2DIKA 3IWGA 4IIXA 5IX3A 2DF5A 4RUHA 2F5IA 5AXIA 4ZY0A 4BMHA 1ELLP 4HNYB 2FM4A 1FBVA 2B3UA 2QYVA 2QIRA 3KGQA 1Q2DA 2JEWA 1J4JA 2JDDA 3LWUA 1NBWA 4UA3A 1T36B 5D8NA 5I0CA 1NE9A 1X12A 2R8VA 2JBJA 1XRYA 1YQEA 3IFEA 4U9ZA 5ISVA 1EZAA 2VQYA 2PE3A 4NJQA 2GANA 1K4JA 3B7IA 3NH5A 4FD7A 1C30B 2CNTA 2XPLA 2O28A 3JVNA 3KKWA 1ZYMA 2PR1A 1BO4A 4OLLA 2QECA 1HEEA 2CNMA 3N5FA 4H6ZA 4C9EA 4X8IA 4F9VA 1ZL0A 1XE4A 3R95A 3T90A 3B3WA 4CAEA 1ZG8A 3D7DA 1CP7A 3NFQA 2PRQA 1TKJA 4XPKA 3D68A 2OU2A 1FT7A 3QAHA 3PZJA 4X2TA 2PVWA 2I00A 2JEVA 2ZEPA 3S9LA 3S9NA 4WWVA 3F8KA 3PB8X 3VRPA 2BEIA 1QMUA 5C82A 3GIUA 1CJWA 4OC1A 1NMTA 2BO9A 2EBJA 4MFZA 4ZX9A 1ZG7A 2ZEFA 4PQAA 4Y49B 4CGOA 1IU8A 4INJA 4FD5A 4OKOA 1Z5RA 3S6HA 3W6XA 1Z9UA 2P0WA 1R43A 4Y49C 4M3SA 1N71A 3KHZA 3PFVA 3B8GA 4KOVA 1Y7RA 5D29A 1Y7EA 4H89A 3WABA 3OAKA 5AG7A 3IO1A 4MI1A 2C5QA 4CS0B 2Q4ZA 1KEEB 4FD4A 3S9MA 4PXDA 4F0XA 4OC4A 4JXQA 4MRIA 4AVBA 4MCRA 3JUWA 4UBRA 3G8WA 4EVYA 3N7ZA 2KCWA 2J8NA 5H84A 4JWPA 3GJZA 2FSRA 1CPSA 3U1BA 4AG9A 3PGPA 3KHXA 4A4BA 1ZRSA 2ZW4A 3ISZA 3HPHE 1ON0A 4JVOA 1IB1E 2VZYA 3NH4A 4B11A 2PJ8A 4CGNA 1LCPA 2ZOGA 4IHMA 3SJFA 2DPSA 3VRQA 2VEZA 3V7ZA 4EFDA 3BI1A 2A4NA 4P4BA 2PJ1A 3C8OA 2EWBA 1CBXA 1MJAA 1V0CA 2UV8G 4LUAA 3VARA 4C8AA 4CRYB 4NGPA 4GM5A 3VRNA 4F0YA 5K8PA 2ATRA 2EK8A 4DJLA 1CG2A 1Z9EA 3PLFB 1KUVA 1VHEA 1XEBA 1YREA 4OADA 2QJ8A 4Q36A 5EMIA 4JYWA 3UY5A 3TE4A 3BUMB 2FE7A 4ZY1A 3VTAA 4DYOA 4CZ1A 4MCQA 4LQGA 1TXRA 2G3AA 4O23A 1CP6A 1S7FA 4PSXA 4OC2A 2NYQA 2Z3OA 2ZEOA 3DR6A 4HNXB 4NCZA 1S7KA 3B35A 3TC8A 1WJTA 4A33A 3TLEA 4KOWA 2F7VA 4KS9A 2E28A 4EYSA 4PK2A 1YK3A 3NA6A 3T0TA 4FWUA 2C6PA 2AFWA 2C1CA 1VHOA 2C27A 2PCNA 1M4IA 1R61A 3OB1B 3D2MA 4A95A 4C9VA 4KSAA 2Y1NA 4J0NA 2Y1MA 3HMJG 2Z11A 5F9MA 4BINA 3D4UA 1QSRA 2JBKA 2GREA 2H5MA 2Q43A 1CS0B 1Z4EA 1Z2LA 2Z10A 2Z3PA 2ZEHA 5K99A 2AUNA 4R57A 3BUXB 5AGEA 3ZZIA 4F8ZA 4MY3A 3CPXA 4NJRA 3OB2B 3FBUA 4MMOA 2XPOA 4R6TA 4UWIA 1PU9A 5G20A 5GCNA 1CE8B 3EZAA 2GLFA 3IGRA 2PRBA 3D67A 1I1DA 2B58A 2PJ4A 5J8FA 3G23A 3B3SA 3IJ3A 1FNOA 3GKRA 4KOYA 3TO9A 2CF4A 4BPWB 3D7FA 1JQGA 3D3SA 3ISXA 2AFSA 4ZBGA 1XIXA 1F57A 2Z0ZA 1BPMA 4OC3A 1YMEA 2QMLA 3H8GA 1YVOA 4BD9A 4E2AA 3T05A 3CZXA 2VZZA 4KSFA 5G22A 4CRZB 3BUWB 4NGRA 5F13A 2ODFA 1Z4RA 1HDQA 2XPNA 2IQ6A 3CT9A 5F48A 1V6CA 4YWYA 2Y0MA 4A39A 3PBBA 5CPAA 2AFZA 1XF1A 4Z65A 1IOFA 3B3VA 2IMOA 4C86A 2YNCA 3RO0A 1UFHA 4E0AA 3WT4A 2FXFA 4CAFA 3K2KA 3R9FA 4M8DA 3BUNB 4CGPA 1OBRA 4NGSA 3T8WA 2ZENA 3TLAA 3TLBA 3DR8A 2WUUA 5K8OA 3EIFA 2HUZA 3B2YA 1TKFA 1P0HA 5LYLA 1YR0A 1B47A 1WWZA 4MBUA 1KWMA 1Z8WA 4MCPA 2B4DA 3FMCA 3FF3A 3FEDA 2EO8A 2R7HA 3TLGA 1FY7A 4A94A 3SXOA 2XEJA 1M4DA 4QVTA 4MI4A 1YW4A 3F5BA 3H8FA 3HLPA 2PJ9A 2NMTA 2MP0A 3FB3A 4KLVA 2CNSA 3NE8A 2B5GA 1F2OA 1LOKA 4IAVA 2PJBA 3FYNA 3G3SA 3GYAA 4C7IA 4C9RA 4DUKA 2BUEA 1DTDA 3PRTA 3PFEA 2V8VA 4XNHB 4C8FA 3TT2A 5K8NA 3D2PA 4A31A 1L0CA 5E96A 2I79A 3R9GA 1HDUA 4IUSA 4B14A 4R3LA 5JYBA 3PB4X 3DLJA 4C8CA 1IYKA 4CYPA 4TWEA 3TOAA 3CPAA 4PXBA 3T07A 3VH9A 2G3TA 2PQ8A 2AJ6A 2F8HA 1ZO0A 4NGTA 1S5KA 2PJ6A 4JJXA 3S6KA 3PBEA 3EFAA 4KOSA 2IJZA 3EXNA 2ZEDA 2HWGA 4KUAA 2DXQA 3EC4A 5AG5A 3EY5A 3JTKA 3RYOA 4UCPA 2CXAA 4MHNA 4C84A 5LRJA 2X0SA 4NGNA 1JWQA 4AB7A 4HNWB 4NGMA 4PSWA 4TJVA 5A28A 2CIJA 1RTQA 2GE3A 4KOTA 4PPZA 4M6HA 1Y9WA 1DIKA 1RXTA 3K9TA 1CPXA 1QQ9A 1F2PA 4GS4A 4HKFA 1WK4A 3W6SA 4EMEA 3SHPA 2ANPA 5HVHA 1R3NA 2CBLA 4RS2A 3FNCA 1AUGA 4X5KA 1J3LA 3KQZA 2PJ7A 4UF4A 2C6CA 3SI2A 2B3VA 3FXTA 2OLSA 3VRRA 5DWMA 3FEEA 1Y0YA 3BJ7A 3FJUA 3IIBA 4M6GA 3TO7A 4AVCA 5EC4A 3LACA 4KSIA 1Y9ZA 1VHSA 1LRZA 3KI9A 4HPSA 1BPNA 4UFWA 4TJXA 4CAWA 1Z8LA 2CTCA 1M1DA 4BTFA 3P2HA 4MFKA 1EO0A 5JPHA 3PP9A 3QAYA 3PB9X 2ZW6A 2OZHA 2FS5A 2ZEGA 3NFZA 4G1PA 4MFLA 1BLLE 4U5YA 4FBEA 3NOJA 1ARLA 1IIDA 2B4JC 1XJOA 1QSOA 2P6EA 2PJAA 1U6MA 1YX0A 3DNSA 4MJXA 3TX8A 4C2ZA 2R82A 2PIZA 2ZW7A 3T5MA 3DSBA 4MXUA 1I21A 4A2ZA 2C6GA 1ELMP 1NSLA 2D0OA 1BAVA 3PB6X 1VBHA 4MFQA 2VBQA 2V8DA 2ZOFA 4COGA 5JVLA 4MY0A 5HKYA 4A30A 1BXRB 2Q7SA 5FD8A 1GYTA 3WC7A 1YW6A 4MHYA 2VL1A 5THWA 4J3GA 1Y9KA 4KOXA 5HVGA 1KC7A 4L8AA 3BUOB 4AVAA 4EWTA 1KZFA 1LANA 3ZNIA 1ARMA 1Z8TA 3D66A 3I6SA 4ORFA 4YRHA 4C2XA 2PVVA 1Z8XA 2AFXA 4MFJA 4CGMA 4OP4A 4B5PB 3GUXA 2OH1A 3TLCA 4YN3A 2PJ0A 4UFXA 4IF5A 3MN8A 4AG7A 1AMPA 1SQHA 3BLNA 3SXNA 5HMNA 1B6BA 5CNPA 1PUAA 4PK3A 5LRKA 3CXPA 3PT1A 1AYEA 4ZY2A 3TYXA 4UEFA 4Q38A 1ZLHA 3GLJA 3L2NA 5K8MA 1YSJA 2NSMA 1NSAA 3O8ZA 3IWEA 4K3NA 4C8UA 3SJEA 1S7NA 3NH8A 1VGYA 1ZLIA 2B4BA 4F9UA 5HXDA 1M4LA 2JDCA 4UFVA 2CY2A 2Q51A 3SI0A 2YJVA 1MJ9A 2EUIA 3V38A 4E94A 5DS0A 1IGBA 3FH4A 5KTDA 3TCVA 5BY0A 3WC5A 2HQYA 4LX9A 4P4EA 4C8PA 3H5ZA 1X10A 4TNUA 5F46A 2Q4YA 2FVGA 2V8GA 4WJBA 4P4DA 2P6GA 2PJ2A 1RO5A 3IU1A 4CYNA 3IU2A 4L89A 1KBLA 1S60A 2ZEEA 5JGFA 1Y0RA 1A9XB 1LAPA 5LYFA 3GB0A 4OAEA 4UIAA 1Q2YA 4PXEA 4CAVA 5ELYA 3EZBA 4CO9A 2YNDA 3R1KA 1Q7LA 3PB7X 5G1ZA 3PFOA 4R8FA 4FAIA 4A32A 4P45A 2AFMA 3MGDA 4OIWA 2RC4A 4C9AA 4XPLA 1I12A 2XPPA 1PYTB 2PDOA 2Q04A 3FIXA 4MFPA 4R9MA 4UIBA 4JXRA 2OOTA 3KL9A 5HKWA 2J9AA 2XEFA 4BPUB 3CDXA 4NGQA 4OMEA 4M85A 3MRUA 4C68A 4R7MA 1M4GA 2ZXVA 4PV6A 2EZBA 1TF8A 2QVPA 5AG6A 2D0PA 2PCUA 1XBUA 3K9UA 2HROA 4I49A 2DLAA 1OZPA 4MHDA 3ZJ0A 2REEA 4OC5A 4PXCA 2XEGA 2BOAA 3E0KA 3RBUA 3FRMA 1R57A 2J8RA 1GGOA 2G9DA 4XNHC 2R98A 2ZW5A 3T9YA 3DGVA 3RAMA 3SI1A 6CPAA 4A4CA 4JLYA 4C8TA 1XOVA 2ARHA 3IC1A 4C2YA 5F09A 3KQXA 5KTAA 1JDBC 1DE4C 2BCOA 2YJTA 3FECA 2FIWA 1YLOA 1M6VB 2PJ3A 2WZNA 2D4PA 5IB0A 2GP4A 4B5PA 3I1UA 2O53A 1KUXA 1VIXA 2V77A 3KR5A 2G0BA 4MHPA 3C26A 2D4OA 3VWDA 4B5OA 1P4NA 1IYLA 1XF8A 3QB8A 2FT0A 2WPWA 4KUBA 3R9EA 1MJBA 4UEEA 3RZAA 5A27A 2N3AB 2Q7BA 3TOBA 4YFJA 1TIQA 4MHZA 4ZGYB 3VWEA 2Q44A 2AFUA 4XPDB 3S6FA 4CPAA 4NXYA 3SR3A 5F1YA 4UEZA 2CTBA 4KNGE 2OR4A 2BSWA 2I3CA 4NSQA 4BBHA 2EK9A 1QSMA 2VI7A 4KLWA 3JRUA 4XPDC 4CGLA 4QC6A 3HPGG 1QSNA 1KUYA 4P6YA 4QB9A 4P44A 5J8CA 3TLZA 2O4HA 4JZ0A 3R96A 1NXJA 4FD6A 2EZAA
chains in the Genus database with same CATH topology
3BHXA 4FUUA 5LYIA 4P4FA 3H8EA 5LRGA 1WVMA 4ZYQA 1LFWA 3QNVA 1IY7A 1H8LA 1TKHA 5JH9A 2AFOA 3BXMA 5HVFA 3I74A 4ZX8A 4ZI6A 8CPAA 2ZELA 3KASA 2HC9A 5JM6A 4B6ZA 3IEHA 3D7HA 1TF9A 4C85A 4AXVA 4IK2A 4OIDA 4X3RA 4H2KA 3B3TA 1UWYA 2V8HA 4MCSA 4ONWA 4CDJA 2GLJA 4W9YA 2GU2A 4A38A 3B3CA 3SJXA 4P10A 3FX6A 1EE3P 5CBMA 5J1QA 2DEAA 4OC0A 3IWWA 4A37A 4CDKA 3KR4A 5LYDA 3LMSA 2ABZA 1LAMA 2PJCA 3KZWA 7CPAA 4P4JA 4YU9A 3D7GA 4C9UA 1XFOA 5IR2A 2XEIA 5I4MA 5IB9A 2ZEMA 1XMBA 2RFHA 4ZY2A 2PIYA 3WC6A 3BI0A 3SJGA 1PCAA 2PJ5A 2WYRA 4R76A 4P4IA 1CX8A 2POKA 4NFRA 3VATA 3HUVA 4C99A 3PEIA 3FVLA 2RB7A 1ZG9A 2HB6A 4Q7AA 4RUHA 4ZY0A 1ELLP 2QYVA 3KGQA 2JEWA 3LWUA 5D8NA 2JBJA 1XRYA 3IFEA 2PE3A 4NJQA 3B7IA 3NH5A 1HEEA 3N5FA 4C9EA 4X8IA 4F9VA 3B3WA 1ZG8A 3D7DA 1CP7A 2PRQA 1TKJA 3D68A 1FT7A 4X2TA 2PVWA 2ZEPA 3S9LA 3S9NA 4WWVA 3PB8X 1QMUA 4ZX9A 4OC1A 2BO9A 1ZG7A 2ZEFA 4PQAA 4OKOA 1Z5RA 1R43A 3KHZA 5D29A 1Y7EA 3WABA 3IO1A 2C5QA 2Q4ZA 3S9MA 4PXDA 4OC4A 4MRIA 4MCRA 1CPSA 3KHXA 3ISZA 3NH4A 2PJ8A 1LCPA 2ZOGA 4IHMA 3SJFA 3V7ZA 4EFDA 3BI1A 2PJ1A 4P4BA 2EWBA 1CBXA 4C8AA 3VARA 4NGPA 4GM5A 5K8PA 2EK8A 4DJLA 1CG2A 4KNGE 1VHEA 2QJ8A 4JYWA 4ZY1A 3VTAA 4DYOA 4MCQA 4LQGA 1TXRA 4O23A 1CP6A 4OC2A 2NYQA 2ZEOA 3B35A 3TC8A 2F7VA 3NA6A 4FWUA 2C6PA 2AFWA 2C1CA 1VHOA 4C9VA 3D4UA 2JBKA 2GREA 2Q43A 1Z2LA 2ZEHA 4F8ZA 4NJRA 3CPXA 4MMOA 4R6TA 2GLFA 3D67A 2PJ4A 3B3SA 3IJ3A 1FNOA 3ICUA 2CF4A 3ISXA 3D7FA 1JQGA 2AFSA 1F57A 1BPMA 4OC3A 1YMEA 3H8GA 4BD9A 4NGRA 1HDQA 2IQ6A 3CT9A 1V6CA 4YWYA 4A39A 3PBBA 5CPAA 2AFZA 1XF1A 4Z65A 3B3VA 2IMOA 4C86A 3WT4A 3K2KA 1OBRA 4NGSA 3T8WA 2ZENA 5K8OA 3EIFA 3B2YA 1TKFA 5LYLA 1KWMA 4MCPA 3FMCA 3FF3A 3FEDA 4A94A 2XEJA 1YW4A 3H8FA 3HLPA 2PJ9A 1F2OA 1LOKA 4IAVA 2PJBA 4C9RA 4DUKA 1DTDA 3PRTA 3PFEA 2V8VA 4C8FA 5K8NA 1HDUA 3PB4X 3DLJA 4C8CA 4TWEA 3CPAA 4PXBA 3VH9A 2F8HA 2PJ6A 4NGTA 3PBEA 2IJZA 2ZEDA 4MHNA 4C84A 5LRJA 4NGNA 4TJVA 4NGMA 2CIJA 1RTQA 4PPZA 3K9TA 1CPXA 1QQ9A 1F2PA 4EMEA 2ANPA 5HVHA 1R3NA 3KQZA 2PJ7A 4UF4A 2C6CA 3SI2A 3FEEA 1Y0YA 3FJUA 3IIBA 1Y9ZA 4KSIA 3KI9A 1BPNA 4TJXA 1Z8LA 2CTCA 3PB9X 3NFZA 2ZEGA 4G1PA 4FBEA 1BLLE 1ARLA 1XJOA 2PJAA 3TX8A 2PIZA 4MXUA 2C6GA 1ELMP 1BAVA 3PB6X 2V8DA 2ZOFA 1GYTA 3WC7A 1YW6A 4MHYA 2VL1A 5THWA 5HVGA 4EWTA 1LANA 1ARMA 3D66A 3I6SA 2PVVA 2AFXA 4OP4A 3GUXA 4YN3A 2PJ0A 3MN8A 1AMPA 5LRKA 1AYEA 4UEFA 1ZLHA 3GLJA 3L2NA 5K8MA 1YSJA 2NSMA 1NSAA 4K3NA 4C8UA 3SJEA 3NH8A 1VGYA 1ZLIA 4F9UA 5HXDA 1M4LA 2Q51A 3SI0A 3V38A 5DS0A 1IGBA 3FH4A 3WC5A 4P4EA 4C8PA 4TNUA 2FVGA 2V8GA 4WJBA 4P4DA 2PJ2A 2ZEEA 5JGFA 1Y0RA 1LAPA 5LYFA 3GB0A 4UIAA 4PXEA 5ELYA 1Q7LA 3PB7X 3PFOA 4R8FA 4FAIA 4P45A 2AFMA 4OIWA 4C9AA 1PYTB 4UIBA 2OOTA 3KL9A 3CDXA 2J9AA 2XEFA 4NGQA 4OMEA 3MRUA 4R7MA 1TF8A 2QVPA 2PCUA 1XBUA 4OC5A 4PXCA 2XEGA 2BOAA 3RBUA 2G9DA 3DGVA 3RAMA 3SI1A 6CPAA 4C8TA 3IC1A 5F09A 3KQXA 1DE4C 2BCOA 3FECA 1YLOA 2PJ3A 2WZNA 2GP4A 3I1UA 2O53A 1VIXA 2V77A 3KR5A 4MHPA 4UEEA 3RZAA 4MHZA 2AFUA 4CPAA 4UEZA 2CTBA 2OR4A 2I3CA 2EK9A 3JRUA 4P6YA 4P44A 2O4HA 4JZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BHX A;  4FUU A;  5LYI A;  4P4F A;  3H8E A;  5LRG A;  1WVM A;  4ZYQ A;  1LFW A;  3QNV A;  1IY7 A;  1H8L A;  1TKH A;  5JH9 A;  2AFO A;  3BXM A;  5HVF A;  3I74 A;  4ZX8 A;  4ZI6 A;  8CPA A;  2ZEL A;  3KAS A;  2HC9 A;  5JM6 A;  4B6Z A;  3IEH A;  3D7H A;  1TF9 A;  4C85 A;  4AXV A;  4IK2 A;  4OID A;  4X3R A;  4H2K A;  3B3T A;  1UWY A;  2V8H A;  4MCS A;  4ONW A;  4CDJ A;  2GLJ A;  4W9Y A;  2GU2 A;  4A38 A;  3B3C A;  3SJX A;  4P10 A;  3FX6 A;  1EE3 P;  5CBM A;  5J1Q A;  2DEA A;  4OC0 A;  3IWW A;  4A37 A;  4CDK A;  3KR4 A;  5LYD A;  3LMS A;  2ABZ A;  1LAM A;  2PJC A;  3KZW A;  7CPA A;  4P4J A;  4YU9 A;  3D7G A;  4C9U A;  1XFO A;  2XEI A;  5I4M A;  5IB9 A;  2ZEM A;  1XMB A;  2RFH A;  4ZY2 A;  2PIY A;  3WC6 A;  3BI0 A;  3SJG A;  1PCA A;  2PJ5 A;  2WYR A;  4R76 A;  4P4I A;  1CX8 A;  2POK A;  4NFR A;  3VAT A;  3HUV A;  4C99 A;  3PEI A;  3FVL A;  2RB7 A;  1ZG9 A;  2HB6 A;  4Q7A A;  4RUH A;  4ZY0 A;  1ELL P;  2QYV A;  3KGQ A;  2JEW A;  3LWU A;  5D8N A;  2JBJ A;  1XRY A;  3IFE A;  2PE3 A;  4NJQ A;  3B7I A;  3NH5 A;  1HEE A;  3N5F A;  4C9E A;  4X8I A;  4F9V A;  3B3W A;  1ZG8 A;  3D7D A;  1CP7 A;  2PRQ A;  1TKJ A;  3D68 A;  1FT7 A;  4X2T A;  2PVW A;  2ZEP A;  3S9L A;  3S9N A;  4WWV A;  3PB8 X;  1QMU A;  4ZX9 A;  4OC1 A;  2BO9 A;  1ZG7 A;  2ZEF A;  4PQA A;  4OKO A;  1Z5R A;  1R43 A;  3KHZ A;  5D29 A;  1Y7E A;  3WAB A;  3IO1 A;  2Q4Z A;  3S9M A;  4PXD A;  4OC4 A;  4MRI A;  4MCR A;  1CPS A;  3KHX A;  3ISZ A;  3NH4 A;  2PJ8 A;  1LCP A;  2ZOG A;  4IHM A;  3SJF A;  3V7Z A;  4EFD A;  3BI1 A;  2PJ1 A;  4P4B A;  2EWB A;  1CBX A;  4C8A A;  3VAR A;  4NGP A;  4GM5 A;  5K8P A;  2EK8 A;  4DJL A;  1CG2 A;  4KNG E;  1VHE A;  2QJ8 A;  4JYW A;  4ZY1 A;  3VTA A;  4DYO A;  4MCQ A;  4LQG A;  1TXR A;  4O23 A;  1CP6 A;  4OC2 A;  2NYQ A;  2ZEO A;  3B35 A;  3TC8 A;  2F7V A;  3NA6 A;  4FWU A;  2C6P A;  2AFW A;  2C1C A;  1VHO A;  4C9V A;  3D4U A;  2JBK A;  2GRE A;  2Q43 A;  1Z2L A;  2ZEH A;  4F8Z A;  4NJR A;  3CPX A;  4MMO A;  4R6T A;  2GLF A;  3D67 A;  2PJ4 A;  3B3S A;  3IJ3 A;  1FNO A;  3ICU A;  2CF4 A;  3ISX A;  3D7F A;  1JQG A;  2AFS A;  1F57 A;  1BPM A;  4OC3 A;  1YME A;  3H8G A;  4BD9 A;  4NGR A;  1HDQ A;  2IQ6 A;  3CT9 A;  1V6C A;  4YWY A;  4A39 A;  3PBB A;  5CPA A;  2AFZ A;  1XF1 A;  4Z65 A;  3B3V A;  2IMO A;  4C86 A;  3WT4 A;  3K2K A;  1OBR A;  4NGS A;  3T8W A;  2ZEN A;  5K8O A;  3EIF A;  3B2Y A;  1TKF A;  5LYL A;  1KWM A;  4MCP A;  3FMC A;  3FF3 A;  3FED A;  4A94 A;  2XEJ A;  1YW4 A;  3H8F A;  3HLP A;  2PJ9 A;  1F2O A;  1LOK A;  4IAV A;  2PJB A;  4C9R A;  4DUK A;  1DTD A;  3PRT A;  3PFE A;  2V8V A;  4C8F A;  5K8N A;  1HDU A;  3PB4 X;  3DLJ A;  4C8C A;  4TWE A;  3CPA A;  4PXB A;  3VH9 A;  2F8H A;  2PJ6 A;  4NGT A;  3PBE A;  2IJZ A;  2ZED A;  4MHN A;  4C84 A;  5LRJ A;  4NGN A;  4TJV A;  4NGM A;  2CIJ A;  1RTQ A;  4PPZ A;  3K9T A;  1CPX A;  1QQ9 A;  1F2P A;  4EME A;  2ANP A;  5HVH A;  1R3N A;  3KQZ A;  2PJ7 A;  4UF4 A;  2C6C A;  3SI2 A;  3FEE A;  1Y0Y A;  3FJU A;  3IIB A;  1Y9Z A;  4KSI A;  3KI9 A;  1BPN A;  4TJX A;  1Z8L A;  2CTC A;  3PB9 X;  3NFZ A;  2ZEG A;  4G1P A;  4FBE A;  1BLL E;  1ARL A;  1XJO A;  2PJA A;  3TX8 A;  2PIZ A;  4MXU A;  2C6G A;  1ELM P;  1BAV A;  3PB6 X;  2V8D A;  2ZOF A;  1GYT A;  3WC7 A;  1YW6 A;  4MHY A;  2VL1 A;  5THW A;  5HVG A;  4EWT A;  1LAN A;  1ARM A;  3D66 A;  3I6S A;  2PVV A;  2AFX A;  4OP4 A;  3GUX A;  4YN3 A;  2PJ0 A;  3MN8 A;  1AMP A;  5LRK A;  1AYE A;  4UEF A;  1ZLH A;  3GLJ A;  3L2N A;  5K8M A;  1YSJ A;  2NSM A;  1NSA A;  4K3N A;  4C8U A;  3SJE A;  3NH8 A;  1VGY A;  1ZLI A;  4F9U A;  5HXD A;  1M4L A;  2Q51 A;  3SI0 A;  3V38 A;  5DS0 A;  1IGB A;  3FH4 A;  3WC5 A;  4P4E A;  4C8P A;  4TNU A;  2FVG A;  2V8G A;  4WJB A;  4P4D A;  2PJ2 A;  2ZEE A;  5JGF A;  1Y0R A;  1LAP A;  5LYF A;  3GB0 A;  4UIA A;  4PXE A;  5ELY A;  1Q7L A;  3PB7 X;  3PFO A;  4R8F A;  4FAI A;  4P45 A;  2AFM A;  4OIW A;  4C9A A;  1PYT B;  4UIB A;  2OOT A;  3KL9 A;  3CDX A;  2J9A A;  2XEF A;  4NGQ A;  4OME A;  3MRU A;  4R7M A;  1TF8 A;  2QVP A;  2PCU A;  1XBU A;  4OC5 A;  4PXC A;  2XEG A;  2BOA A;  3RBU A;  2G9D A;  3DGV A;  3RAM A;  3SI1 A;  6CPA A;  4C8T A;  3IC1 A;  5F09 A;  3KQX A;  1DE4 C;  2BCO A;  3FEC A;  1YLO A;  2PJ3 A;  2WZN A;  3I1U A;  2O53 A;  1VIX A;  2V77 A;  3KR5 A;  4MHP A;  4UEE A;  3RZA A;  4MHZ A;  2AFU A;  4CPA A;  4UEZ A;  2CTB A;  2OR4 A;  2I3C A;  2EK9 A;  3JRU A;  4P6Y A;  4P44 A;  2O4H A;  4JZ0 A; 
#chains in the Genus database with same CATH topology
 2WPX A;  3BHX A;  4FUU A;  2Z3N A;  5LYI A;  4P4F A;  3H8E A;  1EZB A;  3EO4 A;  5LRG A;  1WVM A;  3D8P A;  1YLE A;  2JLM A;  1LFW A;  2K5T A;  2REF A;  3QNV A;  4ZYQ A;  1IY7 A;  2J8M A;  1H8L A;  1QST A;  3ICU A;  1TKH A;  5H86 A;  5J3X A;  5JH9 A;  3VGO A;  2AFO A;  3BXM A;  3P2F A;  4KVO E;  1C3O B;  3H4Q A;  3DDD A;  4RR2 B;  5HVF A;  3I74 A;  3TFY A;  4CAX A;  1S7L A;  1Q2C A;  4ZX8 A;  3W91 A;  3WR7 A;  4ZI6 A;  2Q0Y A;  2R1I A;  8CPA A;  3OP0 A;  2X7B A;  1M44 A;  2DPT A;  2ZEL A;  4GPL B;  1VKC A;  3KAS A;  2HC9 A;  4YGO A;  1A2Z A;  5JM6 A;  1S3Z A;  1YVK A;  5BWA B;  4M6I A;  4B12 A;  4B6Z A;  1Q5X A;  3IEH A;  3D7H A;  1TF9 A;  1B87 A;  4C85 A;  3I3G A;  4AXV A;  4IK2 A;  2OB0 A;  1XMT A;  2VXK A;  4X3R A;  2AE6 A;  2YNE A;  4MJ8 A;  4OID A;  2Z3M A;  4U9Y A;  4H2K A;  3B3T A;  1UWY A;  2V8H A;  4MCS A;  4ONW A;  4CDJ A;  4COB A;  2GLJ A;  4W9Y A;  2GU2 A;  4NF1 A;  5F47 A;  4A38 A;  2VKZ G;  2FIA A;  3B3C A;  3SJX A;  4UCN A;  3KRV A;  4P10 A;  2P6F A;  2Z3K A;  4R87 A;  3FX6 A;  5C88 A;  4GXH A;  4LQ6 A;  5G21 A;  1VI4 A;  1EE3 P;  3LD2 A;  5HH1 A;  4DNC A;  5CBM A;  2DEA A;  5J1Q A;  4KVX A;  5IV0 A;  4OC0 A;  3IWW A;  2WSA A;  3S6G A;  4A37 A;  4CDK A;  4H6U A;  3KR4 A;  3RNZ A;  3TO6 A;  5LYD A;  4C7H A;  2YGW A;  3LMS A;  5EBV A;  4CYO A;  2GFQ A;  3I9S A;  3NE7 A;  4E8O A;  2ABZ A;  1LAM A;  2IL4 A;  4K30 A;  2PJC A;  4KOR A;  2OZU A;  3KZW A;  7CPA A;  3LOD A;  4P4J A;  5DWN A;  2BL1 A;  4CYQ A;  1MK4 A;  3A9L A;  4F6A A;  2EZC A;  2B0A A;  4YU9 A;  3CXQ A;  4QUS A;  3EZE A;  4RI1 A;  1BOB A;  1GHE A;  3V8I A;  4II9 A;  4H1H A;  3TTH A;  4NEX A;  4B13 A;  3F9K C;  2ZPA A;  3D7G A;  3OWC A;  4QBJ A;  5F5X A;  4C9U A;  4KVM E;  3BJ8 A;  1XFO A;  2YNC C;  1VBG A;  5IR2 A;  2EVN A;  2XEI A;  5FVJ A;  5I4M A;  1YVH A;  5IB9 A;  2ZEM A;  1XMB A;  3K4I A;  1IOI A;  2RFH A;  4ONU A;  4UWJ A;  2OZG A;  3U88 C;  2Q4V A;  2FCK A;  2PC1 A;  5HKZ A;  2PIY A;  2PR8 A;  2B4D B;  4JD6 A;  3BI0 A;  3WC6 A;  4IIY A;  3SJG A;  1PCA A;  2PJ5 A;  2WYR A;  2Z3L A;  3F0A A;  4R76 A;  3TLG B;  3GY9 A;  3TLY A;  4P4I A;  1CM0 A;  1CX8 A;  2POK A;  4NFR A;  2HI6 A;  1IIC A;  5KTC A;  4R3K A;  5F49 A;  3VAT A;  1JDE A;  1YGH A;  4E5S A;  2B5G B;  3HUV A;  4BPX B;  4C99 A;  4UCM A;  5JQ4 A;  2AUM A;  2HV2 A;  2FL4 A;  4B10 A;  3PEI A;  3CXS A;  2GIV A;  3FVL A;  2RB7 A;  5AG4 A;  3VRO A;  4KOU A;  1ZG9 A;  4RN7 A;  2HB6 A;  4KZT A;  4Q7A A;  2PSW A;  2DIK A;  3IWG A;  4IIX A;  5IX3 A;  2DF5 A;  4RUH A;  2F5I A;  5AXI A;  4ZY0 A;  4BMH A;  1ELL P;  4HNY B;  2FM4 A;  1FBV A;  2B3U A;  2QYV A;  2QIR A;  3KGQ A;  1Q2D A;  2JEW A;  1J4J A;  2JDD A;  3LWU A;  1NBW A;  4UA3 A;  1T36 B;  5D8N A;  5I0C A;  1NE9 A;  1X12 A;  2R8V A;  2JBJ A;  1XRY A;  1YQE A;  3IFE A;  4U9Z A;  5ISV A;  1EZA A;  2VQY A;  2PE3 A;  4NJQ A;  2GAN A;  1K4J A;  3B7I A;  3NH5 A;  4FD7 A;  1C30 B;  2CNT A;  2XPL A;  2O28 A;  3JVN A;  3KKW A;  1ZYM A;  2PR1 A;  1BO4 A;  4OLL A;  2QEC A;  1HEE A;  2CNM A;  3N5F A;  4H6Z A;  4C9E A;  4X8I A;  4F9V A;  1ZL0 A;  1XE4 A;  3R95 A;  3T90 A;  3B3W A;  4CAE A;  1ZG8 A;  3D7D A;  1CP7 A;  3NFQ A;  2PRQ A;  1TKJ A;  4XPK A;  3D68 A;  2OU2 A;  1FT7 A;  3QAH A;  3PZJ A;  4X2T A;  2PVW A;  2I00 A;  2JEV A;  2ZEP A;  3S9L A;  3S9N A;  4WWV A;  3F8K A;  3PB8 X;  3VRP A;  2BEI A;  1QMU A;  5C82 A;  3GIU A;  1CJW A;  4OC1 A;  1NMT A;  2BO9 A;  2EBJ A;  4MFZ A;  4ZX9 A;  1ZG7 A;  2ZEF A;  4PQA A;  4Y49 B;  4CGO A;  1IU8 A;  4INJ A;  4FD5 A;  4OKO A;  1Z5R A;  3S6H A;  3W6X A;  1Z9U A;  2P0W A;  1R43 A;  4Y49 C;  4M3S A;  1N71 A;  3KHZ A;  3PFV A;  3B8G A;  4KOV A;  1Y7R A;  5D29 A;  1Y7E A;  4H89 A;  3WAB A;  3OAK A;  5AG7 A;  3IO1 A;  4MI1 A;  2C5Q A;  4CS0 B;  2Q4Z A;  1KEE B;  4FD4 A;  3S9M A;  4PXD A;  4F0X A;  4OC4 A;  4JXQ A;  4MRI A;  4AVB A;  4MCR A;  3JUW A;  4UBR A;  3G8W A;  4EVY A;  3N7Z A;  2KCW A;  2J8N A;  5H84 A;  4JWP A;  3GJZ A;  2FSR A;  1CPS A;  3U1B A;  4AG9 A;  3PGP A;  3KHX A;  4A4B A;  1ZRS A;  2ZW4 A;  3ISZ A;  3HPH E;  1ON0 A;  4JVO A;  1IB1 E;  2VZY A;  3NH4 A;  4B11 A;  2PJ8 A;  4CGN A;  1LCP A;  2ZOG A;  4IHM A;  3SJF A;  2DPS A;  3VRQ A;  2VEZ A;  3V7Z A;  4EFD A;  3BI1 A;  2A4N A;  4P4B A;  2PJ1 A;  3C8O A;  2EWB A;  1CBX A;  1MJA A;  1V0C A;  2UV8 G;  4LUA A;  3VAR A;  4C8A A;  4CRY B;  4NGP A;  4GM5 A;  3VRN A;  4F0Y A;  5K8P A;  2ATR A;  2EK8 A;  4DJL A;  1CG2 A;  1Z9E A;  3PLF B;  1KUV A;  1VHE A;  1XEB A;  1YRE A;  4OAD A;  2QJ8 A;  4Q36 A;  5EMI A;  4JYW A;  3UY5 A;  3TE4 A;  3BUM B;  2FE7 A;  4ZY1 A;  3VTA A;  4DYO A;  4CZ1 A;  4MCQ A;  4LQG A;  1TXR A;  2G3A A;  4O23 A;  1CP6 A;  1S7F A;  4PSX A;  4OC2 A;  2NYQ A;  2Z3O A;  2ZEO A;  3DR6 A;  4HNX B;  4NCZ A;  1S7K A;  3B35 A;  3TC8 A;  1WJT A;  4A33 A;  3TLE A;  4KOW A;  2F7V A;  4KS9 A;  2E28 A;  4EYS A;  4PK2 A;  1YK3 A;  3NA6 A;  3T0T A;  4FWU A;  2C6P A;  2AFW A;  2C1C A;  1VHO A;  2C27 A;  2PCN A;  1M4I A;  1R61 A;  3OB1 B;  3D2M A;  4A95 A;  4C9V A;  4KSA A;  2Y1N A;  4J0N A;  2Y1M A;  3HMJ G;  2Z11 A;  5F9M A;  4BIN A;  3D4U A;  1QSR A;  2JBK A;  2GRE A;  2H5M A;  2Q43 A;  1CS0 B;  1Z4E A;  1Z2L A;  2Z10 A;  2Z3P A;  2ZEH A;  5K99 A;  2AUN A;  4R57 A;  3BUX B;  5AGE A;  3ZZI A;  4F8Z A;  4MY3 A;  3CPX A;  4NJR A;  3OB2 B;  3FBU A;  4MMO A;  2XPO A;  4R6T A;  4UWI A;  1PU9 A;  5G20 A;  5GCN A;  1CE8 B;  3EZA A;  2GLF A;  3IGR A;  2PRB A;  3D67 A;  1I1D A;  2B58 A;  2PJ4 A;  5J8F A;  3G23 A;  3B3S A;  3IJ3 A;  1FNO A;  3GKR A;  4KOY A;  3TO9 A;  2CF4 A;  4BPW B;  3D7F A;  1JQG A;  3D3S A;  3ISX A;  2AFS A;  4ZBG A;  1XIX A;  1F57 A;  2Z0Z A;  1BPM A;  4OC3 A;  1YME A;  2QML A;  3H8G A;  1YVO A;  4BD9 A;  4E2A A;  3T05 A;  3CZX A;  2VZZ A;  4KSF A;  5G22 A;  4CRZ B;  3BUW B;  4NGR A;  5F13 A;  2ODF A;  1Z4R A;  1HDQ A;  2XPN A;  2IQ6 A;  3CT9 A;  5F48 A;  1V6C A;  4YWY A;  2Y0M A;  4A39 A;  3PBB A;  5CPA A;  2AFZ A;  1XF1 A;  4Z65 A;  1IOF A;  3B3V A;  2IMO A;  4C86 A;  2YNC A;  3RO0 A;  1UFH A;  4E0A A;  3WT4 A;  2FXF A;  4CAF A;  3K2K A;  3R9F A;  4M8D A;  3BUN B;  4CGP A;  1OBR A;  4NGS A;  3T8W A;  2ZEN A;  3TLA A;  3TLB A;  3DR8 A;  2WUU A;  5K8O A;  3EIF A;  2HUZ A;  3B2Y A;  1TKF A;  1P0H A;  5LYL A;  1YR0 A;  1B47 A;  1WWZ A;  4MBU A;  1KWM A;  1Z8W A;  4MCP A;  2B4D A;  3FMC A;  3FF3 A;  3FED A;  2EO8 A;  2R7H A;  3TLG A;  1FY7 A;  4A94 A;  3SXO A;  2XEJ A;  1M4D A;  4QVT A;  4MI4 A;  1YW4 A;  3F5B A;  3H8F A;  3HLP A;  2PJ9 A;  2NMT A;  2MP0 A;  3FB3 A;  4KLV A;  2CNS A;  3NE8 A;  2B5G A;  1F2O A;  1LOK A;  4IAV A;  2PJB A;  3FYN A;  3G3S A;  3GYA A;  4C7I A;  4C9R A;  4DUK A;  2BUE A;  1DTD A;  3PRT A;  3PFE A;  2V8V A;  4XNH B;  4C8F A;  3TT2 A;  5K8N A;  3D2P A;  4A31 A;  1L0C A;  5E96 A;  2I79 A;  3R9G A;  1HDU A;  4IUS A;  4B14 A;  4R3L A;  5JYB A;  3PB4 X;  3DLJ A;  4C8C A;  1IYK A;  4CYP A;  4TWE A;  3TOA A;  3CPA A;  4PXB A;  3T07 A;  3VH9 A;  2G3T A;  2PQ8 A;  2AJ6 A;  2F8H A;  1ZO0 A;  4NGT A;  1S5K A;  2PJ6 A;  4JJX A;  3S6K A;  3PBE A;  3EFA A;  4KOS A;  2IJZ A;  3EXN A;  2ZED A;  2HWG A;  4KUA A;  2DXQ A;  3EC4 A;  5AG5 A;  3EY5 A;  3JTK A;  3RYO A;  4UCP A;  2CXA A;  4MHN A;  4C84 A;  5LRJ A;  2X0S A;  4NGN A;  1JWQ A;  4AB7 A;  4HNW B;  4NGM A;  4PSW A;  4TJV A;  5A28 A;  2CIJ A;  1RTQ A;  2GE3 A;  4KOT A;  4PPZ A;  4M6H A;  1Y9W A;  1DIK A;  1RXT A;  3K9T A;  1CPX A;  1QQ9 A;  1F2P A;  4GS4 A;  4HKF A;  1WK4 A;  3W6S A;  4EME A;  3SHP A;  2ANP A;  5HVH A;  1R3N A;  2CBL A;  4RS2 A;  3FNC A;  1AUG A;  4X5K A;  1J3L A;  3KQZ A;  2PJ7 A;  4UF4 A;  2C6C A;  3SI2 A;  2B3V A;  3FXT A;  2OLS A;  3VRR A;  5DWM A;  3FEE A;  1Y0Y A;  3BJ7 A;  3FJU A;  3IIB A;  4M6G A;  3TO7 A;  4AVC A;  5EC4 A;  3LAC A;  4KSI A;  1Y9Z A;  1VHS A;  1LRZ A;  3KI9 A;  4HPS A;  1BPN A;  4UFW A;  4TJX A;  4CAW A;  1Z8L A;  2CTC A;  1M1D A;  4BTF A;  3P2H A;  4MFK A;  1EO0 A;  5JPH A;  3PP9 A;  3QAY A;  3PB9 X;  2ZW6 A;  2OZH A;  2FS5 A;  2ZEG A;  3NFZ A;  4G1P A;  4MFL A;  1BLL E;  4U5Y A;  4FBE A;  3NOJ A;  1ARL A;  1IID A;  2B4J C;  1XJO A;  1QSO A;  2P6E A;  2PJA A;  1U6M A;  1YX0 A;  3DNS A;  4MJX A;  3TX8 A;  4C2Z A;  2R82 A;  2PIZ A;  2ZW7 A;  3T5M A;  3DSB A;  4MXU A;  1I21 A;  4A2Z A;  2C6G A;  1ELM P;  1NSL A;  2D0O A;  1BAV A;  3PB6 X;  1VBH A;  4MFQ A;  2VBQ A;  2V8D A;  2ZOF A;  4COG A;  5JVL A;  4MY0 A;  5HKY A;  4A30 A;  1BXR B;  2Q7S A;  5FD8 A;  1GYT A;  3WC7 A;  1YW6 A;  4MHY A;  2VL1 A;  5THW A;  4J3G A;  1Y9K A;  4KOX A;  5HVG A;  1KC7 A;  4L8A A;  3BUO B;  4AVA A;  4EWT A;  1KZF A;  1LAN A;  3ZNI A;  1ARM A;  1Z8T A;  3D66 A;  3I6S A;  4ORF A;  4YRH A;  4C2X A;  2PVV A;  1Z8X A;  2AFX A;  4MFJ A;  4CGM A;  4OP4 A;  4B5P B;  3GUX A;  2OH1 A;  3TLC A;  4YN3 A;  2PJ0 A;  4UFX A;  4IF5 A;  3MN8 A;  4AG7 A;  1AMP A;  1SQH A;  3BLN A;  3SXN A;  5HMN A;  1B6B A;  5CNP A;  1PUA A;  4PK3 A;  5LRK A;  3CXP A;  3PT1 A;  1AYE A;  4ZY2 A;  3TYX A;  4UEF A;  4Q38 A;  1ZLH A;  3GLJ A;  3L2N A;  5K8M A;  1YSJ A;  2NSM A;  1NSA A;  3O8Z A;  3IWE A;  4K3N A;  4C8U A;  3SJE A;  1S7N A;  3NH8 A;  1VGY A;  1ZLI A;  2B4B A;  4F9U A;  5HXD A;  1M4L A;  2JDC A;  4UFV A;  2CY2 A;  2Q51 A;  3SI0 A;  2YJV A;  1MJ9 A;  2EUI A;  3V38 A;  4E94 A;  5DS0 A;  1IGB A;  3FH4 A;  5KTD A;  3TCV A;  5BY0 A;  3WC5 A;  2HQY A;  4LX9 A;  4P4E A;  4C8P A;  3H5Z A;  1X10 A;  4TNU A;  5F46 A;  2Q4Y A;  2FVG A;  2V8G A;  4WJB A;  4P4D A;  2P6G A;  2PJ2 A;  1RO5 A;  3IU1 A;  4CYN A;  3IU2 A;  4L89 A;  1KBL A;  1S60 A;  2ZEE A;  5JGF A;  1Y0R A;  1A9X B;  1LAP A;  5LYF A;  3GB0 A;  4OAE A;  4UIA A;  1Q2Y A;  4PXE A;  4CAV A;  5ELY A;  3EZB A;  4CO9 A;  2YND A;  3R1K A;  1Q7L A;  3PB7 X;  5G1Z A;  3PFO A;  4R8F A;  4FAI A;  4A32 A;  4P45 A;  2AFM A;  3MGD A;  4OIW A;  2RC4 A;  4C9A A;  4XPL A;  1I12 A;  2XPP A;  1PYT B;  2PDO A;  2Q04 A;  3FIX A;  4MFP A;  4R9M A;  4UIB A;  4JXR A;  2OOT A;  3KL9 A;  5HKW A;  2J9A A;  2XEF A;  4BPU B;  3CDX A;  4NGQ A;  4OME A;  4M85 A;  3MRU A;  4C68 A;  4R7M A;  1M4G A;  2ZXV A;  4PV6 A;  2EZB A;  1TF8 A;  2QVP A;  5AG6 A;  2D0P A;  2PCU A;  1XBU A;  3K9U A;  2HRO A;  4I49 A;  2DLA A;  1OZP A;  4MHD A;  3ZJ0 A;  2REE A;  4OC5 A;  4PXC A;  2XEG A;  2BOA A;  3E0K A;  3RBU A;  3FRM A;  1R57 A;  2J8R A;  1GGO A;  2G9D A;  4XNH C;  2R98 A;  2ZW5 A;  3T9Y A;  3DGV A;  3RAM A;  3SI1 A;  6CPA A;  4A4C A;  4JLY A;  4C8T A;  1XOV A;  2ARH A;  3IC1 A;  4C2Y A;  5F09 A;  3KQX A;  5KTA A;  1JDB C;  1DE4 C;  2BCO A;  2YJT A;  3FEC A;  2FIW A;  1YLO A;  1M6V B;  2PJ3 A;  2WZN A;  2D4P A;  5IB0 A;  2GP4 A;  4B5P A;  3I1U A;  2O53 A;  1KUX A;  1VIX A;  2V77 A;  3KR5 A;  2G0B A;  4MHP A;  3C26 A;  2D4O A;  3VWD A;  4B5O A;  1P4N A;  1IYL A;  1XF8 A;  3QB8 A;  2FT0 A;  2WPW A;  4KUB A;  3R9E A;  1MJB A;  4UEE A;  3RZA A;  5A27 A;  2N3A B;  2Q7B A;  3TOB A;  4YFJ A;  1TIQ A;  4MHZ A;  4ZGY B;  3VWE A;  2Q44 A;  2AFU A;  4XPD B;  3S6F A;  4CPA A;  4NXY A;  3SR3 A;  5F1Y A;  4UEZ A;  2CTB A;  4KNG E;  2OR4 A;  2BSW A;  2I3C A;  4NSQ A;  4BBH A;  2EK9 A;  1QSM A;  2VI7 A;  4KLW A;  3JRU A;  4XPD C;  4CGL A;  4QC6 A;  3HPG G;  1QSN A;  1KUY A;  4P6Y A;  4QB9 A;  4P44 A;  5J8C A;  3TLZ A;  2O4H A;  4JZ0 A;  3R96 A;  1NXJ A;  4FD6 A;  2EZA A; 
#chains in the Genus database with same CATH homology
 3BHX A;  4FUU A;  5LYI A;  4P4F A;  3H8E A;  5LRG A;  1WVM A;  4ZYQ A;  1LFW A;  3QNV A;  1IY7 A;  1H8L A;  1TKH A;  5JH9 A;  2AFO A;  3BXM A;  5HVF A;  3I74 A;  4ZX8 A;  4ZI6 A;  8CPA A;  2ZEL A;  3KAS A;  2HC9 A;  5JM6 A;  4B6Z A;  3IEH A;  3D7H A;  1TF9 A;  4C85 A;  4AXV A;  4IK2 A;  4OID A;  4X3R A;  4H2K A;  3B3T A;  1UWY A;  2V8H A;  4MCS A;  4ONW A;  4CDJ A;  2GLJ A;  4W9Y A;  2GU2 A;  4A38 A;  3B3C A;  3SJX A;  4P10 A;  3FX6 A;  1EE3 P;  5CBM A;  5J1Q A;  2DEA A;  4OC0 A;  3IWW A;  4A37 A;  4CDK A;  3KR4 A;  5LYD A;  3LMS A;  2ABZ A;  1LAM A;  2PJC A;  3KZW A;  7CPA A;  4P4J A;  4YU9 A;  3D7G A;  4C9U A;  1XFO A;  5IR2 A;  2XEI A;  5I4M A;  5IB9 A;  2ZEM A;  1XMB A;  2RFH A;  4ZY2 A;  2PIY A;  3WC6 A;  3BI0 A;  3SJG A;  1PCA A;  2PJ5 A;  2WYR A;  4R76 A;  4P4I A;  1CX8 A;  2POK A;  4NFR A;  3VAT A;  3HUV A;  4C99 A;  3PEI A;  3FVL A;  2RB7 A;  1ZG9 A;  2HB6 A;  4Q7A A;  4RUH A;  4ZY0 A;  1ELL P;  2QYV A;  3KGQ A;  2JEW A;  3LWU A;  5D8N A;  2JBJ A;  1XRY A;  3IFE A;  2PE3 A;  4NJQ A;  3B7I A;  3NH5 A;  1HEE A;  3N5F A;  4C9E A;  4X8I A;  4F9V A;  3B3W A;  1ZG8 A;  3D7D A;  1CP7 A;  2PRQ A;  1TKJ A;  3D68 A;  1FT7 A;  4X2T A;  2PVW A;  2ZEP A;  3S9L A;  3S9N A;  4WWV A;  3PB8 X;  1QMU A;  4ZX9 A;  4OC1 A;  2BO9 A;  1ZG7 A;  2ZEF A;  4PQA A;  4OKO A;  1Z5R A;  1R43 A;  3KHZ A;  5D29 A;  1Y7E A;  3WAB A;  3IO1 A;  2C5Q A;  2Q4Z A;  3S9M A;  4PXD A;  4OC4 A;  4MRI A;  4MCR A;  1CPS A;  3KHX A;  3ISZ A;  3NH4 A;  2PJ8 A;  1LCP A;  2ZOG A;  4IHM A;  3SJF A;  3V7Z A;  4EFD A;  3BI1 A;  2PJ1 A;  4P4B A;  2EWB A;  1CBX A;  4C8A A;  3VAR A;  4NGP A;  4GM5 A;  5K8P A;  2EK8 A;  4DJL A;  1CG2 A;  4KNG E;  1VHE A;  2QJ8 A;  4JYW A;  4ZY1 A;  3VTA A;  4DYO A;  4MCQ A;  4LQG A;  1TXR A;  4O23 A;  1CP6 A;  4OC2 A;  2NYQ A;  2ZEO A;  3B35 A;  3TC8 A;  2F7V A;  3NA6 A;  4FWU A;  2C6P A;  2AFW A;  2C1C A;  1VHO A;  4C9V A;  3D4U A;  2JBK A;  2GRE A;  2Q43 A;  1Z2L A;  2ZEH A;  4F8Z A;  4NJR A;  3CPX A;  4MMO A;  4R6T A;  2GLF A;  3D67 A;  2PJ4 A;  3B3S A;  3IJ3 A;  1FNO A;  3ICU A;  2CF4 A;  3ISX A;  3D7F A;  1JQG A;  2AFS A;  1F57 A;  1BPM A;  4OC3 A;  1YME A;  3H8G A;  4BD9 A;  4NGR A;  1HDQ A;  2IQ6 A;  3CT9 A;  1V6C A;  4YWY A;  4A39 A;  3PBB A;  5CPA A;  2AFZ A;  1XF1 A;  4Z65 A;  3B3V A;  2IMO A;  4C86 A;  3WT4 A;  3K2K A;  1OBR A;  4NGS A;  3T8W A;  2ZEN A;  5K8O A;  3EIF A;  3B2Y A;  1TKF A;  5LYL A;  1KWM A;  4MCP A;  3FMC A;  3FF3 A;  3FED A;  4A94 A;  2XEJ A;  1YW4 A;  3H8F A;  3HLP A;  2PJ9 A;  1F2O A;  1LOK A;  4IAV A;  2PJB A;  4C9R A;  4DUK A;  1DTD A;  3PRT A;  3PFE A;  2V8V A;  4C8F A;  5K8N A;  1HDU A;  3PB4 X;  3DLJ A;  4C8C A;  4TWE A;  3CPA A;  4PXB A;  3VH9 A;  2F8H A;  2PJ6 A;  4NGT A;  3PBE A;  2IJZ A;  2ZED A;  4MHN A;  4C84 A;  5LRJ A;  4NGN A;  4TJV A;  4NGM A;  2CIJ A;  1RTQ A;  4PPZ A;  3K9T A;  1CPX A;  1QQ9 A;  1F2P A;  4EME A;  2ANP A;  5HVH A;  1R3N A;  3KQZ A;  2PJ7 A;  4UF4 A;  2C6C A;  3SI2 A;  3FEE A;  1Y0Y A;  3FJU A;  3IIB A;  1Y9Z A;  4KSI A;  3KI9 A;  1BPN A;  4TJX A;  1Z8L A;  2CTC A;  3PB9 X;  3NFZ A;  2ZEG A;  4G1P A;  4FBE A;  1BLL E;  1ARL A;  1XJO A;  2PJA A;  3TX8 A;  2PIZ A;  4MXU A;  2C6G A;  1ELM P;  1BAV A;  3PB6 X;  2V8D A;  2ZOF A;  1GYT A;  3WC7 A;  1YW6 A;  4MHY A;  2VL1 A;  5THW A;  5HVG A;  4EWT A;  1LAN A;  1ARM A;  3D66 A;  3I6S A;  2PVV A;  2AFX A;  4OP4 A;  3GUX A;  4YN3 A;  2PJ0 A;  3MN8 A;  1AMP A;  5LRK A;  1AYE A;  4UEF A;  1ZLH A;  3GLJ A;  3L2N A;  5K8M A;  1YSJ A;  2NSM A;  1NSA A;  4K3N A;  4C8U A;  3SJE A;  3NH8 A;  1VGY A;  1ZLI A;  4F9U A;  5HXD A;  1M4L A;  2Q51 A;  3SI0 A;  3V38 A;  5DS0 A;  1IGB A;  3FH4 A;  3WC5 A;  4P4E A;  4C8P A;  4TNU A;  2FVG A;  2V8G A;  4WJB A;  4P4D A;  2PJ2 A;  2ZEE A;  5JGF A;  1Y0R A;  1LAP A;  5LYF A;  3GB0 A;  4UIA A;  4PXE A;  5ELY A;  1Q7L A;  3PB7 X;  3PFO A;  4R8F A;  4FAI A;  4P45 A;  2AFM A;  4OIW A;  4C9A A;  1PYT B;  4UIB A;  2OOT A;  3KL9 A;  3CDX A;  2J9A A;  2XEF A;  4NGQ A;  4OME A;  3MRU A;  4R7M A;  1TF8 A;  2QVP A;  2PCU A;  1XBU A;  4OC5 A;  4PXC A;  2XEG A;  2BOA A;  3RBU A;  2G9D A;  3DGV A;  3RAM A;  3SI1 A;  6CPA A;  4C8T A;  3IC1 A;  5F09 A;  3KQX A;  1DE4 C;  2BCO A;  3FEC A;  1YLO A;  2PJ3 A;  2WZN A;  2GP4 A;  3I1U A;  2O53 A;  1VIX A;  2V77 A;  3KR5 A;  4MHP A;  4UEE A;  3RZA A;  4MHZ A;  2AFU A;  4CPA A;  4UEZ A;  2CTB A;  2OR4 A;  2I3C A;  2EK9 A;  3JRU A;  4P6Y A;  4P44 A;  2O4H A;  4JZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...