4NGQA

Crystal structure of glutamate carboxypeptidase ii in a complex with urea-based inhibitor
Total Genus 257
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
257
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Rational design of urea-based glutamate carboxypeptidase II (GCPII) inhibitors as versatile tools for specific drug targeting and delivery
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Glutamate carboxypeptidase 2
total genus 257
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4ngqA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4ngqA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4ngqA02
1VIXA 4OIDA 3ICUA 4BD9A 1PCAA 4OMEA 1F2OA 4DJLA 3CPXA 2ABZA 1XBUA 2ZEDA 3HUVA 1VGYA 1ARMA 4MCPA 4C86A 3NH4A 1ZG9A 4OC3A 4WWVA 4C8PA 5DS0A 3NA6A 1BAVA 4TNUA 3KR4A 3H8FA 1ZG8A 4EMEA 3BI0A 4PXEA 3SI1A 4EWTA 2OOTA 2AFMA 1V6CA 1Y7EA 4DYOA 5F09A 5LYIA 2WZNA 4LQGA 3LMSA 1XF1A 2FVGA 4FBEA 2CTBA 4P4DA 2V8GA 3D4UA 3S9NA 1CBXA 3TX8A 3WC6A 3SJXA 5HXDA 3PB7X 1Y9ZA 4C85A 3I1UA 3SJEA 2ANPA 2AFSA 3ISZA 4MRIA 3DGVA 4R6TA 4UIAA 2CTCA 1BLLE 4X3RA 2O53A 1IGBA 5K8NA 4OKOA 1TKHA 3HLPA 5IB9A 2Q43A 1BPNA 1JQGA 3FVLA 1OBRA 4UIBA 3SI0A 1XJOA 2Q4ZA 1IY7A 2PE3A 4F9UA 3L2NA 4NJQA 2C6CA 2CF4A 2PJ7A 2XEFA 4TJXA 4R8FA 4UEEA 2ZEFA 4C99A 1ZG7A 3IEHA 3B3CA 4CPAA 1NSAA 4ZY1A 3RZAA 1LANA 3FEEA 4MHNA 2GREA 3DLJA 3WT4A 4R7MA 2ZEOA 4NJRA 2PCUA 3B2YA 3PB9X 4YU9A 3KGQA 2ZOFA 3MRUA 2IJZA 4MMOA 4P10A 4Z65A 1CG2A 3FEDA 1BPMA 1PYTB 1YW4A 4OC2A 4NGMA 2EK8A 4K3NA 4ZI6A 3FMCA 2HC9A 5LYDA 4A94A 2PJ0A 2WYRA 4MHYA 3IWWA 3WC5A 4IHMA 3N5FA 3SJFA 4JZ0A 2PJ8A 3BI1A 3EIFA 4P4BA 2V8VA 3BHXA 4MCSA 4A39A 1Z5RA 4CDKA 2GLJA 2O4HA 2AFXA 3D7FA 3CT9A 4C8UA 2ZELA 3VATA 2ZEGA 5J1QA 3NFZA 2VL1A 2BOAA 4NGSA 4RUHA 7CPAA 1EE3P 2QVPA 4NGPA 2POKA 4CDJA 2C1CA 2EWBA 2ZENA 4KSIA 4YWYA 3B35A 3CDXA 3D68A 4C9UA 1LFWA 3WC7A 2PJ1A 1YMEA 3RBUA 1Z8LA 4P45A 3KI9A 1WVMA 4MHZA 4P4JA 4X2TA 4PPZA 4R76A 2F7VA 5CBMA 3FF3A 4C8CA 4GM5A 5LRJA 1CX8A 3KZWA 3H8GA 3PFEA 4UF4A 3GUXA 4O23A 3SJGA 1Y0YA 2PVWA 4KNGE 2QYVA 2BCOA 5JM6A 2F8HA 3LWUA 1GYTA 1ARLA 4EFDA 1ZLIA 2PJ9A 4F9VA 2PJ5A 1TF9A 3GLJA 3VTAA 5K8OA 4NFRA 4TWEA 4MHPA 5HVGA 4FUUA 4YN3A 2AFOA 3KQZA 2PIYA 2PJCA 2I3CA 4C9RA 2ZEPA 2PJ3A 1QQ9A 2JEWA 1CPXA 3IC1A 2XEIA 4P44A 1TXRA 3IFEA 3TC8A 4TJVA 5LYFA 1AYEA 4UEFA 4MCQA 3QNVA 3RAMA 5JGFA 4IK2A 2GLFA 4FAIA 1Y0RA 2V77A 4X8IA 3PRTA 3VARA 3KHZA 1R3NA 3B3WA 2AFUA 1TKFA 1VHEA 1HDUA 4C9VA 4P6YA 1UWYA 2RB7A 2JBKA 3KR5A 1VHOA 5D8NA 1R43A 2PJ2A 4UEZA 3PFOA 3V38A 4AXVA 5D29A 3KQXA 5JH9A 4NGTA 2Q51A 1AMPA 3PBBA 3I6SA 4P4IA 1XMBA 1DE4C 1H8LA 1YSJA 1FT7A 2XEGA 2PIZA 1TKJA 5LYLA 1XRYA 4OC4A 2ZEHA 2ZEMA 3WABA 3FJUA 2NYQA 1M4LA 2PJ6A 2BO9A 4P4FA 1DTDA 3D66A 5ELYA 3FX6A 3GB0A 4ONWA 4B6ZA 8CPAA 5LRKA 4NGNA 3PB6X 4A37A 4DUKA 3PBEA 4ZX8A 4OIWA 5THWA 5HVHA 4OP4A 1LAMA 2EK9A 4OC0A 4FWUA 1F2PA 1LAPA 4A38A 4C84A 3IO1A 4ZY0A 1XFOA 1RTQA 1Q7LA 4MXUA 3K9TA 4OC5A 3T8WA 2PJAA 4JYWA 4W9YA 1LOKA 2ZOGA 3K2KA 1YW6A 3D67A 5I4MA 3S9MA 2ZEEA 2G9DA 3PEIA 4OC1A 4PQAA 5K8MA 3B3SA 6CPAA 5LRGA 1KWMA 2HB6A 3H8EA 4PXBA 1F57A 3D7HA 3S9LA 4G1PA 1ELMP 2J9AA 4C8AA 2PJ4A 3IIBA 2V8DA 4ZYQA 2OR4A 3B3VA 4C8FA 3B7IA 2AFZA 3IJ3A 2XEJA 3CPAA 3KL9A 3MN8A 1HEEA 4PXDA 2GU2A 1FNOA 4NGQA 1ZLHA 2QJ8A 3B3TA 1TF8A 1YLOA 4ZY2A 1LCPA 3FECA 5K8PA 3KHXA 4C9AA 2CIJA 3PB8X 1CP6A 3JRUA 2V8HA 4MCRA 3NH5A 4ZX9A 4Q7AA 2JBJA 2DEAA 3BXMA 4C8TA 5CPAA 2IQ6A 4C9EA 4IAVA 3KASA 2PRQA 3SI2A 1CPSA 2NSMA 2C6GA 3FH4A 1HDQA 3ISXA 3I74A 1CP7A 3V7ZA 5HVFA 3NH8A 4P4EA 4H2KA 4F8ZA 2RFHA 2IMOA 4WJBA 2C6PA 1ELLP 4PXCA 1QMUA 3PB4X 3VH9A 2PJBA 3D7GA 3D7DA 2AFWA 2PVVA 4NGRA 1Z2LA
chains in the Genus database with same CATH superfamily
1FBVA 1VIXA 2DPSA 4YRHA 4OIDA 3QAHA 3ICUA 2MP0A 4BD9A 1PCAA 5F1YA 4OMEA 1F2OA 3IU1A 4KLVA 5AXIA 5HKWA 4DJLA 3CPXA 2ABZA 1XBUA 2ZEDA 1S5KA 3HUVA 4COBA 2R7HA 1VGYA 4M6GA 4ZBGA 3GJZA 3PFVA 1ARMA 4MCPA 4HNYB 4C86A 1K4JA 2F5IA 3OWCA 4KORA 4LUAA 3NH4A 4A33A 4F6AA 3TLGB 2EVNA 1ZG9A 3OP0A 4OC3A 4WWVA 5BWAB 4C8PA 2ZW4A 5DS0A 2HQYA 3NA6A 2Z3MA 2Q0YA 4L8AA 2I00A 1BAVA 5G21A 4TNUA 3EY5A 1R57A 3H8FA 3KR4A 4QBJA 1ZG8A 5J8CA 4NSQA 1RO5A 3T90A 4EMEA 2B3VA 3BI0A 5DWNA 4FD7A 4BPXB 4PXEA 3SI1A 4EWTA 2OOTA 2AFMA 2VZYA 4H6UA 4KOYA 4MFKA 1Y7EA 3R9EA 5A28A 2B58A 1R61A 3TLAA 4DYOA 3VRNA 2AJ6A 5F09A 5LYIA 3RYOA 2WZNA 4LQGA 3NE8A 2ZW7A 3KKWA 3LMSA 4M85A 3PGPA 1XF1A 3UY5A 2FVGA 2ARHA 3W6SA 2CTBA 3BUOB 4P4DA 4M6HA 1M4IA 2V8GA 1IU8A 2A4NA 3D4UA 1XEBA 4CGOA 3S9NA 1CBXA 2R1IA 3TX8A 3SJXA 3EC4A 3WC6A 3PB7X 4CAEA 5HXDA 3U88C 1JDBC 4AG7A 5JQ4A 1Y9ZA 4C85A 3I1UA 3SJEA 1Y7RA 1YQEA 2ANPA 1RXTA 3TLEA 2AFSA 3ISZA 3DSBA 4MRIA 3TLCA 3DGVA 4R6TA 4UCMA 2VEZA 2CTCA 3D2MA 4UIAA 2YNEA 4A2ZA 1BLLE 4X3RA 4KOSA 2O53A 1IGBA 3BJ7A 2J8NA 2HWGA 4LQ6A 2CXAA 4BBHA 4QUSA 4JJXA 3DDDA 3PZJA 3TT2A 5K8NA 4F0XA 1XIXA 4CGNA 4OKOA 2YGWA 3T07A 2BEIA 3DR6A 1TKHA 2XPNA 3HLPA 4LX9A 5IB0A 5IB9A 4PK3A 2Q43A 1MJ9A 1LRZA 1BPNA 1JQGA 3FVLA 1OBRA 4UIBA 3SI0A 1XJOA 2Q4ZA 1IY7A 4RR2B 2PE3A 3DNSA 4F9UA 1CE8B 2DLAA 3L2NA 1I21A 4HPSA 1GHEA 2N3AB 2C6CA 2PQ8A 2PR1A 2CF4A 4NJQA 2PJ7A 5C88A 3VGOA 2XEFA 4TJXA 2E28A 3H5ZA 2Z0ZA 4E8OA 4R8FA 1NSLA 1C3OB 4XNHB 4E2AA 5EMIA 4A95A 4FD6A 4UEEA 4B13A 4ZGYB 2ZEFA 4C99A 4MFJA 4KS9A 4U9YA 1VBHA 4YGOA 4ORFA 1M4GA 1ZG7A 3ZNIA 1Y9WA 2IL4A 2OH1A 5E96A 3IEHA 4NGRA 3HPHE 2VXKA 3B3CA 4CPAA 1NSAA 1N71A 2P0WA 4ZY1A 3BJ8A 3RZAA 4F0YA 1LANA 3FEEA 2FT0A 2VBQA 2Z3OA 4MHNA 3I3GA 3TLYA 2GREA 3DLJA 3WT4A 4R7MA 3EO4A 2ZEOA 1TIQA 4NJRA 2PCUA 3W91A 3P2HA 5AG7A 3B2YA 4KUBA 1IICA 3PB9X 4YU9A 1Q2CA 3KGQA 2ZOFA 3CXSA 4IF5A 3MRUA 3TCVA 2FS5A 2IJZA 3W6XA 3SR3A 2K5TA 4MMOA 4P10A 2GIVA 4JD6A 1CG2A 4Z65A 3FEDA 3RNZA 3R9FA 2ZW6A 2AUMA 3NOJA 1BPMA 3F9KC 1PYTB 1QSOA 1YW4A 3TO7A 4Q38A 4AVCA 4GXHA 4OC2A 4CGPA 4NGMA 5KTCA 3TLBA 2B4BA 2EK8A 4FD5A 5F49A 4K3NA 2OB0A 3NFQA 3VRPA 2Q4VA 1XF8A 4ZI6A 2Y1NA 1WJTA 4CO9A 3FMCA 2HC9A 4CGLA 3EZBA 4IIXA 5LYDA 1S7KA 4KOTA 4B5PA 2Z3NA 4XPKA 4A94A 2PJ0A 5AG5A 2DIKA 2WYRA 4MHYA 4R9MA 1Q5XA 2B5GB 3IWWA 4AVAA 4NXYA 3WC5A 4EYSA 3JVNA 4BPUB 4IHMA 4B12A 3TE4A 3N5FA 1DIKA 3SJFA 4GS4A 4JZ0A 2PJ8A 3BI1A 2VI7A 5F47A 5H84A 1KC7A 4CRZB 3EIFA 3GKRA 4P4BA 2V8VA 3BHXA 1CJWA 2QECA 2X0SA 3U1BA 4MCSA 3CZXA 1Z5RA 2DPTA 5FVJA 4A39A 4CDKA 2GLJA 2O4HA 2AFXA 3D7FA 1PUAA 3CT9A 2EUIA 3TFYA 1S60A 2ZELA 1YX0A 4C8UA 4BMHA 2CY2A 3VATA 2ZEGA 1I1DA 5J1QA 2EZCA 3NFZA 2VL1A 4XNHC 2BOAA 3VWDA 1B87A 1QSRA 1Z8XA 2BUEA 1VI4A 3EZEA 2QIRA 1C30B 4NGSA 2YNDA 2HV2A 1A2ZA 4H89A 1EE3P 2QVPA 4RUHA 7CPAA 4NGPA 3PP9A 2POKA 1J3LA 2GP4A 3K4IA 4CDJA 2C1CA 2EWBA 4GPLB 2ZENA 2UV8G 3S6FA 3CXQA 2P6GA 4KSIA 4MY3A 4YWYA 1NMTA 4B5PB 3B35A 3CDXA 3D68A 3PLFB 4QB9A 2ZPAA 5IV0A 4C9UA 1LFWA 3K9UA 3WC7A 1EZAA 4KOUA 2OLSA 2PJ1A 1YMEA 1YVKA 4JXQA 4CRYB 2REEA 3G8WA 4KLWA 4YFJA 2I79A 4OADA 3RBUA 4MFLA 1Z8LA 4P45A 3KI9A 1WVMA 4MHZA 4P4JA 4X2TA 4PPZA 4R76A 3T05A 5JPHA 1YK3A 4CZ1A 2F7VA 1ZYMA 2G3TA 3B8GA 4CAVA 1X12A 3FYNA 4B10A 5CBMA 3FF3A 4C8CA 4GM5A 5LRJA 3G23A 1CX8A 4H6ZA 3KZWA 3H8GA 1VHSA 3PFEA 4KVME 4UF4A 3DR8A 3GUXA 5F48A 2AUNA 4O23A 3BUXB 3SJGA 1Y0YA 4E0AA 1A9XB 2PVWA 1S7NA 3TOAA 4KNGE 2QYVA 2WPWA 3BUMB 2KCWA 2BCOA 5JM6A 2Q7SA 3GIUA 2YJTA 4ONUA 4PV6A 4I49A 4MJXA 1M4DA 5KTAA 1IYLA 1IYKA 1WK4A 2F8HA 1VKCA 3OB2B 3LWUA 5A27A 5G1ZA 2O28A 1GYTA 1MJBA 1ARLA 2Z3PA 3LACA 2FM4A 4UCPA 5JVLA 3F0AA 5F9MA 2GANA 4EFDA 1ZLIA 2PJ9A 4F9VA 3PT1A 2FSRA 2PJ5A 1TF9A 4CAWA 3OAKA 4A4BA 3GLJA 4C7IA 3VTAA 1WWZA 3V8IA 5K8OA 4MBUA 4NFRA 4TWEA 2ZXVA 2B5GA 4MHPA 5HVGA 3FIXA 4II9A 4FUUA 5AG6A 4YN3A 2AFOA 3KQZA 3T9YA 2PIYA 4KOVA 1YVHA 4PSXA 2PJCA 2I3CA 1B6BA 3SHPA 2EO8A 1JWQA 2ZEPA 2PJ3A 5IR2A 4C9RA 4COGA 5BY0A 1FY7A 1QQ9A 5AG4A 4HKFA 4UBRA 1BXRB 3F5BA 2CBLA 2JEWA 4JLYA 2PC1A 1CPXA 3IC1A 2XEIA 4P44A 1TXRA 1YGHA 3IFEA 3TC8A 1Z4EA 3TO6A 4TJVA 3HMJG 5LYFA 1AYEA 4UEFA 2JDDA 4MCQA 1YREA 3QNVA 2WSAA 4JVOA 3RAMA 5JGFA 2B4DA 2GLFA 4IK2A 4QVTA 2YNCA 4FAIA 4UWIA 3C26A 1Y0RA 2RC4A 2V77A 4X8IA 1UFHA 3PRTA 3VARA 1NBWA 3G3SA 1R3NA 3KHZA 4KSFA 4M6IA 1OZPA 1MK4A 3KRVA 3B3WA 1CM0A 2AFUA 1TKFA 1Q2DA 1VHEA 1HDUA 1M1DA 4C9VA 4P6YA 1UWYA 2H5MA 2JBKA 2REFA 1VHOA 2RB7A 3KR5A 2C5QA 1Z9UA 3FB3A 3IGRA 4R3KA 1KUVA 1M44A 2D4OA 5D8NA 1R43A 2PJ2A 4R3LA 4B11A 3ZJ0A 2C27A 3PFOA 4UEZA 3SXNA 1P0HA 3TOBA 3V38A 5D29A 1L0CA 3KQXA 1BO4A 4NGTA 4AXVA 4QC6A 2Q51A 4UWJA 5EBVA 1AMPA 1IB1E 1ON0A 1QSMA 3PBBA 3I6SA 4P4IA 4E94A 1EZBA 3VRQA 1PU9A 5K99A 1XMBA 3VWEA 4R57A 1DE4C 2GFQA 1GGOA 1H8LA 1P4NA 1YSJA 4M3SA 4MFPA 4MY0A 1SQHA 5J3XA 5C82A 1FT7A 4EVYA 3TYXA 4MFQA 2XEGA 2PIZA 1TKJA 3S6GA 3S6KA 5LYLA 5JYBA 2R8VA 1XRYA 4HNXB 4AVBA 4OC4A 2ZEHA 2ZEMA 3WABA 3FJUA 2NYQA 3BUNB 2B4JC 1Q2YA 1M4LA 4KVXA 4XPDC 4C68A 2PJ6A 2BO9A 4C2ZA 4KSAA 2ATRA 4P4FA 2GE3A 2BL1A 1DTDA 1Y9KA 3D66A 2JLMA 3FRMA 2XPLA 3D3SA 3TO9A 5ELYA 3R95A 1Z9EA 3FX6A 3GB0A 3QAYA 4ONWA 4B6ZA 4KUAA 4B5OA 4CYNA 1B47A 8CPAA 4NGNA 3PB6X 5LRKA 4INJA 2R98A 2DXQA 2OZUA 3H4QA 2JEVA 1AUGA 4A37A 4DUKA 5F13A 3PBEA 4ZX8A 4OIWA 2QMLA 5THWA 3RO0A 3HPGG 5HVHA 4OP4A 1LAMA 4NF1A 2DF5A 2VQYA 1M6VB 2EK9A 4OC0A 4FWUA 1F2PA 1LAPA 2CNTA 2YNCC 2HI6A 4A38A 2PCNA 3LD2A 4PSWA 3IO1A 4ZY0A 1YLEA 2G3AA 4C84A 1KBLA 2XPPA 1XFOA 1RTQA 1Q7LA 1XOVA 2OU2A 2PRBA 4K30A 4MXUA 1CS0B 3K9TA 4UFXA 4OC5A 3IWGA 3SXOA 2CNSA 3T8WA 2J8RA 2EZBA 2PJAA 3E0KA 4JYWA 4W9YA 5AGEA 1LOKA 4UCNA 2ZOGA 3K2KA 4L89A 2Z11A 2Q7BA 5F5XA 1YW6A 1KEEB 4IUSA 3JUWA 4Y49B 1MJAA 2Q4YA 3BLNA 3D67A 1Z4RA 1V0CA 2P6EA 4KOXA 5I4MA 2EBJA 3S9MA 4NCZA 4M8DA 4A32A 2ZEEA 4KZTA 2G9DA 1YVOA 1XE4A 5F46A 1VBGA 3PEIA 1ZO0A 1KUYA 3CXPA 4OC1A 2WUUA 2FCKA 4PQAA 3GYAA 4X5KA 1IOIA 5K8MA 3B3SA 4Y49C 6CPAA 5LRGA 1KWMA 2HB6A 1JDEA 1S3ZA 3H8EA 4PXBA 5I0CA 3FXTA 1V6CA 4RI1A 4MI1A 2P6FA 4MJ8A 4UA3A 4U9ZA 1F57A 3ZZIA 3D7HA 4UFWA 4CYOA 3S9LA 4G1PA 1ELMP 2J9AA 5G20A 4CAXA 2PJ4A 5HMNA 3IIBA 4C8AA 2V8DA 4ZYQA 2OR4A 3OB1B 3B3VA 4C8FA 1I12A 3B7IA 2AFZA 3IJ3A 3NE7A 3WR7A 1XMTA 2XEJA 2XPOA 4J0NA 2EZAA 3CPAA 4XPDB 4C2XA 1X10A 3P2FA 4PK2A 3KL9A 1T36B 5HH1A 3MN8A 1HEEA 4C2YA 1NXJA 3VRRA 2Z10A 4XPLA 1QSTA 1ZRSA 4PXDA 3QB8A 1NE9A 2HROA 5ISVA 2GU2A 3T0TA 4BTFA 2FIWA 1FNOA 2Z3LA 5J8FA 3TLZA 4NGQA 1IOFA 1ZLHA 2QJ8A 2JDCA 4CYPA 2AE6A 1YLOA 1TF8A 3B3TA 4ZY2A 3D8PA 1LCPA 3GY9A 3FECA 2FL4A 5K8PA 4A4CA 1S7FA 3KHXA 4DNCA 1IIDA 4NEXA 3R1KA 4C9AA 3R9GA 4C7HA 2CIJA 3PB8X 4MFZA 1CP6A 2Y0MA 1ZL0A 3F8KA 3JRUA 2PR8A 2V8HA 2PSWA 3N7ZA 4KOWA 3VROA 3FBUA 4R87A 5FD8A 4E5SA 4RS2A 4MCRA 3EZAA 3NH5A 4ZX9A 4Q7AA 2JBJA 2YJVA 2DEAA 3TTHA 3BXMA 4C8TA 3A9LA 5CPAA 2OZHA 4HNWB 1QSNA 5CNPA 5EC4A 2G0BA 3C8OA 2Q44A 5HKZA 2IQ6A 4MI4A 2X7BA 2R82A 4C9EA 3R96A 2VKZG 2B3UA 2FE7A 4IAVA 2D0PA 1EO0A 3KASA 2VZZA 3EFAA 5HKYA 4FBEA 5KTDA 1U6MA 2PRQA 3SI2A 5DWMA 1CPSA 1J4JA 4JXRA 5JH9A 2D4PA 2Y1MA 2HUZA 1KZFA 5GCNA 2PDOA 3S6HA 4AB7A 2NSMA 2FXFA 3MGDA 2BSWA 1KUXA 2C6GA 4U5YA 5G22A 3FH4A 1HDQA 3ISXA 4CYQA 3TLGA 5IX3A 2ZW5A 3LODA 4B14A 2Q04A 4BINA 3I74A 1Z8WA 1CP7A 2Z3KA 1YR0A 3BUWB 2J8MA 3V7ZA 3I9SA 2NMTA 3NH8A 5HVFA 1BOBA 4H1HA 4P4EA 3EXNA 2CNMA 4J3GA 4AG9A 4H2KA 4MHDA 4OLLA 4F8ZA 2RFHA 4CAFA 4CS0B 2IMOA 4FD4A 2WPXA 2B4DB 4JWPA 3IWEA 4WJBA 5H86A 2D0OA 4BPWB 2C6PA 1ELLP 4PXCA 3FNCA 3T5MA 4A30A 4UFVA 1QMUA 2FIAA 3PB4X 2OZGA 1Z8TA 4Q36A 4RN7A 4IIYA 2ODFA 1S7LA 3IU2A 4CGMA 2B0AA 4OAEA 2PJBA 3VH9A 3D7GA 3D7DA 2AFWA 4A31A 3D2PA 4KVOE 2PVVA 3JTKA 3O8ZA 1Z2LA
chains in the Genus database with same CATH topology
1VIXA 4OIDA 3ICUA 4BD9A 1PCAA 4OMEA 1F2OA 4DJLA 3CPXA 2ABZA 1XBUA 2ZEDA 3HUVA 1VGYA 1ARMA 4MCPA 4C86A 3NH4A 1ZG9A 4OC3A 4WWVA 4C8PA 5DS0A 3NA6A 1BAVA 4TNUA 3KR4A 3H8FA 1ZG8A 4EMEA 3BI0A 4PXEA 3SI1A 4EWTA 2OOTA 2AFMA 1V6CA 1Y7EA 4DYOA 5F09A 5LYIA 2WZNA 4LQGA 3LMSA 1XF1A 2FVGA 4FBEA 2CTBA 4P4DA 2V8GA 3D4UA 3S9NA 1CBXA 3TX8A 3WC6A 3SJXA 5HXDA 3PB7X 1Y9ZA 4C85A 3I1UA 3SJEA 2ANPA 2AFSA 3ISZA 4MRIA 3DGVA 4R6TA 4UIAA 2CTCA 1BLLE 4X3RA 2O53A 1IGBA 5K8NA 4OKOA 1TKHA 3HLPA 5IB9A 2Q43A 1BPNA 1JQGA 3FVLA 1OBRA 4UIBA 3SI0A 1XJOA 2Q4ZA 1IY7A 2PE3A 4F9UA 3L2NA 4NJQA 2C6CA 2CF4A 2PJ7A 2XEFA 4TJXA 4R8FA 4UEEA 2ZEFA 4C99A 1ZG7A 3IEHA 3B3CA 4CPAA 1NSAA 4ZY1A 3RZAA 1LANA 3FEEA 4MHNA 2GREA 3DLJA 3WT4A 4R7MA 2ZEOA 4NJRA 2PCUA 3B2YA 3PB9X 4YU9A 3KGQA 2ZOFA 3MRUA 2IJZA 4MMOA 4P10A 4Z65A 1CG2A 3FEDA 1BPMA 1PYTB 1YW4A 4OC2A 4NGMA 2EK8A 4K3NA 4ZI6A 3FMCA 2HC9A 5LYDA 4A94A 2PJ0A 2WYRA 4MHYA 3IWWA 3WC5A 4IHMA 3N5FA 3SJFA 4JZ0A 2PJ8A 3BI1A 3EIFA 4P4BA 2V8VA 3BHXA 4MCSA 4A39A 1Z5RA 4CDKA 2GLJA 2O4HA 2AFXA 3D7FA 3CT9A 4C8UA 2ZELA 3VATA 2ZEGA 5J1QA 3NFZA 2VL1A 2BOAA 4NGSA 4RUHA 7CPAA 1EE3P 2QVPA 4NGPA 2POKA 2GP4A 4CDJA 2C1CA 2EWBA 2ZENA 4KSIA 4YWYA 3B35A 3CDXA 3D68A 4C9UA 1LFWA 3WC7A 2PJ1A 1YMEA 3RBUA 1Z8LA 4P45A 3KI9A 1WVMA 4MHZA 4P4JA 4X2TA 4PPZA 4R76A 2F7VA 5CBMA 3FF3A 4C8CA 4GM5A 5LRJA 1CX8A 3KZWA 3H8GA 3PFEA 4UF4A 3GUXA 4O23A 3SJGA 1Y0YA 2PVWA 4KNGE 2QYVA 2BCOA 5JM6A 2F8HA 3LWUA 1GYTA 1ARLA 4EFDA 1ZLIA 2PJ9A 4F9VA 2PJ5A 1TF9A 3GLJA 3VTAA 5K8OA 4NFRA 4TWEA 4MHPA 5HVGA 4FUUA 4YN3A 2AFOA 3KQZA 2PIYA 2PJCA 2I3CA 5IR2A 4C9RA 2ZEPA 2PJ3A 1QQ9A 2JEWA 1CPXA 3IC1A 2XEIA 4P44A 1TXRA 3IFEA 3TC8A 4TJVA 5LYFA 1AYEA 4UEFA 4MCQA 3QNVA 3RAMA 5JGFA 4IK2A 2GLFA 4FAIA 1Y0RA 2V77A 4X8IA 3PRTA 3VARA 3KHZA 1R3NA 3B3WA 2AFUA 1TKFA 1VHEA 1HDUA 4C9VA 4P6YA 1UWYA 2RB7A 2JBKA 3KR5A 1VHOA 2C5QA 5D8NA 1R43A 2PJ2A 4UEZA 3PFOA 3V38A 4AXVA 5D29A 3KQXA 5JH9A 4NGTA 2Q51A 1AMPA 3PBBA 3I6SA 4P4IA 1XMBA 1DE4C 1H8LA 1YSJA 1FT7A 2XEGA 2PIZA 1TKJA 5LYLA 1XRYA 4OC4A 2ZEHA 2ZEMA 3WABA 3FJUA 2NYQA 1M4LA 2PJ6A 2BO9A 4P4FA 1DTDA 3D66A 5ELYA 3FX6A 3GB0A 4ONWA 4B6ZA 8CPAA 5LRKA 4NGNA 3PB6X 4A37A 4DUKA 3PBEA 4ZX8A 4OIWA 5THWA 5HVHA 4OP4A 1LAMA 2EK9A 4OC0A 4FWUA 1F2PA 1LAPA 4A38A 4C84A 3IO1A 4ZY0A 1XFOA 1RTQA 1Q7LA 4MXUA 3K9TA 4OC5A 3T8WA 2PJAA 4JYWA 4W9YA 1LOKA 2ZOGA 3K2KA 1YW6A 3D67A 5I4MA 3S9MA 2ZEEA 2G9DA 3PEIA 4OC1A 4PQAA 5K8MA 3B3SA 6CPAA 5LRGA 1KWMA 2HB6A 3H8EA 4PXBA 1F57A 3D7HA 3S9LA 4G1PA 1ELMP 2J9AA 4C8AA 2PJ4A 3IIBA 2V8DA 4ZYQA 2OR4A 3B3VA 4C8FA 3B7IA 2AFZA 3IJ3A 2XEJA 3CPAA 3KL9A 3MN8A 1HEEA 4PXDA 2GU2A 1FNOA 4NGQA 1ZLHA 2QJ8A 3B3TA 1TF8A 1YLOA 4ZY2A 1LCPA 3FECA 5K8PA 3KHXA 4C9AA 2CIJA 3PB8X 1CP6A 3JRUA 2V8HA 4MCRA 3NH5A 4ZX9A 4Q7AA 2JBJA 2DEAA 3BXMA 4C8TA 5CPAA 2IQ6A 4C9EA 4IAVA 3KASA 2PRQA 3SI2A 1CPSA 2NSMA 2C6GA 3FH4A 1HDQA 3ISXA 3I74A 1CP7A 3V7ZA 5HVFA 3NH8A 4P4EA 4H2KA 4F8ZA 2RFHA 2IMOA 4WJBA 2C6PA 1ELLP 4PXCA 1QMUA 3PB4X 3VH9A 2PJBA 3D7GA 3D7DA 2AFWA 2PVVA 4NGRA 1Z2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VIX A;  4OID A;  3ICU A;  4BD9 A;  1PCA A;  4OME A;  1F2O A;  4DJL A;  3CPX A;  2ABZ A;  1XBU A;  2ZED A;  3HUV A;  1VGY A;  1ARM A;  4MCP A;  4C86 A;  3NH4 A;  1ZG9 A;  4OC3 A;  4WWV A;  4C8P A;  5DS0 A;  3NA6 A;  1BAV A;  4TNU A;  3KR4 A;  3H8F A;  1ZG8 A;  4EME A;  3BI0 A;  4PXE A;  3SI1 A;  4EWT A;  2OOT A;  2AFM A;  1V6C A;  1Y7E A;  4DYO A;  5F09 A;  5LYI A;  2WZN A;  4LQG A;  3LMS A;  1XF1 A;  2FVG A;  4FBE A;  2CTB A;  4P4D A;  2V8G A;  3D4U A;  3S9N A;  1CBX A;  3TX8 A;  3WC6 A;  3SJX A;  5HXD A;  3PB7 X;  1Y9Z A;  4C85 A;  3I1U A;  3SJE A;  2ANP A;  2AFS A;  3ISZ A;  4MRI A;  3DGV A;  4R6T A;  4UIA A;  2CTC A;  1BLL E;  4X3R A;  2O53 A;  1IGB A;  5K8N A;  4OKO A;  1TKH A;  3HLP A;  5IB9 A;  2Q43 A;  1BPN A;  1JQG A;  3FVL A;  1OBR A;  4UIB A;  3SI0 A;  1XJO A;  2Q4Z A;  1IY7 A;  2PE3 A;  4F9U A;  3L2N A;  4NJQ A;  2C6C A;  2CF4 A;  2PJ7 A;  2XEF A;  4TJX A;  4R8F A;  4UEE A;  2ZEF A;  4C99 A;  1ZG7 A;  3IEH A;  3B3C A;  4CPA A;  1NSA A;  4ZY1 A;  3RZA A;  1LAN A;  3FEE A;  4MHN A;  2GRE A;  3DLJ A;  3WT4 A;  4R7M A;  2ZEO A;  4NJR A;  2PCU A;  3B2Y A;  3PB9 X;  4YU9 A;  3KGQ A;  2ZOF A;  3MRU A;  2IJZ A;  4MMO A;  4P10 A;  4Z65 A;  1CG2 A;  3FED A;  1BPM A;  1PYT B;  1YW4 A;  4OC2 A;  4NGM A;  2EK8 A;  4K3N A;  4ZI6 A;  3FMC A;  2HC9 A;  5LYD A;  4A94 A;  2PJ0 A;  2WYR A;  4MHY A;  3IWW A;  3WC5 A;  4IHM A;  3N5F A;  3SJF A;  4JZ0 A;  2PJ8 A;  3BI1 A;  3EIF A;  4P4B A;  2V8V A;  3BHX A;  4MCS A;  4A39 A;  1Z5R A;  4CDK A;  2GLJ A;  2O4H A;  2AFX A;  3D7F A;  3CT9 A;  4C8U A;  2ZEL A;  3VAT A;  2ZEG A;  5J1Q A;  3NFZ A;  2VL1 A;  2BOA A;  4NGS A;  4RUH A;  7CPA A;  1EE3 P;  2QVP A;  4NGP A;  2POK A;  4CDJ A;  2C1C A;  2EWB A;  2ZEN A;  4KSI A;  4YWY A;  3B35 A;  3CDX A;  3D68 A;  4C9U A;  1LFW A;  3WC7 A;  2PJ1 A;  1YME A;  3RBU A;  1Z8L A;  4P45 A;  3KI9 A;  1WVM A;  4MHZ A;  4P4J A;  4X2T A;  4PPZ A;  4R76 A;  2F7V A;  5CBM A;  3FF3 A;  4C8C A;  4GM5 A;  5LRJ A;  1CX8 A;  3KZW A;  3H8G A;  3PFE A;  4UF4 A;  3GUX A;  4O23 A;  3SJG A;  1Y0Y A;  2PVW A;  4KNG E;  2QYV A;  2BCO A;  5JM6 A;  2F8H A;  3LWU A;  1GYT A;  1ARL A;  4EFD A;  1ZLI A;  2PJ9 A;  4F9V A;  2PJ5 A;  1TF9 A;  3GLJ A;  3VTA A;  5K8O A;  4NFR A;  4TWE A;  4MHP A;  5HVG A;  4FUU A;  4YN3 A;  2AFO A;  3KQZ A;  2PIY A;  2PJC A;  2I3C A;  4C9R A;  2ZEP A;  2PJ3 A;  1QQ9 A;  2JEW A;  1CPX A;  3IC1 A;  2XEI A;  4P44 A;  1TXR A;  3IFE A;  3TC8 A;  4TJV A;  5LYF A;  1AYE A;  4UEF A;  4MCQ A;  3QNV A;  3RAM A;  5JGF A;  4IK2 A;  2GLF A;  4FAI A;  1Y0R A;  2V77 A;  4X8I A;  3PRT A;  3VAR A;  3KHZ A;  1R3N A;  3B3W A;  2AFU A;  1TKF A;  1VHE A;  1HDU A;  4C9V A;  4P6Y A;  1UWY A;  2RB7 A;  2JBK A;  3KR5 A;  1VHO A;  5D8N A;  1R43 A;  2PJ2 A;  4UEZ A;  3PFO A;  3V38 A;  4AXV A;  5D29 A;  3KQX A;  5JH9 A;  4NGT A;  2Q51 A;  1AMP A;  3PBB A;  3I6S A;  4P4I A;  1XMB A;  1DE4 C;  1H8L A;  1YSJ A;  1FT7 A;  2XEG A;  2PIZ A;  1TKJ A;  5LYL A;  1XRY A;  4OC4 A;  2ZEH A;  2ZEM A;  3WAB A;  3FJU A;  2NYQ A;  1M4L A;  2PJ6 A;  2BO9 A;  4P4F A;  1DTD A;  3D66 A;  5ELY A;  3FX6 A;  3GB0 A;  4ONW A;  4B6Z A;  8CPA A;  5LRK A;  4NGN A;  3PB6 X;  4A37 A;  4DUK A;  3PBE A;  4ZX8 A;  4OIW A;  5THW A;  5HVH A;  4OP4 A;  1LAM A;  2EK9 A;  4OC0 A;  4FWU A;  1F2P A;  1LAP A;  4A38 A;  4C84 A;  3IO1 A;  4ZY0 A;  1XFO A;  1RTQ A;  1Q7L A;  4MXU A;  3K9T A;  4OC5 A;  3T8W A;  2PJA A;  4JYW A;  4W9Y A;  1LOK A;  2ZOG A;  3K2K A;  1YW6 A;  3D67 A;  5I4M A;  3S9M A;  2ZEE A;  2G9D A;  3PEI A;  4OC1 A;  4PQA A;  5K8M A;  3B3S A;  6CPA A;  5LRG A;  1KWM A;  2HB6 A;  3H8E A;  4PXB A;  1F57 A;  3D7H A;  3S9L A;  4G1P A;  1ELM P;  2J9A A;  4C8A A;  2PJ4 A;  3IIB A;  2V8D A;  4ZYQ A;  2OR4 A;  3B3V A;  4C8F A;  3B7I A;  2AFZ A;  3IJ3 A;  2XEJ A;  3CPA A;  3KL9 A;  3MN8 A;  1HEE A;  4PXD A;  2GU2 A;  1FNO A;  4NGQ A;  1ZLH A;  2QJ8 A;  3B3T A;  1TF8 A;  1YLO A;  4ZY2 A;  1LCP A;  3FEC A;  5K8P A;  3KHX A;  4C9A A;  2CIJ A;  3PB8 X;  1CP6 A;  3JRU A;  2V8H A;  4MCR A;  3NH5 A;  4ZX9 A;  4Q7A A;  2JBJ A;  2DEA A;  3BXM A;  4C8T A;  5CPA A;  2IQ6 A;  4C9E A;  4IAV A;  3KAS A;  2PRQ A;  3SI2 A;  1CPS A;  2NSM A;  2C6G A;  3FH4 A;  1HDQ A;  3ISX A;  3I74 A;  1CP7 A;  3V7Z A;  5HVF A;  3NH8 A;  4P4E A;  4H2K A;  4F8Z A;  2RFH A;  2IMO A;  4WJB A;  2C6P A;  1ELL P;  4PXC A;  1QMU A;  3PB4 X;  3VH9 A;  2PJB A;  3D7G A;  3D7D A;  2AFW A;  2PVV A;  4NGR A;  1Z2L A; 
#chains in the Genus database with same CATH topology
 1FBV A;  1VIX A;  2DPS A;  4YRH A;  4OID A;  3QAH A;  3ICU A;  2MP0 A;  4BD9 A;  1PCA A;  5F1Y A;  4OME A;  1F2O A;  3IU1 A;  4KLV A;  5AXI A;  5HKW A;  4DJL A;  3CPX A;  2ABZ A;  1XBU A;  2ZED A;  1S5K A;  3HUV A;  4COB A;  2R7H A;  1VGY A;  4M6G A;  4ZBG A;  3GJZ A;  3PFV A;  1ARM A;  4MCP A;  4HNY B;  4C86 A;  1K4J A;  2F5I A;  3OWC A;  4KOR A;  4LUA A;  3NH4 A;  4A33 A;  4F6A A;  3TLG B;  2EVN A;  1ZG9 A;  3OP0 A;  4OC3 A;  4WWV A;  5BWA B;  4C8P A;  2ZW4 A;  5DS0 A;  2HQY A;  3NA6 A;  2Z3M A;  2Q0Y A;  4L8A A;  2I00 A;  1BAV A;  5G21 A;  4TNU A;  3EY5 A;  1R57 A;  3H8F A;  3KR4 A;  4QBJ A;  1ZG8 A;  5J8C A;  4NSQ A;  1RO5 A;  3T90 A;  4EME A;  2B3V A;  3BI0 A;  5DWN A;  4FD7 A;  4BPX B;  4PXE A;  3SI1 A;  4EWT A;  2OOT A;  2AFM A;  2VZY A;  4H6U A;  4KOY A;  4MFK A;  1Y7E A;  3R9E A;  5A28 A;  2B58 A;  1R61 A;  3TLA A;  4DYO A;  3VRN A;  2AJ6 A;  5F09 A;  5LYI A;  3RYO A;  2WZN A;  4LQG A;  3NE8 A;  2ZW7 A;  3KKW A;  3LMS A;  4M85 A;  3PGP A;  1XF1 A;  3UY5 A;  2FVG A;  2ARH A;  3W6S A;  2CTB A;  3BUO B;  4P4D A;  4M6H A;  1M4I A;  2V8G A;  1IU8 A;  2A4N A;  3D4U A;  1XEB A;  4CGO A;  3S9N A;  1CBX A;  2R1I A;  3TX8 A;  3SJX A;  3EC4 A;  3WC6 A;  3PB7 X;  4CAE A;  5HXD A;  3U88 C;  1JDB C;  4AG7 A;  5JQ4 A;  1Y9Z A;  4C85 A;  3I1U A;  3SJE A;  1Y7R A;  1YQE A;  2ANP A;  1RXT A;  3TLE A;  2AFS A;  3ISZ A;  3DSB A;  4MRI A;  3TLC A;  3DGV A;  4R6T A;  4UCM A;  2VEZ A;  2CTC A;  3D2M A;  4UIA A;  2YNE A;  4A2Z A;  1BLL E;  4X3R A;  4KOS A;  2O53 A;  1IGB A;  3BJ7 A;  2J8N A;  2HWG A;  4LQ6 A;  2CXA A;  4BBH A;  4QUS A;  4JJX A;  3DDD A;  3PZJ A;  3TT2 A;  5K8N A;  4F0X A;  1XIX A;  4CGN A;  4OKO A;  2YGW A;  3T07 A;  2BEI A;  3DR6 A;  1TKH A;  2XPN A;  3HLP A;  4LX9 A;  5IB0 A;  5IB9 A;  4PK3 A;  2Q43 A;  1MJ9 A;  1LRZ A;  1BPN A;  1JQG A;  3FVL A;  1OBR A;  4UIB A;  3SI0 A;  1XJO A;  2Q4Z A;  1IY7 A;  4RR2 B;  2PE3 A;  3DNS A;  4F9U A;  1CE8 B;  2DLA A;  3L2N A;  1I21 A;  4HPS A;  1GHE A;  2N3A B;  2C6C A;  2PQ8 A;  2PR1 A;  2CF4 A;  4NJQ A;  2PJ7 A;  5C88 A;  3VGO A;  2XEF A;  4TJX A;  2E28 A;  3H5Z A;  2Z0Z A;  4E8O A;  4R8F A;  1NSL A;  1C3O B;  4XNH B;  4E2A A;  5EMI A;  4A95 A;  4FD6 A;  4UEE A;  4B13 A;  4ZGY B;  2ZEF A;  4C99 A;  4MFJ A;  4KS9 A;  4U9Y A;  1VBH A;  4YGO A;  4ORF A;  1M4G A;  1ZG7 A;  3ZNI A;  1Y9W A;  2IL4 A;  2OH1 A;  5E96 A;  3IEH A;  4NGR A;  3HPH E;  2VXK A;  3B3C A;  4CPA A;  1NSA A;  1N71 A;  2P0W A;  4ZY1 A;  3BJ8 A;  3RZA A;  4F0Y A;  1LAN A;  3FEE A;  2FT0 A;  2VBQ A;  2Z3O A;  4MHN A;  3I3G A;  3TLY A;  2GRE A;  3DLJ A;  3WT4 A;  4R7M A;  3EO4 A;  2ZEO A;  1TIQ A;  4NJR A;  2PCU A;  3W91 A;  3P2H A;  5AG7 A;  3B2Y A;  4KUB A;  1IIC A;  3PB9 X;  4YU9 A;  1Q2C A;  3KGQ A;  2ZOF A;  3CXS A;  4IF5 A;  3MRU A;  3TCV A;  2FS5 A;  2IJZ A;  3W6X A;  3SR3 A;  2K5T A;  4MMO A;  4P10 A;  2GIV A;  4JD6 A;  1CG2 A;  4Z65 A;  3FED A;  3RNZ A;  3R9F A;  2ZW6 A;  2AUM A;  3NOJ A;  1BPM A;  3F9K C;  1PYT B;  1QSO A;  1YW4 A;  3TO7 A;  4Q38 A;  4AVC A;  4GXH A;  4OC2 A;  4CGP A;  4NGM A;  5KTC A;  3TLB A;  2B4B A;  2EK8 A;  4FD5 A;  5F49 A;  4K3N A;  2OB0 A;  3NFQ A;  3VRP A;  2Q4V A;  1XF8 A;  4ZI6 A;  2Y1N A;  1WJT A;  4CO9 A;  3FMC A;  2HC9 A;  4CGL A;  3EZB A;  4IIX A;  5LYD A;  1S7K A;  4KOT A;  4B5P A;  2Z3N A;  4XPK A;  4A94 A;  2PJ0 A;  5AG5 A;  2DIK A;  2WYR A;  4MHY A;  4R9M A;  1Q5X A;  2B5G B;  3IWW A;  4AVA A;  4NXY A;  3WC5 A;  4EYS A;  3JVN A;  4BPU B;  4IHM A;  4B12 A;  3TE4 A;  3N5F A;  1DIK A;  3SJF A;  4GS4 A;  4JZ0 A;  2PJ8 A;  3BI1 A;  2VI7 A;  5F47 A;  5H84 A;  1KC7 A;  4CRZ B;  3EIF A;  3GKR A;  4P4B A;  2V8V A;  3BHX A;  1CJW A;  2QEC A;  2X0S A;  3U1B A;  4MCS A;  3CZX A;  1Z5R A;  2DPT A;  5FVJ A;  4A39 A;  4CDK A;  2GLJ A;  2O4H A;  2AFX A;  3D7F A;  1PUA A;  3CT9 A;  2EUI A;  3TFY A;  1S60 A;  2ZEL A;  1YX0 A;  4C8U A;  4BMH A;  2CY2 A;  3VAT A;  2ZEG A;  1I1D A;  5J1Q A;  2EZC A;  3NFZ A;  2VL1 A;  4XNH C;  2BOA A;  3VWD A;  1B87 A;  1QSR A;  1Z8X A;  2BUE A;  1VI4 A;  3EZE A;  2QIR A;  1C30 B;  4NGS A;  2YND A;  2HV2 A;  1A2Z A;  4H89 A;  1EE3 P;  2QVP A;  4RUH A;  7CPA A;  4NGP A;  3PP9 A;  2POK A;  1J3L A;  2GP4 A;  3K4I A;  4CDJ A;  2C1C A;  2EWB A;  4GPL B;  2ZEN A;  2UV8 G;  3S6F A;  3CXQ A;  2P6G A;  4KSI A;  4MY3 A;  4YWY A;  1NMT A;  4B5P B;  3B35 A;  3CDX A;  3D68 A;  3PLF B;  4QB9 A;  2ZPA A;  5IV0 A;  4C9U A;  1LFW A;  3K9U A;  3WC7 A;  1EZA A;  4KOU A;  2OLS A;  2PJ1 A;  1YME A;  1YVK A;  4JXQ A;  4CRY B;  2REE A;  3G8W A;  4KLW A;  4YFJ A;  2I79 A;  4OAD A;  3RBU A;  4MFL A;  1Z8L A;  4P45 A;  3KI9 A;  1WVM A;  4MHZ A;  4P4J A;  4X2T A;  4PPZ A;  4R76 A;  3T05 A;  5JPH A;  1YK3 A;  4CZ1 A;  2F7V A;  1ZYM A;  2G3T A;  3B8G A;  4CAV A;  1X12 A;  3FYN A;  4B10 A;  5CBM A;  3FF3 A;  4C8C A;  4GM5 A;  5LRJ A;  3G23 A;  1CX8 A;  4H6Z A;  3KZW A;  3H8G A;  1VHS A;  3PFE A;  4KVM E;  4UF4 A;  3DR8 A;  3GUX A;  5F48 A;  2AUN A;  4O23 A;  3BUX B;  3SJG A;  1Y0Y A;  4E0A A;  1A9X B;  2PVW A;  1S7N A;  3TOA A;  4KNG E;  2QYV A;  2WPW A;  3BUM B;  2KCW A;  2BCO A;  5JM6 A;  2Q7S A;  3GIU A;  2YJT A;  4ONU A;  4PV6 A;  4I49 A;  4MJX A;  1M4D A;  5KTA A;  1IYL A;  1IYK A;  1WK4 A;  2F8H A;  1VKC A;  3OB2 B;  3LWU A;  5A27 A;  5G1Z A;  2O28 A;  1GYT A;  1MJB A;  1ARL A;  2Z3P A;  3LAC A;  2FM4 A;  4UCP A;  5JVL A;  3F0A A;  5F9M A;  2GAN A;  4EFD A;  1ZLI A;  2PJ9 A;  4F9V A;  3PT1 A;  2FSR A;  2PJ5 A;  1TF9 A;  4CAW A;  3OAK A;  4A4B A;  3GLJ A;  4C7I A;  3VTA A;  1WWZ A;  3V8I A;  5K8O A;  4MBU A;  4NFR A;  4TWE A;  2ZXV A;  2B5G A;  4MHP A;  5HVG A;  3FIX A;  4II9 A;  4FUU A;  5AG6 A;  4YN3 A;  2AFO A;  3KQZ A;  3T9Y A;  2PIY A;  4KOV A;  1YVH A;  4PSX A;  2PJC A;  2I3C A;  1B6B A;  3SHP A;  2EO8 A;  1JWQ A;  2ZEP A;  2PJ3 A;  5IR2 A;  4C9R A;  4COG A;  5BY0 A;  1FY7 A;  1QQ9 A;  5AG4 A;  4HKF A;  4UBR A;  1BXR B;  3F5B A;  2CBL A;  2JEW A;  4JLY A;  2PC1 A;  1CPX A;  3IC1 A;  2XEI A;  4P44 A;  1TXR A;  1YGH A;  3IFE A;  3TC8 A;  1Z4E A;  3TO6 A;  4TJV A;  3HMJ G;  5LYF A;  1AYE A;  4UEF A;  2JDD A;  4MCQ A;  1YRE A;  3QNV A;  2WSA A;  4JVO A;  3RAM A;  5JGF A;  2B4D A;  2GLF A;  4IK2 A;  4QVT A;  2YNC A;  4FAI A;  4UWI A;  3C26 A;  1Y0R A;  2RC4 A;  2V77 A;  4X8I A;  1UFH A;  3PRT A;  3VAR A;  1NBW A;  3G3S A;  1R3N A;  3KHZ A;  4KSF A;  4M6I A;  1OZP A;  1MK4 A;  3KRV A;  3B3W A;  1CM0 A;  2AFU A;  1TKF A;  1Q2D A;  1VHE A;  1HDU A;  1M1D A;  4C9V A;  4P6Y A;  1UWY A;  2H5M A;  2JBK A;  2REF A;  1VHO A;  2RB7 A;  3KR5 A;  2C5Q A;  1Z9U A;  3FB3 A;  3IGR A;  4R3K A;  1KUV A;  1M44 A;  2D4O A;  5D8N A;  1R43 A;  2PJ2 A;  4R3L A;  4B11 A;  3ZJ0 A;  2C27 A;  3PFO A;  4UEZ A;  3SXN A;  1P0H A;  3TOB A;  3V38 A;  5D29 A;  1L0C A;  3KQX A;  1BO4 A;  4NGT A;  4AXV A;  4QC6 A;  2Q51 A;  4UWJ A;  5EBV A;  1AMP A;  1IB1 E;  1ON0 A;  1QSM A;  3PBB A;  3I6S A;  4P4I A;  4E94 A;  1EZB A;  3VRQ A;  1PU9 A;  5K99 A;  1XMB A;  3VWE A;  4R57 A;  1DE4 C;  2GFQ A;  1GGO A;  1H8L A;  1P4N A;  1YSJ A;  4M3S A;  4MFP A;  4MY0 A;  1SQH A;  5J3X A;  5C82 A;  1FT7 A;  4EVY A;  3TYX A;  4MFQ A;  2XEG A;  2PIZ A;  1TKJ A;  3S6G A;  3S6K A;  5LYL A;  5JYB A;  2R8V A;  1XRY A;  4HNX B;  4AVB A;  4OC4 A;  2ZEH A;  2ZEM A;  3WAB A;  3FJU A;  2NYQ A;  3BUN B;  2B4J C;  1Q2Y A;  1M4L A;  4KVX A;  4XPD C;  4C68 A;  2PJ6 A;  2BO9 A;  4C2Z A;  4KSA A;  2ATR A;  4P4F A;  2GE3 A;  2BL1 A;  1DTD A;  1Y9K A;  3D66 A;  2JLM A;  3FRM A;  2XPL A;  3D3S A;  3TO9 A;  5ELY A;  3R95 A;  1Z9E A;  3FX6 A;  3GB0 A;  3QAY A;  4ONW A;  4B6Z A;  4KUA A;  4B5O A;  4CYN A;  1B47 A;  8CPA A;  4NGN A;  3PB6 X;  5LRK A;  4INJ A;  2R98 A;  2DXQ A;  2OZU A;  3H4Q A;  2JEV A;  1AUG A;  4A37 A;  4DUK A;  5F13 A;  3PBE A;  4ZX8 A;  4OIW A;  2QML A;  5THW A;  3RO0 A;  3HPG G;  5HVH A;  4OP4 A;  1LAM A;  4NF1 A;  2DF5 A;  2VQY A;  1M6V B;  2EK9 A;  4OC0 A;  4FWU A;  1F2P A;  1LAP A;  2CNT A;  2YNC C;  2HI6 A;  4A38 A;  2PCN A;  3LD2 A;  4PSW A;  3IO1 A;  4ZY0 A;  1YLE A;  2G3A A;  4C84 A;  1KBL A;  2XPP A;  1XFO A;  1RTQ A;  1Q7L A;  1XOV A;  2OU2 A;  2PRB A;  4K30 A;  4MXU A;  1CS0 B;  3K9T A;  4UFX A;  4OC5 A;  3IWG A;  3SXO A;  2CNS A;  3T8W A;  2J8R A;  2EZB A;  2PJA A;  3E0K A;  4JYW A;  4W9Y A;  5AGE A;  1LOK A;  4UCN A;  2ZOG A;  3K2K A;  4L89 A;  2Z11 A;  2Q7B A;  5F5X A;  1YW6 A;  1KEE B;  4IUS A;  3JUW A;  4Y49 B;  1MJA A;  2Q4Y A;  3BLN A;  3D67 A;  1Z4R A;  1V0C A;  2P6E A;  4KOX A;  5I4M A;  2EBJ A;  3S9M A;  4NCZ A;  4M8D A;  4A32 A;  2ZEE A;  4KZT A;  2G9D A;  1YVO A;  1XE4 A;  5F46 A;  1VBG A;  3PEI A;  1ZO0 A;  1KUY A;  3CXP A;  4OC1 A;  2WUU A;  2FCK A;  4PQA A;  3GYA A;  4X5K A;  1IOI A;  5K8M A;  3B3S A;  4Y49 C;  6CPA A;  5LRG A;  1KWM A;  2HB6 A;  1JDE A;  1S3Z A;  3H8E A;  4PXB A;  5I0C A;  3FXT A;  1V6C A;  4RI1 A;  4MI1 A;  2P6F A;  4MJ8 A;  4UA3 A;  4U9Z A;  1F57 A;  3ZZI A;  3D7H A;  4UFW A;  4CYO A;  3S9L A;  4G1P A;  1ELM P;  2J9A A;  5G20 A;  4CAX A;  2PJ4 A;  5HMN A;  3IIB A;  4C8A A;  2V8D A;  4ZYQ A;  2OR4 A;  3OB1 B;  3B3V A;  4C8F A;  1I12 A;  3B7I A;  2AFZ A;  3IJ3 A;  3NE7 A;  3WR7 A;  1XMT A;  2XEJ A;  2XPO A;  4J0N A;  2EZA A;  3CPA A;  4XPD B;  4C2X A;  1X10 A;  3P2F A;  4PK2 A;  3KL9 A;  1T36 B;  5HH1 A;  3MN8 A;  1HEE A;  4C2Y A;  1NXJ A;  3VRR A;  2Z10 A;  4XPL A;  1QST A;  1ZRS A;  4PXD A;  3QB8 A;  1NE9 A;  2HRO A;  5ISV A;  2GU2 A;  3T0T A;  4BTF A;  2FIW A;  1FNO A;  2Z3L A;  5J8F A;  3TLZ A;  4NGQ A;  1IOF A;  1ZLH A;  2QJ8 A;  2JDC A;  4CYP A;  2AE6 A;  1YLO A;  1TF8 A;  3B3T A;  4ZY2 A;  3D8P A;  1LCP A;  3GY9 A;  3FEC A;  2FL4 A;  5K8P A;  4A4C A;  1S7F A;  3KHX A;  4DNC A;  1IID A;  4NEX A;  3R1K A;  4C9A A;  3R9G A;  4C7H A;  2CIJ A;  3PB8 X;  4MFZ A;  1CP6 A;  2Y0M A;  1ZL0 A;  3F8K A;  3JRU A;  2PR8 A;  2V8H A;  2PSW A;  3N7Z A;  4KOW A;  3VRO A;  3FBU A;  4R87 A;  5FD8 A;  4E5S A;  4RS2 A;  4MCR A;  3EZA A;  3NH5 A;  4ZX9 A;  4Q7A A;  2JBJ A;  2YJV A;  2DEA A;  3TTH A;  3BXM A;  4C8T A;  3A9L A;  5CPA A;  2OZH A;  4HNW B;  1QSN A;  5CNP A;  5EC4 A;  2G0B A;  3C8O A;  2Q44 A;  5HKZ A;  2IQ6 A;  4MI4 A;  2X7B A;  2R82 A;  4C9E A;  3R96 A;  2VKZ G;  2B3U A;  2FE7 A;  4IAV A;  2D0P A;  1EO0 A;  3KAS A;  2VZZ A;  3EFA A;  5HKY A;  4FBE A;  5KTD A;  1U6M A;  2PRQ A;  3SI2 A;  5DWM A;  1CPS A;  1J4J A;  4JXR A;  5JH9 A;  2D4P A;  2Y1M A;  2HUZ A;  1KZF A;  5GCN A;  2PDO A;  3S6H A;  4AB7 A;  2NSM A;  2FXF A;  3MGD A;  2BSW A;  1KUX A;  2C6G A;  4U5Y A;  5G22 A;  3FH4 A;  1HDQ A;  3ISX A;  4CYQ A;  3TLG A;  5IX3 A;  2ZW5 A;  3LOD A;  4B14 A;  2Q04 A;  4BIN A;  3I74 A;  1Z8W A;  1CP7 A;  2Z3K A;  1YR0 A;  3BUW B;  2J8M A;  3V7Z A;  3I9S A;  2NMT A;  3NH8 A;  5HVF A;  1BOB A;  4H1H A;  4P4E A;  3EXN A;  2CNM A;  4J3G A;  4AG9 A;  4H2K A;  4MHD A;  4OLL A;  4F8Z A;  2RFH A;  4CAF A;  4CS0 B;  2IMO A;  4FD4 A;  2WPX A;  2B4D B;  4JWP A;  3IWE A;  4WJB A;  5H86 A;  2D0O A;  4BPW B;  2C6P A;  1ELL P;  4PXC A;  3FNC A;  3T5M A;  4A30 A;  4UFV A;  1QMU A;  2FIA A;  3PB4 X;  2OZG A;  1Z8T A;  4Q36 A;  4RN7 A;  4IIY A;  2ODF A;  1S7L A;  3IU2 A;  4CGM A;  2B0A A;  4OAE A;  2PJB A;  3VH9 A;  3D7G A;  3D7D A;  2AFW A;  4A31 A;  3D2P A;  4KVO E;  2PVV A;  3JTK A;  3O8Z A;  1Z2L A; 
#chains in the Genus database with same CATH homology
 1VIX A;  4OID A;  3ICU A;  4BD9 A;  1PCA A;  4OME A;  1F2O A;  4DJL A;  3CPX A;  2ABZ A;  1XBU A;  2ZED A;  3HUV A;  1VGY A;  1ARM A;  4MCP A;  4C86 A;  3NH4 A;  1ZG9 A;  4OC3 A;  4WWV A;  4C8P A;  5DS0 A;  3NA6 A;  1BAV A;  4TNU A;  3KR4 A;  3H8F A;  1ZG8 A;  4EME A;  3BI0 A;  4PXE A;  3SI1 A;  4EWT A;  2OOT A;  2AFM A;  1V6C A;  1Y7E A;  4DYO A;  5F09 A;  5LYI A;  2WZN A;  4LQG A;  3LMS A;  1XF1 A;  2FVG A;  4FBE A;  2CTB A;  4P4D A;  2V8G A;  3D4U A;  3S9N A;  1CBX A;  3TX8 A;  3WC6 A;  3SJX A;  5HXD A;  3PB7 X;  1Y9Z A;  4C85 A;  3I1U A;  3SJE A;  2ANP A;  2AFS A;  3ISZ A;  4MRI A;  3DGV A;  4R6T A;  4UIA A;  2CTC A;  1BLL E;  4X3R A;  2O53 A;  1IGB A;  5K8N A;  4OKO A;  1TKH A;  3HLP A;  5IB9 A;  2Q43 A;  1BPN A;  1JQG A;  3FVL A;  1OBR A;  4UIB A;  3SI0 A;  1XJO A;  2Q4Z A;  1IY7 A;  2PE3 A;  4F9U A;  3L2N A;  4NJQ A;  2C6C A;  2CF4 A;  2PJ7 A;  2XEF A;  4TJX A;  4R8F A;  4UEE A;  2ZEF A;  4C99 A;  1ZG7 A;  3IEH A;  3B3C A;  4CPA A;  1NSA A;  4ZY1 A;  3RZA A;  1LAN A;  3FEE A;  4MHN A;  2GRE A;  3DLJ A;  3WT4 A;  4R7M A;  2ZEO A;  4NJR A;  2PCU A;  3B2Y A;  3PB9 X;  4YU9 A;  3KGQ A;  2ZOF A;  3MRU A;  2IJZ A;  4MMO A;  4P10 A;  4Z65 A;  1CG2 A;  3FED A;  1BPM A;  1PYT B;  1YW4 A;  4OC2 A;  4NGM A;  2EK8 A;  4K3N A;  4ZI6 A;  3FMC A;  2HC9 A;  5LYD A;  4A94 A;  2PJ0 A;  2WYR A;  4MHY A;  3IWW A;  3WC5 A;  4IHM A;  3N5F A;  3SJF A;  4JZ0 A;  2PJ8 A;  3BI1 A;  3EIF A;  4P4B A;  2V8V A;  3BHX A;  4MCS A;  4A39 A;  1Z5R A;  4CDK A;  2GLJ A;  2O4H A;  2AFX A;  3D7F A;  3CT9 A;  4C8U A;  2ZEL A;  3VAT A;  2ZEG A;  5J1Q A;  3NFZ A;  2VL1 A;  2BOA A;  4NGS A;  4RUH A;  7CPA A;  1EE3 P;  2QVP A;  4NGP A;  2POK A;  2GP4 A;  4CDJ A;  2C1C A;  2EWB A;  2ZEN A;  4KSI A;  4YWY A;  3B35 A;  3CDX A;  3D68 A;  4C9U A;  1LFW A;  3WC7 A;  2PJ1 A;  1YME A;  3RBU A;  1Z8L A;  4P45 A;  3KI9 A;  1WVM A;  4MHZ A;  4P4J A;  4X2T A;  4PPZ A;  4R76 A;  2F7V A;  5CBM A;  3FF3 A;  4C8C A;  4GM5 A;  5LRJ A;  1CX8 A;  3KZW A;  3H8G A;  3PFE A;  4UF4 A;  3GUX A;  4O23 A;  3SJG A;  1Y0Y A;  2PVW A;  4KNG E;  2QYV A;  2BCO A;  5JM6 A;  2F8H A;  3LWU A;  1GYT A;  1ARL A;  4EFD A;  1ZLI A;  2PJ9 A;  4F9V A;  2PJ5 A;  1TF9 A;  3GLJ A;  3VTA A;  5K8O A;  4NFR A;  4TWE A;  4MHP A;  5HVG A;  4FUU A;  4YN3 A;  2AFO A;  3KQZ A;  2PIY A;  2PJC A;  2I3C A;  5IR2 A;  4C9R A;  2ZEP A;  2PJ3 A;  1QQ9 A;  2JEW A;  1CPX A;  3IC1 A;  2XEI A;  4P44 A;  1TXR A;  3IFE A;  3TC8 A;  4TJV A;  5LYF A;  1AYE A;  4UEF A;  4MCQ A;  3QNV A;  3RAM A;  5JGF A;  4IK2 A;  2GLF A;  4FAI A;  1Y0R A;  2V77 A;  4X8I A;  3PRT A;  3VAR A;  3KHZ A;  1R3N A;  3B3W A;  2AFU A;  1TKF A;  1VHE A;  1HDU A;  4C9V A;  4P6Y A;  1UWY A;  2RB7 A;  2JBK A;  3KR5 A;  1VHO A;  2C5Q A;  5D8N A;  1R43 A;  2PJ2 A;  4UEZ A;  3PFO A;  3V38 A;  4AXV A;  5D29 A;  3KQX A;  5JH9 A;  4NGT A;  2Q51 A;  1AMP A;  3PBB A;  3I6S A;  4P4I A;  1XMB A;  1DE4 C;  1H8L A;  1YSJ A;  1FT7 A;  2XEG A;  2PIZ A;  1TKJ A;  5LYL A;  1XRY A;  4OC4 A;  2ZEH A;  2ZEM A;  3WAB A;  3FJU A;  2NYQ A;  1M4L A;  2PJ6 A;  2BO9 A;  4P4F A;  1DTD A;  3D66 A;  5ELY A;  3FX6 A;  3GB0 A;  4ONW A;  4B6Z A;  8CPA A;  5LRK A;  4NGN A;  3PB6 X;  4A37 A;  4DUK A;  3PBE A;  4ZX8 A;  4OIW A;  5THW A;  5HVH A;  4OP4 A;  1LAM A;  2EK9 A;  4OC0 A;  4FWU A;  1F2P A;  1LAP A;  4A38 A;  4C84 A;  3IO1 A;  4ZY0 A;  1XFO A;  1RTQ A;  1Q7L A;  4MXU A;  3K9T A;  4OC5 A;  3T8W A;  2PJA A;  4JYW A;  4W9Y A;  1LOK A;  2ZOG A;  3K2K A;  1YW6 A;  3D67 A;  5I4M A;  3S9M A;  2ZEE A;  2G9D A;  3PEI A;  4OC1 A;  4PQA A;  5K8M A;  3B3S A;  6CPA A;  5LRG A;  1KWM A;  2HB6 A;  3H8E A;  4PXB A;  1F57 A;  3D7H A;  3S9L A;  4G1P A;  1ELM P;  2J9A A;  4C8A A;  2PJ4 A;  3IIB A;  2V8D A;  4ZYQ A;  2OR4 A;  3B3V A;  4C8F A;  3B7I A;  2AFZ A;  3IJ3 A;  2XEJ A;  3CPA A;  3KL9 A;  3MN8 A;  1HEE A;  4PXD A;  2GU2 A;  1FNO A;  4NGQ A;  1ZLH A;  2QJ8 A;  3B3T A;  1TF8 A;  1YLO A;  4ZY2 A;  1LCP A;  3FEC A;  5K8P A;  3KHX A;  4C9A A;  2CIJ A;  3PB8 X;  1CP6 A;  3JRU A;  2V8H A;  4MCR A;  3NH5 A;  4ZX9 A;  4Q7A A;  2JBJ A;  2DEA A;  3BXM A;  4C8T A;  5CPA A;  2IQ6 A;  4C9E A;  4IAV A;  3KAS A;  2PRQ A;  3SI2 A;  1CPS A;  2NSM A;  2C6G A;  3FH4 A;  1HDQ A;  3ISX A;  3I74 A;  1CP7 A;  3V7Z A;  5HVF A;  3NH8 A;  4P4E A;  4H2K A;  4F8Z A;  2RFH A;  2IMO A;  4WJB A;  2C6P A;  1ELL P;  4PXC A;  1QMU A;  3PB4 X;  3VH9 A;  2PJB A;  3D7G A;  3D7D A;  2AFW A;  2PVV A;  4NGR A;  1Z2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...