4NGQA

Crystal structure of glutamate carboxypeptidase ii in a complex with urea-based inhibitor
Total Genus 257
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
257
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Rational design of urea-based glutamate carboxypeptidase II (GCPII) inhibitors as versatile tools for specific drug targeting and delivery
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 257
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4ngqA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4ngqA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4ngqA02
4R6TA 5IB9A 2PJ6A 4FAIA 3ICUA 2GLFA 4KSIA 3D7FA 5CBMA 4C9VA 3SI0A 1PCAA 3MRUA 2C6GA 1QMUA 2V77A 3CPXA 4P45A 3KI9A 1CX8A 4C9UA 2V8GA 3RZAA 4MMOA 3SI2A 2ZOFA 5J1QA 4A37A 1WVMA 2CTBA 1VHOA 1ZLHA 3SJEA 3D7GA 4P44A 3BXMA 3IC1A 6CPAA 3KL9A 2ZELA 2IMOA 4OC1A 4K3NA 5LRKA 2AFZA 2O53A 1ARLA 4P4DA 3PB4X 5D8NA 1YSJA 1LAPA 4A39A 3NH4A 2ZEEA 1BPNA 1CPXA 3PB8X 4P4EA 1IY7A 2PJ1A 3VH9A 3H8EA 2BCOA 2G9DA 3V7ZA 2V8HA 1ELMP 1HDQA 4PXCA 2PVWA 3GLJA 2I3CA 1FT7A 2AFSA 5K8PA 2HC9A 4ZI6A 3KZWA 8CPAA 3B3VA 2PJAA 3SJGA 2CTCA 4OC3A 4NGMA 2Q51A 4WJBA 3IWWA 4Q7AA 3B35A 3HLPA 1R3NA 4A38A 4MCRA 4W9YA 5F09A 4TJVA 2FVGA 2AFMA 4NJQA 1VIXA 2V8DA 5THWA 2NYQA 5LRGA 1UWYA 4C8AA 3WC6A 2XEJA 4PQAA 2C6PA 3IIBA 3WC7A 4ZX9A 3N5FA 1Y0YA 4OIDA 7CPAA 2ZEMA 4PPZA 1LOKA 3KR5A 4ZY1A 1TKHA 4PXEA 2GLJA 3D7DA 3FVLA 4C8PA 1Y0RA 3D66A 4UEFA 2C1CA 4OP4A 3FECA 4OC4A 2QVPA 2XEGA 4MRIA 3NH8A 4X2TA 1CBXA 1CP7A 4GM5A 3KASA 1TF9A 3RAMA 3T8WA 1IGBA 3EIFA 3B3SA 4C99A 3PFEA 4KNGE 3HUVA 2EK8A 2PIYA 2IQ6A 2PJ0A 1RTQA 5LRJA 2EWBA 1QQ9A 3NFZA 1XFOA 4B6ZA 4IHMA 1LANA 3KHZA 1ZG7A 2GU2A 3RBUA 3DLJA 5HXDA 5D29A 3WABA 3D67A 4NGTA 2JBJA 1V6CA 4MHZA 1DE4C 1H8LA 3KGQA 2DEAA 4Z65A 1VHEA 1ZLIA 3KQXA 4NGPA 4OMEA 1HEEA 4X8IA 5LYIA 2PJ4A 3JRUA 3B3CA 1LCPA 2ZEHA 1BPMA 2AFXA 1BLLE 4CDKA 3FMCA 5CPAA 4UEEA 1XBUA 2AFWA 2PJBA 4G1PA 5K8OA 3K2KA 3BI0A 3GB0A 5ELYA 4UIAA 3FF3A 3DGVA 1R43A 4OC0A 5HVGA 2PJ7A 3PB6X 1ZG8A 2V8VA 4P6YA 1ZG9A 3IJ3A 2QJ8A 4TWEA 4ZY2A 4EWTA 2ANPA 2F8HA 4AXVA 4JZ0A 1Z2LA 2XEFA 5HVFA 4JYWA 3QNVA 1TXRA 3D4UA 5HVHA 4UEZA 3V38A 2RB7A 4YWYA 2IJZA 2PCUA 4DJLA 2PIZA 5LYLA 4A94A 2PJ8A 4C85A 2ZOGA 3ISZA 1ARMA 5I4MA 4F9VA 1VGYA 3I6SA 3TX8A 1Z8LA 3VARA 4YU9A 2Q43A 4H2KA 2F7VA 4UF4A 2AFUA 3CPAA 3ISXA 2BOAA 4P4JA 1XMBA 2ZEGA 3PFOA 2PJ9A 4CPAA 1XJOA 1Z5RA 5JH9A 3FEEA 2AFOA 4IAVA 4MCQA 4EMEA 1OBRA 3IFEA 3B7IA 4FBEA 3WC5A 4MHNA 3GUXA 4NGSA 1PYTB 2WZNA 2RFHA 4OC5A 4C8UA 4C84A 3FJUA 4DUKA 2QYVA 5LYFA 2ZENA 4TNUA 2OOTA 2CIJA 2PRQA 1F2OA 1LFWA 2XEIA 1Y7EA 4F8ZA 2C6CA 4MCPA 3FEDA 3S9MA 4ZYQA 4R76A 4NGQA 4C9EA 1LAMA 4TJXA 2JBKA 4P4BA 1FNOA 3D7HA 3LWUA 3CT9A 4R8FA 1Q7LA 4P4FA 3I74A 5DS0A 2CF4A 4C9AA 4ZX8A 3VATA 1TKFA 3CDXA 3S9NA 3PB9X 4LQGA 3B2YA 4C8CA 1DTDA 4CDJA 3PBEA 3MN8A 2Q4ZA 4PXDA 2ZEDA 1F2PA 2NSMA 2EK9A 4NFRA 4X3RA 3L2NA 1TF8A 2JEWA 1NSAA 4IK2A 4C86A 4NJRA 3I1UA 1AMPA 3PB7X 2ZEFA 4ONWA 4C8FA 2PJ3A 4WWVA 1YLOA 3S9LA 5JGFA 4O23A 4PXBA 4OKOA 4BD9A 3KHXA 3B3TA 4P10A 3NH5A 3D68A 3IEHA 1YW4A 3NA6A 1CG2A 1TKJA 4YN3A 3VTAA 2BO9A 2J9AA 4P4IA 1CP6A 3SI1A 3PBBA 2POKA 5K8NA 1AYEA 4EFDA 4MHPA 2VL1A 4C8TA 1CPSA 3FX6A 1F57A 1M4LA 1HDUA 3H8GA 2WYRA 5LYDA 1XF1A 4NGNA 2PJCA 2PJ2A 1JQGA 2ABZA 3BI1A 4C9RA 3KR4A 2O4HA 3B3WA 4MXUA 4RUHA 4ZY0A 3K9TA 4FUUA 2OR4A 1GYTA 2PE3A 4R7MA 4OC2A 3H8FA 4OIWA 3IO1A 2ZEPA 2PVVA 1ELLP 2ZEOA 4MCSA 1YMEA 3KQZA 2GREA 3PRTA 1YW6A 3LMSA 1BAVA 4NGRA 5K8MA 3SJFA 3PEIA 3WT4A 4UIBA 3BHXA 5JM6A 1EE3P 4F9UA 2HB6A 2PJ5A 1Y9ZA 4FWUA 3FH4A 1KWMA 4DYOA 3TC8A 4MHYA 1XRYA 3SJXA
chains in the Genus database with same CATH superfamily
4R6TA 1RO5A 5IB9A 3HMJG 4UFWA 2PJ6A 4K30A 4FAIA 3ICUA 2DPSA 2D4PA 2GLFA 4XPDB 4A33A 4KSIA 3D7FA 4HNWB 5CBMA 2KCWA 1XMTA 2Z11A 4KUBA 4C9VA 3SI0A 4ZBGA 1PCAA 3MRUA 4KSFA 4NXYA 2C5QA 5A27A 3G8WA 2C6GA 4MBUA 1QMUA 1N71A 2V77A 3CPXA 1R61A 5F5XA 2EUIA 4P45A 4COBA 4CYPA 4F6AA 3KI9A 3FYNA 1CX8A 1PU9A 4C9UA 2V8GA 3RZAA 2D4OA 3I9SA 5IX3A 1IOFA 2PQ8A 4MMOA 3SI2A 4B5PB 2R1IA 2ZOFA 3G3SA 4QB9A 2ATRA 1FBVA 4LUAA 5J1QA 1BO4A 3F5BA 2D0OA 4A37A 1EZBA 1ZL0A 4AB7A 2CTBA 1XEBA 4L8AA 1WVMA 3IGRA 1ON0A 3OP0A 1VHOA 2J8NA 4CAXA 1ZLHA 3SJEA 2B4DB 3D7GA 4PV6A 4Q36A 4P44A 3BXMA 3IC1A 3NE8A 1XE4A 1GHEA 4QC6A 6CPAA 1A2ZA 1B87A 3KL9A 2ZELA 2IMOA 4OC1A 4K3NA 4MFJA 2AFZA 4CGOA 5LRKA 2O53A 1ARLA 3UY5A 1BXRB 4P4DA 4BINA 3PB4X 5D8NA 1YSJA 1LAPA 4A39A 1EZAA 3VWDA 3EZEA 4FD7A 2B5GB 3NH4A 3CXSA 2OZHA 2ZEEA 2BSWA 3K4IA 1BPNA 1U6MA 1CPXA 3PB8X 2CNTA 3OAKA 1S3ZA 4P4EA 1IY7A 1M4DA 3ZJ0A 2OB0A 2PJ1A 3VH9A 2WPXA 2F5IA 2BCOA 3H8EA 3C26A 3TLCA 2G9DA 3V7ZA 2V8HA 1ELMP 1HDQA 2AE6A 4PXCA 1J4JA 4JWPA 1Z8TA 2PVWA 2ZW7A 3GLJA 4CGLA 2I3CA 1FT7A 1M44A 1X10A 2AFSA 5K8PA 2J8RA 5KTDA 3VRRA 4KVME 2HC9A 2JDCA 3BUOB 4ZI6A 1YGHA 3KZWA 1IU8A 2GANA 3B3VA 5F48A 4C68A 8CPAA 2PJAA 2DIKA 3SJGA 2CTCA 4OC3A 4MHDA 3PLFB 4U5YA 1ZYMA 4NGMA 1B6BA 2Q51A 4QBJA 4WJBA 5EC4A 5J8FA 3U1BA 3IWWA 4Q7AA 4KLWA 3B35A 1JWQA 3HLPA 3RYOA 1R3NA 2WSAA 4MFZA 4A38A 5KTAA 4MCRA 4W9YA 4U9ZA 3OWCA 5F09A 4M8DA 2BEIA 4II9A 1S7KA 4TJVA 2FVGA 2B58A 5KTCA 1QSNA 2AFMA 3D3SA 1VIXA 2V8DA 4HPSA 4NJQA 3ZZIA 5THWA 2NYQA 4MY3A 3DSBA 5LRGA 1UWYA 1L0CA 4KORA 4C8AA 3P2FA 3WC6A 2XEJA 4PQAA 2Q04A 2C6PA 1VBGA 5K99A 3IIBA 3WC7A 4X5KA 1S5KA 2BUEA 2QMLA 4ZX9A 3N5FA 3EXNA 1Y0YA 4OIDA 2WPWA 4E2AA 4M6HA 5E96A 1IYKA 4AG9A 7CPAA 3HPGG 1OZPA 2FSRA 3KRVA 4XNHC 2ZEMA 1Y9KA 2OZUA 4PPZA 2FIAA 1LOKA 3KR5A 4KVXA 4CYOA 4ZY1A 2CY2A 1TKHA 4PXEA 2GLJA 3GY9A 4IIYA 2PDOA 3O8ZA 4UCPA 3D7DA 1Z8WA 2CXAA 3FVLA 4C8PA 2OLSA 1Z4EA 1Y0RA 3PZJA 4A95A 2B3VA 3D66A 4UEFA 2C1CA 2GP4A 5EBVA 4GS4A 4FD6A 4OP4A 3FECA 3IU2A 4OC4A 4GPLB 2QVPA 2FE7A 1Z4RA 2UV8G 2XEGA 1MJ9A 4MRIA 5F46A 2HWGA 3NH8A 3IWEA 4KUAA 1M6VB 4RS2A 3TO9A 4JVOA 2VKZG 4X2TA 2Z3OA 1CBXA 1CP7A 1M4IA 4GM5A 3KASA 3K9UA 1TF9A 5H86A 1NSLA 3RAMA 3D2PA 3T8WA 1IGBA 3TO7A 3TFYA 3EIFA 2VZZA 4MI1A 3F9KC 3ZNIA 1Y7RA 2PRBA 4Q38A 3HPHE 3B3SA 4UCNA 4C99A 3PFEA 4KNGE 3D2MA 3HUVA 4MI4A 2N3AB 1JDEA 1CS0B 4KLVA 4UWJA 3SXOA 2EK8A 4EYSA 2PIYA 2IQ6A 2PJ0A 3FRMA 3RNZA 3T0TA 3S6HA 1RTQA 3PFVA 1Q2CA 1Q2DA 2P0WA 5LRJA 4B12A 3BUXB 1Z9UA 4LQ6A 2FS5A 2Z3MA 2FT0A 2EWBA 3S6FA 1QQ9A 2ZW5A 3NFZA 4BPXB 4YFJA 3BUWB 4JD6A 1XFOA 3R95A 4AVCA 4IHMA 4B6ZA 1LANA 5HKWA 3KHZA 4CZ1A 3TLGA 2JEVA 1ZG7A 2GU2A 3RBUA 3DLJA 5HXDA 1Q5XA 4ORFA 4E5SA 5D29A 3R9GA 4HNYB 3W6XA 3D67A 4NGTA 3I3GA 3WABA 4C7HA 3T07A 3R96A 4C7IA 4QUSA 2JBJA 2PR8A 4H6UA 4NEXA 1V6CA 2YJVA 4MHZA 2FCKA 1DE4C 1H8LA 5GCNA 3KGQA 4MFQA 2PSWA 3H4QA 2DEAA 2EVNA 1VKCA 4Z65A 1VHEA 1ZLIA 3KQXA 4CAWA 3DNSA 1GGOA 3C8OA 5BY0A 3V8IA 1DIKA 2E28A 4NGPA 4OMEA 1HEEA 4X8IA 5LYIA 2PJ4A 2Z3LA 3JRUA 1S7LA 5AG5A 4DNCA 5JPHA 3B3CA 1MK4A 4RN7A 2Q0YA 5AXIA 1LCPA 1BPMA 2C27A 2ZEHA 4NF1A 2AFXA 1BLLE 3A9LA 5JQ4A 4CDKA 1XF8A 3FMCA 5CPAA 4HKFA 2GFQA 4UEEA 1XBUA 2AFWA 2PJBA 4NCZA 2HUZA 2Q7SA 4G1PA 5BWAB 5K8OA 4A4BA 1YQEA 3K2KA 2R8VA 3BI0A 3U88C 1YK3A 3GB0A 2R98A 5ELYA 3LACA 4Y49B 4UIAA 3TO6A 3FF3A 1C3OB 3DGVA 1R43A 3VRQA 3CXQA 4OC0A 1Q2YA 2PJ7A 2VI7A 3PB6X 1ZG8A 2V8VA 5CNPA 3W6SA 4BBHA 4P6YA 2AUMA 2DF5A 2G3TA 4QVTA 3DDDA 4UA3A 1YREA 1YX0A 1ZG9A 5G1ZA 2J8MA 5HH1A 3EZAA 3IJ3A 4ONUA 5G20A 2QJ8A 4KOUA 4E8OA 2CNMA 1WWZA 1M1DA 4TWEA 2RC4A 4ZY2A 3TLZA 1VI4A 4EWTA 2ANPA 4R87A 5J3XA 2F8HA 4PK2A 4JZ0A 4XPDC 4AXVA 1KUXA 4FD4A 1Z2LA 3GIUA 3LD2A 1I1DA 2Q4YA 2XEFA 3BUNB 5HKZA 4JYWA 1NE9A 3GKRA 5HVFA 1CE8B 3QNVA 3FXTA 3SXNA 2QECA 4R3KA 1TXRA 3D4UA 4NSQA 2VQYA 4XPLA 3DR6A 2P6EA 5HVHA 4H1HA 4UEZA 5C82A 4PSWA 3V38A 4XPKA 2B3UA 2FM4A 2RB7A 2VXKA 4YWYA 2REEA 3FNCA 2IJZA 4R57A 2O28A 2PCUA 2ZPAA 5F47A 4DJLA 2EZCA 3FB3A 5AG7A 2PIZA 4CAEA 5LYLA 1J3LA 2JDDA 2Z3PA 4A94A 4J0NA 3KKWA 1KBLA 3VGOA 2PJ8A 4C85A 3IU1A 2ZOGA 3ISZA 2K5TA 3OB1B 4CGMA 5IV0A 1ARMA 2FL4A 5I4MA 3N7ZA 2YJTA 2GIVA 1VBHA 3JUWA 4JJXA 4F9VA 1VGYA 3I6SA 3TX8A 1Z8LA 3VARA 5JVLA 4BMHA 1ZRSA 2IL4A 4YU9A 2P6FA 2Q43A 4H2KA 2F7VA 3BJ8A 4KSAA 4UF4A 2AFUA 1BOBA 3TT2A 4CAFA 3BJ7A 2YNEA 1T36B 3CPAA 4CO9A 3SHPA 4JXQA 3ISXA 4IIXA 4CS0B 4MJXA 3TOBA 4Y49C 3F0AA 2Z3NA 2BOAA 4P4JA 1XMBA 2ZEGA 3PFOA 4CGPA 2A4NA 1UFHA 2I00A 2DXQA 2PJ9A 4CPAA 3SR3A 1XJOA 1Z5RA 2AJ6A 3FEEA 5JH9A 4UBRA 2AFOA 4IAVA 2DLAA 4MCQA 2VZYA 4EMEA 4B11A 3GJZA 4UFVA 1OBRA 2R7HA 3IFEA 3B7IA 4FBEA 4CRZB 2YNCC 1S7NA 4KOXA 4PSXA 3WC5A 2Y1NA 3WR7A 1YVOA 2EBJA 3TYXA 3NOJA 2XPNA 4I49A 4MHNA 3JVNA 1MJBA 3GUXA 4NGSA 1PYTB 4B10A 2WZNA 4CGNA 5FD8A 2RFHA 4OC5A 1CM0A 4C8UA 4KZTA 3DR8A 4C84A 3FJUA 5F9MA 4DUKA 2QYVA 5LYFA 4AG7A 2ZENA 3LODA 1Z9EA 4TNUA 2OOTA 4BPUB 2CIJA 4H6ZA 2G3AA 2I79A 2PRQA 3B8GA 1F2OA 1LFWA 2XEIA 3RO0A 5HVGA 4KOTA 5I0CA 1Y7EA 4PK3A 2AUNA 3TLEA 3QAHA 4R3LA 4F8ZA 2C6CA 4MCPA 3FEDA 3S9MA 3D8PA 4J3GA 3PT1A 3VWEA 4CYQA 3TCVA 4C8TA 3IWGA 3PP9A 1QSMA 4ZYQA 2Z3KA 4B14A 4R76A 4NGQA 5EMIA 3FBUA 3PGPA 3F8KA 4JXRA 3NFQA 4C9EA 2PCNA 1LAMA 1YVKA 2JBKA 3CZXA 4P4BA 2Z0ZA 2B0AA 4TJXA 1FNOA 4KOYA 1AUGA 2FIWA 3D7HA 3H5ZA 4MFKA 1FY7A 3LWUA 3CT9A 4R8FA 1Q7LA 4E94A 3EFAA 2HV2A 4P4FA 3QAYA 1S7FA 3I74A 3GYAA 4UWIA 5DS0A 1X12A 2CF4A 2OZGA 4C9AA 4MY0A 4COGA 4ZX8A 1WJTA 1TKFA 5DWMA 3VATA 3CDXA 5AGEA 3S9NA 4KS9A 2Q44A 3PB9X 4LQGA 1YVHA 3B2YA 1DTDA 4C8CA 3T05A 4CDJA 3PBEA 1QSRA 3R9EA 3MN8A 2Q4ZA 4YRHA 5C88A 4BPWB 4PXDA 2HROA 3S6KA 3TLAA 1I21A 4AVAA 2FXFA 1LRZA 2ZEDA 4AVBA 1F2PA 2NSMA 2EK9A 3JTKA 1QSOA 4NFRA 2ZW4A 2QIRA 4B5PA 4X3RA 4CYNA 3L2NA 4A2ZA 2EO8A 5A28A 1TF8A 2JEWA 1NSAA 3MGDA 5ISVA 4IK2A 4A30A 4C86A 4KVOE 4NJRA 2Y0MA 4A31A 1VHSA 4ZGYB 1Y9WA 1XOVA 2PC1A 1AMPA 3VROA 3I1UA 3PB7X 2ZEFA 1NXJA 4ONWA 4C8FA 1YLEA 2B4DA 2PJ3A 4OAEA 2P6GA 4WWVA 1YLOA 3S9LA 2ZW6A 4O23A 2XPLA 4PXBA 2X7BA 5JGFA 4OKOA 5G22A 3TE4A 1QSTA 2ZXVA 4XNHB 4BD9A 4FD5A 5IR2A 3T5MA 3KHXA 3B3TA 3BUMB 4L89A 4A32A 2BL1A 4M6IA 4A4CA 1NMTA 4P10A 3E0KA 5H84A 4C2YA 4RR2B 3TLYA 2H5MA 3NH5A 4RI1A 2B5GA 4U9YA 3D68A 3IEHA 1YW4A 3NA6A 1CG2A 1TKJA 1CJWA 5F1YA 4YN3A 3W91A 3VTAA 5F49A 2BO9A 2J9AA 4P4IA 1CP6A 3SI1A 4B5OA 1KEEB 3PBBA 4OLLA 2POKA 1K4JA 4JLYA 5K8NA 1AYEA 3T9YA 4C2XA 4EFDA 2YNDA 2VL1A 4MHPA 1CPSA 5HKYA 1M4GA 2Q4VA 3FX6A 3EY5A 3R9FA 3TTHA 3EZBA 2B4JC 4GXHA 5HMNA 1F57A 3QB8A 1M4LA 1WK4A 1HDUA 3H8GA 2G0BA 2WYRA 4IUSA 3VRNA 2NMTA 2R82A 4KOWA 4H89A 2YNCA 3P2HA 4R9MA 3EC4A 5LYDA 1XF1A 4NGNA 5FVJA 2PJCA 4CAVA 2PJ2A 2JLMA 1NBWA 1JQGA 3NE7A 1KUYA 2ABZA 3BI1A 2MP0A 2OU2A 4C9RA 1YR0A 3KR4A 2VEZA 1RXTA 4KOVA 5IB0A 5JYBA 2OH1A 2O4HA 1IICA 3B3WA 4B13A 4MXUA 4C2ZA 2HI6A 2XPPA 4MJ8A 2DPTA 1Z8XA 4M85A 1IYLA 3OB2B 4RUHA 4LX9A 4ZY0A 2EZAA 3K9TA 1C30B 1V0CA 2OR4A 4FUUA 1GYTA 4MFPA 2PE3A 1KC7A 4R7MA 2B4BA 5G21A 4IF5A 4OC2A 3H8FA 5J8CA 4OIWA 4F0YA 3R1KA 2D0PA 2PR1A 3IO1A 2Z10A 1MJAA 2XPOA 2ZEPA 5AG6A 2PVVA 1ELLP 2ZEOA 3CXPA 3VRPA 1EO0A 2GE3A 2VBQA 2CNSA 3FIXA 4MCSA 1A9XB 1I12A 4M3SA 2EZBA 1IB1E 1YMEA 1KUVA 3BLNA 4CRYB 3KQZA 5DWNA 4UCMA 2Q7BA 2GREA 3PRTA 1YW6A 4OADA 2WUUA 2ARHA 1S60A 4UFXA 3LMSA 1BAVA 1ZO0A 4NGRA 4KOSA 4M6GA 4MFLA 1R57A 5K8MA 1JDBC 2YGWA 3SJFA 3PEIA 4HNXB 1PUAA 4E0AA 3TLBA 3TLGB 3T90A 1IIDA 3WT4A 4UIBA 2X0SA 3G23A 1P4NA 1XIXA 1SQHA 3BHXA 1P0HA 3S6GA 2Y1MA 3TOAA 1EE3P 4EVYA 5JM6A 4INJA 2CBLA 4BTFA 2HB6A 2ODFA 2PJ5A 4YGOA 4F9UA 1Y9ZA 1IOIA 2HQYA 4FWUA 5F13A 1KZFA 1KWMA 1TIQA 3EO4A 1B47A 3FH4A 2REFA 4DYOA 4F0XA 5AG4A 3TC8A 4MHYA 1XRYA 3SJXA
chains in the Genus database with same CATH topology
4R6TA 5IB9A 2PJ6A 4FAIA 3ICUA 2GLFA 4KSIA 3D7FA 5CBMA 4C9VA 3SI0A 1PCAA 3MRUA 2C5QA 2C6GA 1QMUA 2V77A 3CPXA 4P45A 3KI9A 1CX8A 4C9UA 2V8GA 3RZAA 4MMOA 3SI2A 2ZOFA 5J1QA 4A37A 1WVMA 2CTBA 1VHOA 1ZLHA 3SJEA 3D7GA 4P44A 3BXMA 3IC1A 6CPAA 3KL9A 2ZELA 2IMOA 4OC1A 4K3NA 5LRKA 2AFZA 2O53A 1ARLA 4P4DA 3PB4X 5D8NA 1YSJA 1LAPA 4A39A 3NH4A 2ZEEA 1BPNA 1CPXA 3PB8X 4P4EA 1IY7A 2PJ1A 3VH9A 3H8EA 2BCOA 2G9DA 3V7ZA 2V8HA 1ELMP 1HDQA 4PXCA 2PVWA 3GLJA 2I3CA 1FT7A 2AFSA 5K8PA 2HC9A 4ZI6A 3KZWA 8CPAA 3B3VA 2PJAA 3SJGA 2CTCA 4OC3A 4NGMA 2Q51A 4WJBA 3IWWA 4Q7AA 3B35A 3HLPA 1R3NA 4A38A 4MCRA 4W9YA 5F09A 4TJVA 2FVGA 2AFMA 4NJQA 1VIXA 2V8DA 5THWA 2NYQA 5LRGA 1UWYA 4C8AA 3WC6A 2XEJA 4PQAA 2C6PA 3IIBA 3WC7A 4ZX9A 3N5FA 1Y0YA 4OIDA 7CPAA 2ZEMA 4PPZA 1LOKA 3KR5A 4ZY1A 1TKHA 4PXEA 2GLJA 3D7DA 3FVLA 4C8PA 1Y0RA 3D66A 4UEFA 2C1CA 2GP4A 4OP4A 3FECA 4OC4A 2QVPA 2XEGA 4MRIA 3NH8A 4X2TA 1CBXA 1CP7A 4GM5A 3KASA 1TF9A 3RAMA 3T8WA 1IGBA 3EIFA 3B3SA 4C99A 3PFEA 4KNGE 3HUVA 2EK8A 2PIYA 2IQ6A 2PJ0A 1RTQA 5LRJA 2EWBA 1QQ9A 3NFZA 1XFOA 4B6ZA 4IHMA 1LANA 3KHZA 1ZG7A 2GU2A 3RBUA 3DLJA 5HXDA 5D29A 3WABA 3D67A 4NGTA 2JBJA 1V6CA 4MHZA 1DE4C 1H8LA 3KGQA 2DEAA 4Z65A 1VHEA 1ZLIA 3KQXA 4NGPA 4OMEA 1HEEA 4X8IA 5LYIA 2PJ4A 3JRUA 3B3CA 1LCPA 2ZEHA 1BPMA 2AFXA 1BLLE 4CDKA 3FMCA 5CPAA 4UEEA 1XBUA 2AFWA 2PJBA 4G1PA 5K8OA 3K2KA 3BI0A 3GB0A 5ELYA 4UIAA 3FF3A 3DGVA 1R43A 4OC0A 5HVGA 2PJ7A 3PB6X 1ZG8A 2V8VA 4P6YA 1ZG9A 3IJ3A 2QJ8A 4TWEA 4ZY2A 4EWTA 2ANPA 2F8HA 4AXVA 4JZ0A 1Z2LA 2XEFA 5HVFA 4JYWA 3QNVA 1TXRA 3D4UA 5HVHA 4UEZA 3V38A 2RB7A 4YWYA 2IJZA 2PCUA 4DJLA 2PIZA 5LYLA 4A94A 2PJ8A 4C85A 2ZOGA 3ISZA 1ARMA 5I4MA 4F9VA 1VGYA 3I6SA 3TX8A 1Z8LA 3VARA 4YU9A 2Q43A 4H2KA 2F7VA 4UF4A 2AFUA 3CPAA 3ISXA 2BOAA 4P4JA 1XMBA 2ZEGA 3PFOA 2PJ9A 4CPAA 1XJOA 1Z5RA 5JH9A 3FEEA 2AFOA 4IAVA 4MCQA 4EMEA 1OBRA 3IFEA 3B7IA 4FBEA 3WC5A 4MHNA 3GUXA 4NGSA 1PYTB 2WZNA 2RFHA 4OC5A 4C8UA 4C84A 3FJUA 4DUKA 2QYVA 5LYFA 2ZENA 4TNUA 2OOTA 2CIJA 2PRQA 1F2OA 1LFWA 2XEIA 1Y7EA 4F8ZA 2C6CA 4MCPA 3FEDA 3S9MA 4ZYQA 4R76A 4NGQA 4C9EA 1LAMA 4TJXA 2JBKA 4P4BA 1FNOA 3D7HA 3LWUA 3CT9A 4R8FA 1Q7LA 4P4FA 3I74A 5DS0A 2CF4A 4C9AA 4ZX8A 3VATA 1TKFA 3CDXA 3S9NA 3PB9X 4LQGA 3B2YA 4C8CA 1DTDA 4CDJA 3PBEA 3MN8A 2Q4ZA 4PXDA 2ZEDA 1F2PA 2NSMA 2EK9A 4NFRA 4X3RA 3L2NA 1TF8A 2JEWA 1NSAA 4IK2A 4C86A 4NJRA 3I1UA 1AMPA 3PB7X 2ZEFA 4ONWA 4C8FA 2PJ3A 4WWVA 1YLOA 3S9LA 5JGFA 4O23A 4PXBA 5IR2A 4OKOA 4BD9A 3KHXA 3B3TA 4P10A 3NH5A 3D68A 3IEHA 1YW4A 3NA6A 1CG2A 1TKJA 4YN3A 3VTAA 2BO9A 2J9AA 4P4IA 1CP6A 3SI1A 3PBBA 2POKA 5K8NA 1AYEA 4EFDA 4MHPA 2VL1A 4C8TA 1CPSA 3FX6A 1F57A 1M4LA 1HDUA 3H8GA 2WYRA 5LYDA 1XF1A 4NGNA 2PJCA 2PJ2A 1JQGA 2ABZA 3BI1A 4C9RA 3KR4A 2O4HA 3B3WA 4MXUA 4RUHA 4ZY0A 3K9TA 4FUUA 2OR4A 1GYTA 2PE3A 4R7MA 4OC2A 3H8FA 4OIWA 3IO1A 2ZEPA 2PVVA 1ELLP 2ZEOA 4MCSA 1YMEA 3KQZA 2GREA 3PRTA 1YW6A 3LMSA 1BAVA 4NGRA 5K8MA 3SJFA 3PEIA 3WT4A 4UIBA 3BHXA 5JM6A 1EE3P 4F9UA 2HB6A 2PJ5A 1Y9ZA 4FWUA 3FH4A 1KWMA 4DYOA 3TC8A 4MHYA 1XRYA 3SJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R6T A;  5IB9 A;  2PJ6 A;  4FAI A;  3ICU A;  2GLF A;  4KSI A;  3D7F A;  5CBM A;  4C9V A;  3SI0 A;  1PCA A;  3MRU A;  2C6G A;  1QMU A;  2V77 A;  3CPX A;  4P45 A;  3KI9 A;  1CX8 A;  4C9U A;  2V8G A;  3RZA A;  4MMO A;  3SI2 A;  2ZOF A;  5J1Q A;  4A37 A;  1WVM A;  2CTB A;  1VHO A;  1ZLH A;  3SJE A;  3D7G A;  4P44 A;  3BXM A;  3IC1 A;  6CPA A;  3KL9 A;  2ZEL A;  2IMO A;  4OC1 A;  4K3N A;  5LRK A;  2AFZ A;  2O53 A;  1ARL A;  4P4D A;  3PB4 X;  5D8N A;  1YSJ A;  1LAP A;  4A39 A;  3NH4 A;  2ZEE A;  1BPN A;  1CPX A;  3PB8 X;  4P4E A;  1IY7 A;  2PJ1 A;  3VH9 A;  3H8E A;  2BCO A;  2G9D A;  3V7Z A;  2V8H A;  1ELM P;  1HDQ A;  4PXC A;  2PVW A;  3GLJ A;  2I3C A;  1FT7 A;  2AFS A;  5K8P A;  2HC9 A;  4ZI6 A;  3KZW A;  8CPA A;  3B3V A;  2PJA A;  3SJG A;  2CTC A;  4OC3 A;  4NGM A;  2Q51 A;  4WJB A;  3IWW A;  4Q7A A;  3B35 A;  3HLP A;  1R3N A;  4A38 A;  4MCR A;  4W9Y A;  5F09 A;  4TJV A;  2FVG A;  2AFM A;  4NJQ A;  1VIX A;  2V8D A;  5THW A;  2NYQ A;  5LRG A;  1UWY A;  4C8A A;  3WC6 A;  2XEJ A;  4PQA A;  2C6P A;  3IIB A;  3WC7 A;  4ZX9 A;  3N5F A;  1Y0Y A;  4OID A;  7CPA A;  2ZEM A;  4PPZ A;  1LOK A;  3KR5 A;  4ZY1 A;  1TKH A;  4PXE A;  2GLJ A;  3D7D A;  3FVL A;  4C8P A;  1Y0R A;  3D66 A;  4UEF A;  2C1C A;  4OP4 A;  3FEC A;  4OC4 A;  2QVP A;  2XEG A;  4MRI A;  3NH8 A;  4X2T A;  1CBX A;  1CP7 A;  4GM5 A;  3KAS A;  1TF9 A;  3RAM A;  3T8W A;  1IGB A;  3EIF A;  3B3S A;  4C99 A;  3PFE A;  4KNG E;  3HUV A;  2EK8 A;  2PIY A;  2IQ6 A;  2PJ0 A;  1RTQ A;  5LRJ A;  2EWB A;  1QQ9 A;  3NFZ A;  1XFO A;  4B6Z A;  4IHM A;  1LAN A;  3KHZ A;  1ZG7 A;  2GU2 A;  3RBU A;  3DLJ A;  5HXD A;  5D29 A;  3WAB A;  3D67 A;  4NGT A;  2JBJ A;  1V6C A;  4MHZ A;  1DE4 C;  1H8L A;  3KGQ A;  2DEA A;  4Z65 A;  1VHE A;  1ZLI A;  3KQX A;  4NGP A;  4OME A;  1HEE A;  4X8I A;  5LYI A;  2PJ4 A;  3JRU A;  3B3C A;  1LCP A;  2ZEH A;  1BPM A;  2AFX A;  1BLL E;  4CDK A;  3FMC A;  5CPA A;  4UEE A;  1XBU A;  2AFW A;  2PJB A;  4G1P A;  5K8O A;  3K2K A;  3BI0 A;  3GB0 A;  5ELY A;  4UIA A;  3FF3 A;  3DGV A;  1R43 A;  4OC0 A;  5HVG A;  2PJ7 A;  3PB6 X;  1ZG8 A;  2V8V A;  4P6Y A;  1ZG9 A;  3IJ3 A;  2QJ8 A;  4TWE A;  4ZY2 A;  4EWT A;  2ANP A;  2F8H A;  4AXV A;  4JZ0 A;  1Z2L A;  2XEF A;  5HVF A;  4JYW A;  3QNV A;  1TXR A;  3D4U A;  5HVH A;  4UEZ A;  3V38 A;  2RB7 A;  4YWY A;  2IJZ A;  2PCU A;  4DJL A;  2PIZ A;  5LYL A;  4A94 A;  2PJ8 A;  4C85 A;  2ZOG A;  3ISZ A;  1ARM A;  5I4M A;  4F9V A;  1VGY A;  3I6S A;  3TX8 A;  1Z8L A;  3VAR A;  4YU9 A;  2Q43 A;  4H2K A;  2F7V A;  4UF4 A;  2AFU A;  3CPA A;  3ISX A;  2BOA A;  4P4J A;  1XMB A;  2ZEG A;  3PFO A;  2PJ9 A;  4CPA A;  1XJO A;  1Z5R A;  5JH9 A;  3FEE A;  2AFO A;  4IAV A;  4MCQ A;  4EME A;  1OBR A;  3IFE A;  3B7I A;  4FBE A;  3WC5 A;  4MHN A;  3GUX A;  4NGS A;  1PYT B;  2WZN A;  2RFH A;  4OC5 A;  4C8U A;  4C84 A;  3FJU A;  4DUK A;  2QYV A;  5LYF A;  2ZEN A;  4TNU A;  2OOT A;  2CIJ A;  2PRQ A;  1F2O A;  1LFW A;  2XEI A;  1Y7E A;  4F8Z A;  2C6C A;  4MCP A;  3FED A;  3S9M A;  4ZYQ A;  4R76 A;  4NGQ A;  4C9E A;  1LAM A;  4TJX A;  2JBK A;  4P4B A;  1FNO A;  3D7H A;  3LWU A;  3CT9 A;  4R8F A;  1Q7L A;  4P4F A;  3I74 A;  5DS0 A;  2CF4 A;  4C9A A;  4ZX8 A;  3VAT A;  1TKF A;  3CDX A;  3S9N A;  3PB9 X;  4LQG A;  3B2Y A;  4C8C A;  1DTD A;  4CDJ A;  3PBE A;  3MN8 A;  2Q4Z A;  4PXD A;  2ZED A;  1F2P A;  2NSM A;  2EK9 A;  4NFR A;  4X3R A;  3L2N A;  1TF8 A;  2JEW A;  1NSA A;  4IK2 A;  4C86 A;  4NJR A;  3I1U A;  1AMP A;  3PB7 X;  2ZEF A;  4ONW A;  4C8F A;  2PJ3 A;  4WWV A;  1YLO A;  3S9L A;  5JGF A;  4O23 A;  4PXB A;  4OKO A;  4BD9 A;  3KHX A;  3B3T A;  4P10 A;  3NH5 A;  3D68 A;  3IEH A;  1YW4 A;  3NA6 A;  1CG2 A;  1TKJ A;  4YN3 A;  3VTA A;  2BO9 A;  2J9A A;  4P4I A;  1CP6 A;  3SI1 A;  3PBB A;  2POK A;  5K8N A;  1AYE A;  4EFD A;  4MHP A;  2VL1 A;  4C8T A;  1CPS A;  3FX6 A;  1F57 A;  1M4L A;  1HDU A;  3H8G A;  2WYR A;  5LYD A;  1XF1 A;  4NGN A;  2PJC A;  2PJ2 A;  1JQG A;  2ABZ A;  3BI1 A;  4C9R A;  3KR4 A;  2O4H A;  3B3W A;  4MXU A;  4RUH A;  4ZY0 A;  3K9T A;  4FUU A;  2OR4 A;  1GYT A;  2PE3 A;  4R7M A;  4OC2 A;  3H8F A;  4OIW A;  3IO1 A;  2ZEP A;  2PVV A;  1ELL P;  2ZEO A;  4MCS A;  1YME A;  3KQZ A;  2GRE A;  3PRT A;  1YW6 A;  3LMS A;  1BAV A;  4NGR A;  5K8M A;  3SJF A;  3PEI A;  3WT4 A;  4UIB A;  3BHX A;  5JM6 A;  1EE3 P;  4F9U A;  2HB6 A;  2PJ5 A;  1Y9Z A;  4FWU A;  3FH4 A;  1KWM A;  4DYO A;  3TC8 A;  4MHY A;  1XRY A;  3SJX A; 
#chains in the Genus database with same CATH topology
 4R6T A;  1RO5 A;  5IB9 A;  3HMJ G;  4UFW A;  2PJ6 A;  4K30 A;  4FAI A;  3ICU A;  2DPS A;  2D4P A;  2GLF A;  4XPD B;  4A33 A;  4KSI A;  3D7F A;  4HNW B;  5CBM A;  2KCW A;  1XMT A;  2Z11 A;  4KUB A;  4C9V A;  3SI0 A;  4ZBG A;  1PCA A;  3MRU A;  4KSF A;  4NXY A;  2C5Q A;  5A27 A;  3G8W A;  2C6G A;  4MBU A;  1QMU A;  1N71 A;  2V77 A;  3CPX A;  1R61 A;  5F5X A;  2EUI A;  4P45 A;  4COB A;  4CYP A;  4F6A A;  3KI9 A;  3FYN A;  1CX8 A;  1PU9 A;  4C9U A;  2V8G A;  3RZA A;  2D4O A;  3I9S A;  5IX3 A;  1IOF A;  2PQ8 A;  4MMO A;  3SI2 A;  4B5P B;  2R1I A;  2ZOF A;  3G3S A;  4QB9 A;  2ATR A;  1FBV A;  4LUA A;  5J1Q A;  1BO4 A;  3F5B A;  2D0O A;  4A37 A;  1EZB A;  1ZL0 A;  4AB7 A;  2CTB A;  1XEB A;  4L8A A;  1WVM A;  3IGR A;  1ON0 A;  3OP0 A;  1VHO A;  2J8N A;  4CAX A;  1ZLH A;  3SJE A;  2B4D B;  3D7G A;  4PV6 A;  4Q36 A;  4P44 A;  3BXM A;  3IC1 A;  3NE8 A;  1XE4 A;  1GHE A;  4QC6 A;  6CPA A;  1A2Z A;  1B87 A;  3KL9 A;  2ZEL A;  2IMO A;  4OC1 A;  4K3N A;  4MFJ A;  2AFZ A;  4CGO A;  5LRK A;  2O53 A;  1ARL A;  3UY5 A;  1BXR B;  4P4D A;  4BIN A;  3PB4 X;  5D8N A;  1YSJ A;  1LAP A;  4A39 A;  1EZA A;  3VWD A;  3EZE A;  4FD7 A;  2B5G B;  3NH4 A;  3CXS A;  2OZH A;  2ZEE A;  2BSW A;  3K4I A;  1BPN A;  1U6M A;  1CPX A;  3PB8 X;  2CNT A;  3OAK A;  1S3Z A;  4P4E A;  1IY7 A;  1M4D A;  3ZJ0 A;  2OB0 A;  2PJ1 A;  3VH9 A;  2WPX A;  2F5I A;  2BCO A;  3H8E A;  3C26 A;  3TLC A;  2G9D A;  3V7Z A;  2V8H A;  1ELM P;  1HDQ A;  2AE6 A;  4PXC A;  1J4J A;  4JWP A;  1Z8T A;  2PVW A;  2ZW7 A;  3GLJ A;  4CGL A;  2I3C A;  1FT7 A;  1M44 A;  1X10 A;  2AFS A;  5K8P A;  2J8R A;  5KTD A;  3VRR A;  4KVM E;  2HC9 A;  2JDC A;  3BUO B;  4ZI6 A;  1YGH A;  3KZW A;  1IU8 A;  2GAN A;  3B3V A;  5F48 A;  4C68 A;  8CPA A;  2PJA A;  2DIK A;  3SJG A;  2CTC A;  4OC3 A;  4MHD A;  3PLF B;  4U5Y A;  1ZYM A;  4NGM A;  1B6B A;  2Q51 A;  4QBJ A;  4WJB A;  5EC4 A;  5J8F A;  3U1B A;  3IWW A;  4Q7A A;  4KLW A;  3B35 A;  1JWQ A;  3HLP A;  3RYO A;  1R3N A;  2WSA A;  4MFZ A;  4A38 A;  5KTA A;  4MCR A;  4W9Y A;  4U9Z A;  3OWC A;  5F09 A;  4M8D A;  2BEI A;  4II9 A;  1S7K A;  4TJV A;  2FVG A;  2B58 A;  5KTC A;  1QSN A;  2AFM A;  3D3S A;  1VIX A;  2V8D A;  4HPS A;  4NJQ A;  3ZZI A;  5THW A;  2NYQ A;  4MY3 A;  3DSB A;  5LRG A;  1UWY A;  1L0C A;  4KOR A;  4C8A A;  3P2F A;  3WC6 A;  2XEJ A;  4PQA A;  2Q04 A;  2C6P A;  1VBG A;  5K99 A;  3IIB A;  3WC7 A;  4X5K A;  1S5K A;  2BUE A;  2QML A;  4ZX9 A;  3N5F A;  3EXN A;  1Y0Y A;  4OID A;  2WPW A;  4E2A A;  4M6H A;  5E96 A;  1IYK A;  4AG9 A;  7CPA A;  3HPG G;  1OZP A;  2FSR A;  3KRV A;  4XNH C;  2ZEM A;  1Y9K A;  2OZU A;  4PPZ A;  2FIA A;  1LOK A;  3KR5 A;  4KVX A;  4CYO A;  4ZY1 A;  2CY2 A;  1TKH A;  4PXE A;  2GLJ A;  3GY9 A;  4IIY A;  2PDO A;  3O8Z A;  4UCP A;  3D7D A;  1Z8W A;  2CXA A;  3FVL A;  4C8P A;  2OLS A;  1Z4E A;  1Y0R A;  3PZJ A;  4A95 A;  2B3V A;  3D66 A;  4UEF A;  2C1C A;  2GP4 A;  5EBV A;  4GS4 A;  4FD6 A;  4OP4 A;  3FEC A;  3IU2 A;  4OC4 A;  4GPL B;  2QVP A;  2FE7 A;  1Z4R A;  2UV8 G;  2XEG A;  1MJ9 A;  4MRI A;  5F46 A;  2HWG A;  3NH8 A;  3IWE A;  4KUA A;  1M6V B;  4RS2 A;  3TO9 A;  4JVO A;  2VKZ G;  4X2T A;  2Z3O A;  1CBX A;  1CP7 A;  1M4I A;  4GM5 A;  3KAS A;  3K9U A;  1TF9 A;  5H86 A;  1NSL A;  3RAM A;  3D2P A;  3T8W A;  1IGB A;  3TO7 A;  3TFY A;  3EIF A;  2VZZ A;  4MI1 A;  3F9K C;  3ZNI A;  1Y7R A;  2PRB A;  4Q38 A;  3HPH E;  3B3S A;  4UCN A;  4C99 A;  3PFE A;  4KNG E;  3D2M A;  3HUV A;  4MI4 A;  2N3A B;  1JDE A;  1CS0 B;  4KLV A;  4UWJ A;  3SXO A;  2EK8 A;  4EYS A;  2PIY A;  2IQ6 A;  2PJ0 A;  3FRM A;  3RNZ A;  3T0T A;  3S6H A;  1RTQ A;  3PFV A;  1Q2C A;  1Q2D A;  2P0W A;  5LRJ A;  4B12 A;  3BUX B;  1Z9U A;  4LQ6 A;  2FS5 A;  2Z3M A;  2FT0 A;  2EWB A;  3S6F A;  1QQ9 A;  2ZW5 A;  3NFZ A;  4BPX B;  4YFJ A;  3BUW B;  4JD6 A;  1XFO A;  3R95 A;  4AVC A;  4IHM A;  4B6Z A;  1LAN A;  5HKW A;  3KHZ A;  4CZ1 A;  3TLG A;  2JEV A;  1ZG7 A;  2GU2 A;  3RBU A;  3DLJ A;  5HXD A;  1Q5X A;  4ORF A;  4E5S A;  5D29 A;  3R9G A;  4HNY B;  3W6X A;  3D67 A;  4NGT A;  3I3G A;  3WAB A;  4C7H A;  3T07 A;  3R96 A;  4C7I A;  4QUS A;  2JBJ A;  2PR8 A;  4H6U A;  4NEX A;  1V6C A;  2YJV A;  4MHZ A;  2FCK A;  1DE4 C;  1H8L A;  5GCN A;  3KGQ A;  4MFQ A;  2PSW A;  3H4Q A;  2DEA A;  2EVN A;  1VKC A;  4Z65 A;  1VHE A;  1ZLI A;  3KQX A;  4CAW A;  3DNS A;  1GGO A;  3C8O A;  5BY0 A;  3V8I A;  1DIK A;  2E28 A;  4NGP A;  4OME A;  1HEE A;  4X8I A;  5LYI A;  2PJ4 A;  2Z3L A;  3JRU A;  1S7L A;  5AG5 A;  4DNC A;  5JPH A;  3B3C A;  1MK4 A;  4RN7 A;  2Q0Y A;  5AXI A;  1LCP A;  1BPM A;  2C27 A;  2ZEH A;  4NF1 A;  2AFX A;  1BLL E;  3A9L A;  5JQ4 A;  4CDK A;  1XF8 A;  3FMC A;  5CPA A;  4HKF A;  2GFQ A;  4UEE A;  1XBU A;  2AFW A;  2PJB A;  4NCZ A;  2HUZ A;  2Q7S A;  4G1P A;  5BWA B;  5K8O A;  4A4B A;  1YQE A;  3K2K A;  2R8V A;  3BI0 A;  3U88 C;  1YK3 A;  3GB0 A;  2R98 A;  5ELY A;  3LAC A;  4Y49 B;  4UIA A;  3TO6 A;  3FF3 A;  1C3O B;  3DGV A;  1R43 A;  3VRQ A;  3CXQ A;  4OC0 A;  1Q2Y A;  2PJ7 A;  2VI7 A;  3PB6 X;  1ZG8 A;  2V8V A;  5CNP A;  3W6S A;  4BBH A;  4P6Y A;  2AUM A;  2DF5 A;  2G3T A;  4QVT A;  3DDD A;  4UA3 A;  1YRE A;  1YX0 A;  1ZG9 A;  5G1Z A;  2J8M A;  5HH1 A;  3EZA A;  3IJ3 A;  4ONU A;  5G20 A;  2QJ8 A;  4KOU A;  4E8O A;  2CNM A;  1WWZ A;  1M1D A;  4TWE A;  2RC4 A;  4ZY2 A;  3TLZ A;  1VI4 A;  4EWT A;  2ANP A;  4R87 A;  5J3X A;  2F8H A;  4PK2 A;  4JZ0 A;  4XPD C;  4AXV A;  1KUX A;  4FD4 A;  1Z2L A;  3GIU A;  3LD2 A;  1I1D A;  2Q4Y A;  2XEF A;  3BUN B;  5HKZ A;  4JYW A;  1NE9 A;  3GKR A;  5HVF A;  1CE8 B;  3QNV A;  3FXT A;  3SXN A;  2QEC A;  4R3K A;  1TXR A;  3D4U A;  4NSQ A;  2VQY A;  4XPL A;  3DR6 A;  2P6E A;  5HVH A;  4H1H A;  4UEZ A;  5C82 A;  4PSW A;  3V38 A;  4XPK A;  2B3U A;  2FM4 A;  2RB7 A;  2VXK A;  4YWY A;  2REE A;  3FNC A;  2IJZ A;  4R57 A;  2O28 A;  2PCU A;  2ZPA A;  5F47 A;  4DJL A;  2EZC A;  3FB3 A;  5AG7 A;  2PIZ A;  4CAE A;  5LYL A;  1J3L A;  2JDD A;  2Z3P A;  4A94 A;  4J0N A;  3KKW A;  1KBL A;  3VGO A;  2PJ8 A;  4C85 A;  3IU1 A;  2ZOG A;  3ISZ A;  2K5T A;  3OB1 B;  4CGM A;  5IV0 A;  1ARM A;  2FL4 A;  5I4M A;  3N7Z A;  2YJT A;  2GIV A;  1VBH A;  3JUW A;  4JJX A;  4F9V A;  1VGY A;  3I6S A;  3TX8 A;  1Z8L A;  3VAR A;  5JVL A;  4BMH A;  1ZRS A;  2IL4 A;  4YU9 A;  2P6F A;  2Q43 A;  4H2K A;  2F7V A;  3BJ8 A;  4KSA A;  4UF4 A;  2AFU A;  1BOB A;  3TT2 A;  4CAF A;  3BJ7 A;  2YNE A;  1T36 B;  3CPA A;  4CO9 A;  3SHP A;  4JXQ A;  3ISX A;  4IIX A;  4CS0 B;  4MJX A;  3TOB A;  4Y49 C;  3F0A A;  2Z3N A;  2BOA A;  4P4J A;  1XMB A;  2ZEG A;  3PFO A;  4CGP A;  2A4N A;  1UFH A;  2I00 A;  2DXQ A;  2PJ9 A;  4CPA A;  3SR3 A;  1XJO A;  1Z5R A;  2AJ6 A;  3FEE A;  5JH9 A;  4UBR A;  2AFO A;  4IAV A;  2DLA A;  4MCQ A;  2VZY A;  4EME A;  4B11 A;  3GJZ A;  4UFV A;  1OBR A;  2R7H A;  3IFE A;  3B7I A;  4FBE A;  4CRZ B;  2YNC C;  1S7N A;  4KOX A;  4PSX A;  3WC5 A;  2Y1N A;  3WR7 A;  1YVO A;  2EBJ A;  3TYX A;  3NOJ A;  2XPN A;  4I49 A;  4MHN A;  3JVN A;  1MJB A;  3GUX A;  4NGS A;  1PYT B;  4B10 A;  2WZN A;  4CGN A;  5FD8 A;  2RFH A;  4OC5 A;  1CM0 A;  4C8U A;  4KZT A;  3DR8 A;  4C84 A;  3FJU A;  5F9M A;  4DUK A;  2QYV A;  5LYF A;  4AG7 A;  2ZEN A;  3LOD A;  1Z9E A;  4TNU A;  2OOT A;  4BPU B;  2CIJ A;  4H6Z A;  2G3A A;  2I79 A;  2PRQ A;  3B8G A;  1F2O A;  1LFW A;  2XEI A;  3RO0 A;  5HVG A;  4KOT A;  5I0C A;  1Y7E A;  4PK3 A;  2AUN A;  3TLE A;  3QAH A;  4R3L A;  4F8Z A;  2C6C A;  4MCP A;  3FED A;  3S9M A;  3D8P A;  4J3G A;  3PT1 A;  3VWE A;  4CYQ A;  3TCV A;  4C8T A;  3IWG A;  3PP9 A;  1QSM A;  4ZYQ A;  2Z3K A;  4B14 A;  4R76 A;  4NGQ A;  5EMI A;  3FBU A;  3PGP A;  3F8K A;  4JXR A;  3NFQ A;  4C9E A;  2PCN A;  1LAM A;  1YVK A;  2JBK A;  3CZX A;  4P4B A;  2Z0Z A;  2B0A A;  4TJX A;  1FNO A;  4KOY A;  1AUG A;  2FIW A;  3D7H A;  3H5Z A;  4MFK A;  1FY7 A;  3LWU A;  3CT9 A;  4R8F A;  1Q7L A;  4E94 A;  3EFA A;  2HV2 A;  4P4F A;  3QAY A;  1S7F A;  3I74 A;  3GYA A;  4UWI A;  5DS0 A;  1X12 A;  2CF4 A;  2OZG A;  4C9A A;  4MY0 A;  4COG A;  4ZX8 A;  1WJT A;  1TKF A;  5DWM A;  3VAT A;  3CDX A;  5AGE A;  3S9N A;  4KS9 A;  2Q44 A;  3PB9 X;  4LQG A;  1YVH A;  3B2Y A;  1DTD A;  4C8C A;  3T05 A;  4CDJ A;  3PBE A;  1QSR A;  3R9E A;  3MN8 A;  2Q4Z A;  4YRH A;  5C88 A;  4BPW B;  4PXD A;  2HRO A;  3S6K A;  3TLA A;  1I21 A;  4AVA A;  2FXF A;  1LRZ A;  2ZED A;  4AVB A;  1F2P A;  2NSM A;  2EK9 A;  3JTK A;  1QSO A;  4NFR A;  2ZW4 A;  2QIR A;  4B5P A;  4X3R A;  4CYN A;  3L2N A;  4A2Z A;  2EO8 A;  5A28 A;  1TF8 A;  2JEW A;  1NSA A;  3MGD A;  5ISV A;  4IK2 A;  4A30 A;  4C86 A;  4KVO E;  4NJR A;  2Y0M A;  4A31 A;  1VHS A;  4ZGY B;  1Y9W A;  1XOV A;  2PC1 A;  1AMP A;  3VRO A;  3I1U A;  3PB7 X;  2ZEF A;  1NXJ A;  4ONW A;  4C8F A;  1YLE A;  2B4D A;  2PJ3 A;  4OAE A;  2P6G A;  4WWV A;  1YLO A;  3S9L A;  2ZW6 A;  4O23 A;  2XPL A;  4PXB A;  2X7B A;  5JGF A;  4OKO A;  5G22 A;  3TE4 A;  1QST A;  2ZXV A;  4XNH B;  4BD9 A;  4FD5 A;  5IR2 A;  3T5M A;  3KHX A;  3B3T A;  3BUM B;  4L89 A;  4A32 A;  2BL1 A;  4M6I A;  4A4C A;  1NMT A;  4P10 A;  3E0K A;  5H84 A;  4C2Y A;  4RR2 B;  3TLY A;  2H5M A;  3NH5 A;  4RI1 A;  2B5G A;  4U9Y A;  3D68 A;  3IEH A;  1YW4 A;  3NA6 A;  1CG2 A;  1TKJ A;  1CJW A;  5F1Y A;  4YN3 A;  3W91 A;  3VTA A;  5F49 A;  2BO9 A;  2J9A A;  4P4I A;  1CP6 A;  3SI1 A;  4B5O A;  1KEE B;  3PBB A;  4OLL A;  2POK A;  1K4J A;  4JLY A;  5K8N A;  1AYE A;  3T9Y A;  4C2X A;  4EFD A;  2YND A;  2VL1 A;  4MHP A;  1CPS A;  5HKY A;  1M4G A;  2Q4V A;  3FX6 A;  3EY5 A;  3R9F A;  3TTH A;  3EZB A;  2B4J C;  4GXH A;  5HMN A;  1F57 A;  3QB8 A;  1M4L A;  1WK4 A;  1HDU A;  3H8G A;  2G0B A;  2WYR A;  4IUS A;  3VRN A;  2NMT A;  2R82 A;  4KOW A;  4H89 A;  2YNC A;  3P2H A;  4R9M A;  3EC4 A;  5LYD A;  1XF1 A;  4NGN A;  5FVJ A;  2PJC A;  4CAV A;  2PJ2 A;  2JLM A;  1NBW A;  1JQG A;  3NE7 A;  1KUY A;  2ABZ A;  3BI1 A;  2MP0 A;  2OU2 A;  4C9R A;  1YR0 A;  3KR4 A;  2VEZ A;  1RXT A;  4KOV A;  5IB0 A;  5JYB A;  2OH1 A;  2O4H A;  1IIC A;  3B3W A;  4B13 A;  4MXU A;  4C2Z A;  2HI6 A;  2XPP A;  4MJ8 A;  2DPT A;  1Z8X A;  4M85 A;  1IYL A;  3OB2 B;  4RUH A;  4LX9 A;  4ZY0 A;  2EZA A;  3K9T A;  1C30 B;  1V0C A;  2OR4 A;  4FUU A;  1GYT A;  4MFP A;  2PE3 A;  1KC7 A;  4R7M A;  2B4B A;  5G21 A;  4IF5 A;  4OC2 A;  3H8F A;  5J8C A;  4OIW A;  4F0Y A;  3R1K A;  2D0P A;  2PR1 A;  3IO1 A;  2Z10 A;  1MJA A;  2XPO A;  2ZEP A;  5AG6 A;  2PVV A;  1ELL P;  2ZEO A;  3CXP A;  3VRP A;  1EO0 A;  2GE3 A;  2VBQ A;  2CNS A;  3FIX A;  4MCS A;  1A9X B;  1I12 A;  4M3S A;  2EZB A;  1IB1 E;  1YME A;  1KUV A;  3BLN A;  4CRY B;  3KQZ A;  5DWN A;  4UCM A;  2Q7B A;  2GRE A;  3PRT A;  1YW6 A;  4OAD A;  2WUU A;  2ARH A;  1S60 A;  4UFX A;  3LMS A;  1BAV A;  1ZO0 A;  4NGR A;  4KOS A;  4M6G A;  4MFL A;  1R57 A;  5K8M A;  1JDB C;  2YGW A;  3SJF A;  3PEI A;  4HNX B;  1PUA A;  4E0A A;  3TLB A;  3TLG B;  3T90 A;  1IID A;  3WT4 A;  4UIB A;  2X0S A;  3G23 A;  1P4N A;  1XIX A;  1SQH A;  3BHX A;  1P0H A;  3S6G A;  2Y1M A;  3TOA A;  1EE3 P;  4EVY A;  5JM6 A;  4INJ A;  2CBL A;  4BTF A;  2HB6 A;  2ODF A;  2PJ5 A;  4YGO A;  4F9U A;  1Y9Z A;  1IOI A;  2HQY A;  4FWU A;  5F13 A;  1KZF A;  1KWM A;  1TIQ A;  3EO4 A;  1B47 A;  3FH4 A;  2REF A;  4DYO A;  4F0X A;  5AG4 A;  3TC8 A;  4MHY A;  1XRY A;  3SJX A; 
#chains in the Genus database with same CATH homology
 4R6T A;  5IB9 A;  2PJ6 A;  4FAI A;  3ICU A;  2GLF A;  4KSI A;  3D7F A;  5CBM A;  4C9V A;  3SI0 A;  1PCA A;  3MRU A;  2C5Q A;  2C6G A;  1QMU A;  2V77 A;  3CPX A;  4P45 A;  3KI9 A;  1CX8 A;  4C9U A;  2V8G A;  3RZA A;  4MMO A;  3SI2 A;  2ZOF A;  5J1Q A;  4A37 A;  1WVM A;  2CTB A;  1VHO A;  1ZLH A;  3SJE A;  3D7G A;  4P44 A;  3BXM A;  3IC1 A;  6CPA A;  3KL9 A;  2ZEL A;  2IMO A;  4OC1 A;  4K3N A;  5LRK A;  2AFZ A;  2O53 A;  1ARL A;  4P4D A;  3PB4 X;  5D8N A;  1YSJ A;  1LAP A;  4A39 A;  3NH4 A;  2ZEE A;  1BPN A;  1CPX A;  3PB8 X;  4P4E A;  1IY7 A;  2PJ1 A;  3VH9 A;  3H8E A;  2BCO A;  2G9D A;  3V7Z A;  2V8H A;  1ELM P;  1HDQ A;  4PXC A;  2PVW A;  3GLJ A;  2I3C A;  1FT7 A;  2AFS A;  5K8P A;  2HC9 A;  4ZI6 A;  3KZW A;  8CPA A;  3B3V A;  2PJA A;  3SJG A;  2CTC A;  4OC3 A;  4NGM A;  2Q51 A;  4WJB A;  3IWW A;  4Q7A A;  3B35 A;  3HLP A;  1R3N A;  4A38 A;  4MCR A;  4W9Y A;  5F09 A;  4TJV A;  2FVG A;  2AFM A;  4NJQ A;  1VIX A;  2V8D A;  5THW A;  2NYQ A;  5LRG A;  1UWY A;  4C8A A;  3WC6 A;  2XEJ A;  4PQA A;  2C6P A;  3IIB A;  3WC7 A;  4ZX9 A;  3N5F A;  1Y0Y A;  4OID A;  7CPA A;  2ZEM A;  4PPZ A;  1LOK A;  3KR5 A;  4ZY1 A;  1TKH A;  4PXE A;  2GLJ A;  3D7D A;  3FVL A;  4C8P A;  1Y0R A;  3D66 A;  4UEF A;  2C1C A;  2GP4 A;  4OP4 A;  3FEC A;  4OC4 A;  2QVP A;  2XEG A;  4MRI A;  3NH8 A;  4X2T A;  1CBX A;  1CP7 A;  4GM5 A;  3KAS A;  1TF9 A;  3RAM A;  3T8W A;  1IGB A;  3EIF A;  3B3S A;  4C99 A;  3PFE A;  4KNG E;  3HUV A;  2EK8 A;  2PIY A;  2IQ6 A;  2PJ0 A;  1RTQ A;  5LRJ A;  2EWB A;  1QQ9 A;  3NFZ A;  1XFO A;  4B6Z A;  4IHM A;  1LAN A;  3KHZ A;  1ZG7 A;  2GU2 A;  3RBU A;  3DLJ A;  5HXD A;  5D29 A;  3WAB A;  3D67 A;  4NGT A;  2JBJ A;  1V6C A;  4MHZ A;  1DE4 C;  1H8L A;  3KGQ A;  2DEA A;  4Z65 A;  1VHE A;  1ZLI A;  3KQX A;  4NGP A;  4OME A;  1HEE A;  4X8I A;  5LYI A;  2PJ4 A;  3JRU A;  3B3C A;  1LCP A;  2ZEH A;  1BPM A;  2AFX A;  1BLL E;  4CDK A;  3FMC A;  5CPA A;  4UEE A;  1XBU A;  2AFW A;  2PJB A;  4G1P A;  5K8O A;  3K2K A;  3BI0 A;  3GB0 A;  5ELY A;  4UIA A;  3FF3 A;  3DGV A;  1R43 A;  4OC0 A;  5HVG A;  2PJ7 A;  3PB6 X;  1ZG8 A;  2V8V A;  4P6Y A;  1ZG9 A;  3IJ3 A;  2QJ8 A;  4TWE A;  4ZY2 A;  4EWT A;  2ANP A;  2F8H A;  4AXV A;  4JZ0 A;  1Z2L A;  2XEF A;  5HVF A;  4JYW A;  3QNV A;  1TXR A;  3D4U A;  5HVH A;  4UEZ A;  3V38 A;  2RB7 A;  4YWY A;  2IJZ A;  2PCU A;  4DJL A;  2PIZ A;  5LYL A;  4A94 A;  2PJ8 A;  4C85 A;  2ZOG A;  3ISZ A;  1ARM A;  5I4M A;  4F9V A;  1VGY A;  3I6S A;  3TX8 A;  1Z8L A;  3VAR A;  4YU9 A;  2Q43 A;  4H2K A;  2F7V A;  4UF4 A;  2AFU A;  3CPA A;  3ISX A;  2BOA A;  4P4J A;  1XMB A;  2ZEG A;  3PFO A;  2PJ9 A;  4CPA A;  1XJO A;  1Z5R A;  5JH9 A;  3FEE A;  2AFO A;  4IAV A;  4MCQ A;  4EME A;  1OBR A;  3IFE A;  3B7I A;  4FBE A;  3WC5 A;  4MHN A;  3GUX A;  4NGS A;  1PYT B;  2WZN A;  2RFH A;  4OC5 A;  4C8U A;  4C84 A;  3FJU A;  4DUK A;  2QYV A;  5LYF A;  2ZEN A;  4TNU A;  2OOT A;  2CIJ A;  2PRQ A;  1F2O A;  1LFW A;  2XEI A;  1Y7E A;  4F8Z A;  2C6C A;  4MCP A;  3FED A;  3S9M A;  4ZYQ A;  4R76 A;  4NGQ A;  4C9E A;  1LAM A;  4TJX A;  2JBK A;  4P4B A;  1FNO A;  3D7H A;  3LWU A;  3CT9 A;  4R8F A;  1Q7L A;  4P4F A;  3I74 A;  5DS0 A;  2CF4 A;  4C9A A;  4ZX8 A;  3VAT A;  1TKF A;  3CDX A;  3S9N A;  3PB9 X;  4LQG A;  3B2Y A;  4C8C A;  1DTD A;  4CDJ A;  3PBE A;  3MN8 A;  2Q4Z A;  4PXD A;  2ZED A;  1F2P A;  2NSM A;  2EK9 A;  4NFR A;  4X3R A;  3L2N A;  1TF8 A;  2JEW A;  1NSA A;  4IK2 A;  4C86 A;  4NJR A;  3I1U A;  1AMP A;  3PB7 X;  2ZEF A;  4ONW A;  4C8F A;  2PJ3 A;  4WWV A;  1YLO A;  3S9L A;  5JGF A;  4O23 A;  4PXB A;  5IR2 A;  4OKO A;  4BD9 A;  3KHX A;  3B3T A;  4P10 A;  3NH5 A;  3D68 A;  3IEH A;  1YW4 A;  3NA6 A;  1CG2 A;  1TKJ A;  4YN3 A;  3VTA A;  2BO9 A;  2J9A A;  4P4I A;  1CP6 A;  3SI1 A;  3PBB A;  2POK A;  5K8N A;  1AYE A;  4EFD A;  4MHP A;  2VL1 A;  4C8T A;  1CPS A;  3FX6 A;  1F57 A;  1M4L A;  1HDU A;  3H8G A;  2WYR A;  5LYD A;  1XF1 A;  4NGN A;  2PJC A;  2PJ2 A;  1JQG A;  2ABZ A;  3BI1 A;  4C9R A;  3KR4 A;  2O4H A;  3B3W A;  4MXU A;  4RUH A;  4ZY0 A;  3K9T A;  4FUU A;  2OR4 A;  1GYT A;  2PE3 A;  4R7M A;  4OC2 A;  3H8F A;  4OIW A;  3IO1 A;  2ZEP A;  2PVV A;  1ELL P;  2ZEO A;  4MCS A;  1YME A;  3KQZ A;  2GRE A;  3PRT A;  1YW6 A;  3LMS A;  1BAV A;  4NGR A;  5K8M A;  3SJF A;  3PEI A;  3WT4 A;  4UIB A;  3BHX A;  5JM6 A;  1EE3 P;  4F9U A;  2HB6 A;  2PJ5 A;  1Y9Z A;  4FWU A;  3FH4 A;  1KWM A;  4DYO A;  3TC8 A;  4MHY A;  1XRY A;  3SJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...