4NGQA

Crystal structure of glutamate carboxypeptidase ii in a complex with urea-based inhibitor
Total Genus 257
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
257
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Rational design of urea-based glutamate carboxypeptidase II (GCPII) inhibitors as versatile tools for specific drug targeting and delivery
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Glutamate carboxypeptidase 2
total genus 257
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4ngqA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4ngqA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4ngqA02
2PJ2A 2PJ5A 5ELYA 5CBMA 1YMEA 2Q4ZA 3FJUA 4ONWA 2PJBA 1EE3P 3D68A 4BD9A 2BOAA 3NH8A 2ZEPA 1ARLA 4NGRA 3NFZA 3ISXA 1TF9A 5HVGA 2BCOA 4F9UA 4PXDA 4DJLA 4UIBA 2PIZA 1TKFA 4FBEA 3S9MA 2XEJA 3IWWA 3VH9A 2ZEHA 3FF3A 4F8ZA 4MMOA 3BI1A 3IEHA 4P4IA 3KR4A 1LCPA 3FH4A 3PRTA 4IK2A 4JYWA 3KHXA 4CDJA 5LYFA 4ZYQA 2PJAA 1F2OA 3EIFA 1CBXA 2IQ6A 3WT4A 3PB9X 4C85A 3KR5A 4MHZA 4UEEA 2NYQA 3DLJA 5D29A 4EMEA 5HVHA 1AYEA 3KHZA 1HDUA 4P6YA 3I6SA 3NA6A 4W9YA 4NGMA 4C8TA 3H8FA 1OBRA 1YW4A 4A38A 4P45A 4RUHA 2PJ4A 4FWUA 4C8CA 1JQGA 4ZI6A 3BXMA 2IMOA 1IY7A 2PCUA 1ELLP 4YWYA 1XMBA 2CIJA 2QVPA 4NGPA 2ZEEA 4F9VA 2CTCA 3IIBA 4NGNA 4K3NA 2V8VA 3GLJA 4NGSA 1VGYA 4P10A 5J1QA 3I74A 2OR4A 2AFWA 4CPAA 1ZG9A 4ZX9A 3D7FA 2ZENA 1YSJA 4PXBA 4MCQA 3KQXA 3SI2A 4UF4A 1TXRA 1ZG8A 5K8OA 1QMUA 2WYRA 4ZY2A 4OC5A 4OC2A 2PJ0A 3IFEA 3IJ3A 2ZEDA 4UIAA 5HXDA 2WZNA 2OOTA 4MCSA 4P44A 1BLLE 1GYTA 3B3VA 3D7DA 1Z8LA 3VTAA 1TKHA 4Z65A 4OMEA 7CPAA 4C8UA 3NH4A 5D8NA 2ZEMA 2PJ3A 3H8GA 3D67A 2IJZA 1BPMA 1LANA 3D7GA 4MHYA 2F7VA 4DUKA 1NSAA 5JM6A 5LYDA 4C8PA 4OKOA 3CPAA 3KL9A 4OIDA 3WABA 3TX8A 2V77A 1V6CA 3KQZA 3SJEA 1Y9ZA 1XRYA 1PYTB 4TJXA 4FUUA 4IAVA 3KASA 4AXVA 1Z5RA 1CPSA 2RFHA 4O23A 1PCAA 5JH9A 4R6TA 3H8EA 2I3CA 1LFWA 3PBBA 1R3NA 4OIWA 2Q51A 4X8IA 4NJRA 3NH5A 3FMCA 1CG2A 3SI1A 5JGFA 3K2KA 3T8WA 1CP7A 2G9DA 5I4MA 2C1CA 2PJ9A 4MXUA 1FNOA 3V38A 4C86A 3GB0A 2POKA 2ZOGA 5LRKA 4KNGE 1XBUA 4C84A 3N5FA 4TNUA 2XEFA 4EFDA 2HC9A 1CPXA 1HDQA 5LRGA 1R43A 3IC1A 1YW6A 2PJ8A 3JRUA 3I1UA 2CTBA 2AFXA 5CPAA 4OC4A 1Q7LA 3ICUA 3D4UA 2ZELA 5DS0A 3MRUA 3CT9A 3SJGA 1BAVA 3S9LA 2V8HA 2NSMA 3PEIA 8CPAA 3SJXA 4YU9A 4C9AA 2XEIA 3SJFA 1XFOA 1FT7A 4EWTA 3FEDA 2GLJA 2AFZA 4X3RA 4P4DA 4PXEA 1XJOA 1DTDA 3GUXA 1UWYA 1LAPA 5LYLA 5K8NA 2ZEOA 3L2NA 3D66A 2V8GA 1M4LA 3IO1A 1TF8A 2PJ1A 3SI0A 3S9NA 2JBKA 4NJQA 4P4JA 4MRIA 4MHNA 4MCRA 2ZOFA 4PXCA 4OC3A 5IB9A 2ABZA 1CP6A 3WC5A 1BPNA 4R8FA 3HUVA 1DE4C 2ANPA 3B3WA 3FVLA 1Y0RA 2GLFA 2VL1A 1VHEA 4MHPA 2GU2A 3CDXA 4P4EA 1Z2LA 4C9RA 4R7MA 3FECA 2PJ6A 4G1PA 3ISZA 4CDKA 5K8MA 1H8LA 4MCPA 2XEGA 4PPZA 4IHMA 2V8DA 1ZLIA 2AFOA 4NGTA 2FVGA 4KSIA 2C6PA 2O53A 4PQAA 2PIYA 3B3CA 4ZY0A 4NFRA 4UEZA 3KI9A 4B6ZA 5THWA 4YN3A 1LAMA 1VIXA 4OP4A 3RZAA 3VARA 2JBJA 4OC1A 3VATA 4C9VA 4H2KA 2HB6A 2Q43A 2RB7A 1YLOA 1Y7EA 3PB6X 2QJ8A 3KZWA 3BHXA 3B35A 1KWMA 2EWBA 3K9TA 3LMSA 4GM5A 3PBEA 3B3SA 4P4BA 4JZ0A 1AMPA 2EK8A 2GREA 2PVVA 3D7HA 1TKJA 5K8PA 1ARMA 4R76A 3BI0A 3LWUA 4P4FA 3FEEA 1F2PA 2PJCA 4ZY1A 3PFOA 5HVFA 4TJVA 4TWEA 5F09A 6CPAA 3PFEA 2O4HA 2C6CA 4C99A 1XF1A 1WVMA 4C8FA 3MN8A 2BO9A 2ZEGA 1F57A 4OC0A 3V7ZA 3WC6A 2F8HA 1LOKA 4Q7AA 4C9EA 4WWVA 3PB4X 3PB8X 3KGQA 1ELMP 3B3TA 5LRJA 2EK9A 3QNVA 2PVWA 1IGBA 4A37A 2DEAA 2PE3A 4FAIA 4DYOA 1QQ9A 2AFSA 2PJ7A 1Y0YA 1ZG7A 3PB7X 1CX8A 3RAMA 5LYIA 3CPXA 4ZX8A 3B2YA 3RBUA 2AFMA 2AFUA 3WC7A 4LQGA 4C8AA 4C9UA 3B7IA 1RTQA 1HEEA 2QYVA 4A94A 2C6GA 3FX6A 3HLPA 2JEWA 1ZLHA 2ZEFA 3TC8A 2CF4A 2PRQA 2J9AA 1VHOA 4WJBA 4X2TA 4NGQA 3DGVA 4A39A 4UEFA
chains in the Genus database with same CATH superfamily
2PJ2A 5A27A 1VI4A 2PJ5A 1BXRB 3DDDA 4C2XA 5F46A 3OB1B 5ELYA 5EMIA 3IU2A 4CGOA 5CBMA 3PLFB 2ZPAA 3JTKA 4MY3A 5BWAB 4IIYA 3TO7A 3VROA 2ZW6A 1YMEA 3KKWA 1YVOA 2Q4ZA 3FJUA 4YFJA 1I12A 2REEA 4JJXA 1JDEA 1YQEA 4ONWA 3R9EA 5IX3A 4AG7A 2PJBA 5CNPA 4R57A 1EE3P 3D68A 2R98A 4BD9A 4A31A 2EUIA 4J0NA 2BOAA 3NH8A 2ZEPA 1ARLA 5G22A 4CAEA 4NGRA 3NFZA 5AXIA 3ISXA 1TF9A 5HVGA 4MFKA 2BCOA 1FBVA 4F9UA 1KUXA 4PXDA 3ZJ0A 4BMHA 4M6HA 4DJLA 3F9KC 4UIBA 2PIZA 3OB2B 3EXNA 4QUSA 1TKFA 4FBEA 4NEXA 4CS0B 5HKYA 3S9MA 2XEJA 3IWWA 3VH9A 2JEVA 2ZEHA 3BJ8A 3FF3A 4F8ZA 2CNTA 4MMOA 3D2PA 4JD6A 3BI1A 3IEHA 4P4IA 3R96A 1M1DA 4X5KA 3KR4A 3F0AA 3F8KA 2DLAA 4RS2A 5AG5A 2Q7BA 1LCPA 3FH4A 3PRTA 3TE4A 4IK2A 5HKWA 2C27A 4UFVA 2HROA 4JYWA 1YVHA 3EZAA 3KHXA 2P0WA 1M4GA 3QAHA 4EVYA 2GFQA 2PJAA 4ZYQA 1U6MA 4BBHA 5LYFA 2C5QA 3TLCA 4BTFA 2OLSA 1F2OA 3FIXA 3EIFA 1WWZA 4MFLA 3V8IA 5C88A 3RYOA 1CBXA 2IQ6A 3WT4A 2B58A 1S7KA 3PB9X 4C85A 2JLMA 3I9SA 3R9GA 3KR5A 2YJTA 2OU2A 4MHZA 4UEEA 2DIKA 4A95A 2NYQA 3DLJA 5D29A 4EMEA 5HVHA 1Z9UA 1AYEA 1IB1E 3KHZA 5G21A 1HDUA 4P6YA 3I6SA 4CO9A 3NA6A 4W9YA 4NGMA 4C8TA 3H8FA 1OBRA 1YW4A 4NXYA 4QB9A 4A38A 4P45A 2ZW4A 3CXSA 3FYNA 4NCZA 3LD2A 2EO8A 2PJ4A 1PUAA 2Q4VA 4FWUA 4E8OA 4RUHA 4IIXA 4C8CA 4E5SA 3TO6A 1JQGA 2G3TA 4ZI6A 3PFVA 4FD5A 3BXMA 4C7HA 2IMOA 1IY7A 5F48A 2PCUA 3P2HA 2H5MA 1ELLP 4PV6A 4YWYA 3S6GA 2AUNA 4GPLB 1XMBA 4K30A 2CIJA 3E0KA 4NF1A 5G20A 2QVPA 5C82A 3TLGB 3S6HA 4PSWA 3GIUA 3D2MA 4NGPA 2ZEEA 3VRRA 1Z4EA 4F9VA 4B12A 4XPDC 4II9A 3EZBA 2CTCA 3MGDA 2ZW7A 4NGNA 3IIBA 1Z8XA 2OZUA 4K3NA 3EO4A 1S60A 1S3ZA 2V8VA 3GLJA 4NGSA 1EZBA 4KVXA 2Z3LA 3P2FA 4I49A 3DNSA 1IU8A 1VGYA 4P10A 5J1QA 4JXQA 3I74A 2VZYA 2HV2A 5F47A 2OR4A 4MFQA 4CAXA 3H4QA 2AFWA 4CPAA 4AVAA 1ZG9A 4UBRA 2B3UA 4M3SA 4ZX9A 3D7FA 2ZENA 1QSOA 1YSJA 4PXBA 3DR6A 4HNYB 2CNSA 2XPLA 4MCQA 3VRPA 2BEIA 3KQXA 2HWGA 3GKRA 5F1YA 3SI2A 4LQ6A 1TXRA 4UF4A 2UV8G 1ZG8A 2I79A 4CRYB 1SQHA 2CXAA 2YNCA 2WPWA 5K8OA 1C3OB 4CGLA 3FB3A 1QMUA 2WYRA 3EC4A 4ZY2A 4OC5A 4Y49B 4OC2A 2PJ0A 3IFEA 3IJ3A 2ZEDA 3GY9A 4UIAA 1C30B 3TLYA 4M6IA 4ZGYB 3IU1A 2Q0YA 3JVNA 5HXDA 2WZNA 2OOTA 4MCSA 4P44A 4HNWB 2Q44A 4C68A 3I3GA 1KUYA 3TOAA 1BLLE 5BY0A 1GYTA 3B3VA 4E0AA 3D7DA 2GANA 5HMNA 1Z8LA 4B13A 1DIKA 3VTAA 4CYNA 2FE7A 3T0TA 1TKHA 1QSRA 1K4JA 3RNZA 4Z65A 2MP0A 3T07A 4OMEA 2WSAA 3W6XA 4U9ZA 7CPAA 3GJZA 4C8UA 1QSMA 3NH4A 2O28A 2ZEMA 5D8NA 4B5PA 2PJ3A 3H8GA 4PK2A 3D67A 2IJZA 3NOJA 5EBVA 4COGA 2R8VA 3U88C 4PK3A 1ZL0A 1BPMA 4KUAA 3TLBA 2FIWA 1LANA 3D7GA 1KZFA 4QC6A 4L89A 1YGHA 4MHYA 2F7VA 2JDDA 1NSAA 3A9LA 4DUKA 5JM6A 2B4BA 1EZAA 1IIDA 4BPUB 5LYDA 4C8PA 4OKOA 3CPAA 1YREA 3KL9A 2PDOA 4OIDA 4B11A 4KOSA 3WABA 3TX8A 4ORFA 2V77A 1VHSA 3T90A 2N3AB 1M4DA 3KQZA 1V6CA 3SJEA 4OAEA 2VBQA 1Y9ZA 1XRYA 5EC4A 4R3LA 3HPHE 2X7BA 1S7NA 2X0SA 1PYTB 4TJXA 2YNCC 2VQYA 4FUUA 4IAVA 3KASA 3EY5A 4AXVA 3JUWA 2Z3OA 1Z5RA 1CPSA 2RFHA 3R9FA 4LUAA 1WJTA 4O23A 1PCAA 2FIAA 4KLVA 5JH9A 3BUMB 4AVBA 4M8DA 4R6TA 4NSQA 3NFQA 3H8EA 2EVNA 2I3CA 2J8MA 1LFWA 4B5PB 1R57A 4YRHA 5J8CA 3VRQA 5KTCA 1IOIA 3PBBA 1R3NA 4OIWA 2Q51A 3TFYA 4X8IA 5FVJA 3PP9A 3ZNIA 4NJRA 4M6GA 3DR8A 3NH5A 2HI6A 3FMCA 1B87A 1CG2A 3FXTA 4UFXA 2PSWA 3BUXB 3SI1A 5JGFA 3K2KA 4B14A 3N7ZA 2HQYA 1KC7A 1VKCA 3T8WA 4BINA 1PU9A 1XF8A 3G3SA 1Q5XA 1CP7A 2D4OA 4KS9A 1B6BA 1KBLA 2G9DA 4YGOA 2C1CA 4ZBGA 5I4MA 1JDBC 3TTHA 3SR3A 2PJ9A 2Q7SA 4MXUA 1FNOA 3V38A 4JVOA 4C86A 3GB0A 1VBGA 2POKA 1YLEA 2ZOGA 5LRKA 4KNGE 1XBUA 2B3VA 4GXHA 4C84A 2BUEA 4R3KA 1ON0A 1EO0A 3EFAA 2B0AA 3N5FA 3QAYA 4TNUA 2XEFA 3BUOB 3TO9A 3T05A 1S7FA 3CXPA 1MJAA 4KOXA 2XPNA 3PT1A 4U9YA 4EFDA 4MFPA 2HC9A 1CPXA 1HDQA 1QSTA 2FT0A 5LRGA 4CAVA 4E2AA 1R43A 5IV0A 1BOBA 2P6EA 3IC1A 4A4BA 2PCNA 4HKFA 1YW6A 2PJ8A 2PR1A 4CYQA 1NXJA 3JRUA 1X10A 4UEFA 4UCPA 3I1UA 5HKZA 2CTBA 4Q38A 1P4NA 2AFXA 5KTAA 3UY5A 2NMTA 5CPAA 4OC4A 4KVME 1YX0A 1Q7LA 5K99A 3ICUA 1N71A 4R87A 4AB7A 4MHDA 2R7HA 4XPLA 3D4UA 3VWEA 5IR2A 2PR8A 2DF5A 2K5TA 2ZELA 4FD7A 5DS0A 3IWEA 3MRUA 2R82A 3CT9A 3SJGA 1BAVA 4H1HA 3S9LA 2V8HA 2NSMA 3C26A 4OLLA 4CGNA 3PEIA 8CPAA 3SJXA 1LRZA 4YU9A 4C9AA 2XEIA 5JVLA 4CAWA 4CYPA 3SJFA 1XFOA 4JLYA 3T5MA 1FT7A 4EWTA 3SHPA 1Y9WA 3FEDA 2GLJA 5F9MA 4KZTA 2AFZA 4KOWA 2HUZA 2Z3NA 3LODA 4IUSA 4F0XA 2WUUA 4C7IA 4X3RA 4P4DA 2REFA 4PXEA 1XJOA 1YR0A 5F13A 3R1KA 1AUGA 1DTDA 2OB0A 2B5GB 3GUXA 1UWYA 1LAPA 2FCKA 5LYLA 4B5OA 5K8NA 1XMTA 2ZEOA 3L2NA 4A32A 4XPKA 1XEBA 3D66A 2V8GA 4UWIA 1M4LA 3IO1A 1TF8A 1X12A 5JYBA 2PJ1A 3SI0A 3S9NA 1J3LA 4A2ZA 4UWJA 2FM4A 2JBKA 4RR2B 4NJQA 2J8RA 2QIRA 3HMJG 1I1DA 1KUVA 4H6UA 4CGMA 4P4JA 2PC1A 2GP4A 3VGOA 4MRIA 5IB0A 1L0CA 2CY2A 4MHNA 3FNCA 3RO0A 2D0PA 4MCRA 2ZOFA 4PXCA 4C2YA 4OC3A 2CNMA 2QMLA 5IB9A 1YK3A 4ONUA 3W6SA 3TCVA 2ABZA 2P6GA 2D0OA 1CP6A 2RC4A 1BPNA 4JXRA 4R8FA 3WC5A 3HUVA 5J3XA 1DE4C 2KCWA 2ANPA 3B3WA 3FVLA 4H6ZA 2CBLA 4A4CA 1Y0RA 4OADA 2GLFA 5AG4A 2VL1A 1WK4A 5H86A 2DXQA 1VHEA 1MK4A 4MHPA 3TLEA 2GU2A 2B4JC 2B5GA 1CM0A 1Q2YA 3CDXA 4P4EA 1Z2LA 4JWPA 5F49A 4R7MA 4C9RA 2D4PA 2Z3KA 3FECA 2ZW5A 3B8GA 1NBWA 2B4DB 2PJ6A 4G1PA 3ISZA 4CDKA 1IOFA 2ODFA 5K8MA 1Y7RA 1H8LA 1ZO0A 3TOBA 3ZZIA 2OZHA 4INJA 2OZGA 2F5IA 3F5BA 4MCPA 2FSRA 1IYKA 2XEGA 4L8AA 4PPZA 4IHMA 3FRMA 2AE6A 4M85A 3QB8A 2V8DA 2FL4A 1ZLIA 2AFOA 2IL4A 4KOYA 4A30A 4NGTA 2FVGA 4KSIA 2Q4YA 4MBUA 4MI4A 4CYOA 1GGOA 4B10A 1T36B 5A28A 3U1BA 4F0YA 2C6PA 2ZXVA 2Z0ZA 2Y1MA 2O53A 4MJ8A 4PQAA 1V0CA 4RN7A 2PIYA 3HPGG 3B3CA 5KTDA 2VEZA 4Y49C 4NFRA 4ZY0A 2R1IA 2A4NA 4UEZA 3KI9A 1XOVA 3S6KA 4AVCA 4B6ZA 4KLWA 3SXOA 2G3AA 2Z3MA 1FY7A 3BJ7A 5THWA 4XNHB 4YN3A 4UFWA 1LAMA 2Y0MA 4PSXA 1M4IA 1XIXA 3BUNB 1VIXA 4OP4A 3RZAA 3VARA 2JBJA 2PQ8A 4GS4A 5HH1A 4OC1A 2EZCA 3IWGA 4MI1A 2VKZG 3VATA 2EZAA 2ATRA 1QSNA 2Z11A 1A2ZA 4FD6A 2GE3A 4XPDB 4HPSA 4A33A 2Z10A 3OAKA 4H2KA 2Y1NA 4KOTA 5GCNA 4QBJA 4C9VA 2HB6A 3IGRA 4CZ1A 2Q43A 2RB7A 4KORA 1YLOA 1Y7EA 2QJ8A 3KZWA 2VXKA 2QECA 3PB6X 3BHXA 2G0BA 3B35A 3PGPA 2YNDA 3BLNA 3TT2A 3K4IA 1Z8TA 4IF5A 1KWMA 3H5ZA 4J3GA 2EWBA 3K9TA 1MJBA 3LMSA 5J8FA 4BPWB 1MJ9A 3PBEA 4GM5A 4KUBA 2ARHA 3B3SA 1NSLA 3W91A 2YJVA 4P4BA 1OZPA 4JZ0A 1AMPA 1I21A 2EK8A 2GREA 2PVVA 3D7HA 3NE8A 3DSBA 3WR7A 1TKJA 3S6FA 5K8PA 1YVKA 1Q2DA 1ARMA 3VRNA 3G8WA 3BI0A 4R76A 1R61A 3KRVA 3LWUA 3EZEA 4P4FA 3FEEA 1F2PA 2PJCA 4ZY1A 4CAFA 3PFOA 4MFZA 5DWNA 3OWCA 3CXQA 5HVFA 2DPSA 4TJVA 4TWEA 5F09A 6CPAA 3TYXA 3PFEA 2WPXA 2O4HA 4C2ZA 4BPXB 2C6CA 2AJ6A 1IYLA 2GIVA 2J8NA 4FD4A 3NE7A 4QVTA 4CGPA 1XF1A 4C99A 1WVMA 4C8FA 1BO4A 2PRBA 3MN8A 1A9XB 1RXTA 2YNEA 2YGWA 4COBA 1NE9A 2BO9A 4MJXA 2ZEGA 5I0CA 1IICA 1F57A 4UCMA 4OC0A 2VI7A 4RI1A 2F8HA 5AG6A 3V7ZA 3WC6A 5F5XA 1RO5A 1LOKA 4Q7AA 2DPTA 4HNXB 1J4JA 2EZBA 4WWVA 4C9EA 3O8ZA 3PB4X 3PB8X 2E28A 3G23A 3KGQA 1Z9EA 1ELMP 3B3TA 3OP0A 3CZXA 5LRJA 3VWDA 2EK9A 4Q36A 5FD8A 3TLAA 3QNVA 2PVWA 5H84A 3K9UA 3TLGA 1IGBA 4A37A 2DEAA 2PE3A 4FAIA 4E94A 4XNHC 1CJWA 1P0HA 4DYOA 1VBHA 4KOVA 1QQ9A 1B47A 2AFSA 1M44A 2Z3PA 2PJ7A 4KVOE 4CRZB 1Y0YA 5E96A 4KSFA 5G1ZA 4R9MA 2XPOA 1ZG7A 1NMTA 1CX8A 3PB7X 5DWMA 5LYIA 2P6FA 3RAMA 3CPXA 4ZX8A 3B2YA 3RBUA 2AFMA 2BL1A 2AFUA 5AGEA 3D8PA 3WC7A 4LQGA 1CS0B 1JWQA 2Q04A 4UA3A 3C8OA 1ZYMA 4C8AA 4KSAA 3GYAA 5AG7A 2JDCA 4C9UA 3B7IA 1RTQA 1TIQA 1HEEA 1KEEB 1UFHA 2BSWA 2QYVA 2VZZA 4MY0A 4H89A 4AG9A 4A94A 1ZRSA 2AUMA 1XE4A 2XPPA 5JPHA 2C6GA 3FX6A 3HLPA 3SXNA 2EBJA 2JEWA 1ZLHA 2ZEFA 1Z4RA 3TC8A 4F6AA 1M6VB 3TLZA 2CF4A 5ISVA 3LACA 4EYSA 2PRQA 4UCNA 2J9AA 1VHOA 2FXFA 3PZJA 4WJBA 4X2TA 3FBUA 4KOUA 4U5YA 2FS5A 4NGQA 1S7LA 3R95A 2B4DA 3T9YA 2I00A 1Y9KA 3D3SA 1S5KA 2OH1A 4LX9A 4CDJA 3DGVA 4A39A 1CE8B 1Q2CA 1GHEA 4DNCA 4MFJA 1Z8WA 3BUWB 5JQ4A
chains in the Genus database with same CATH topology
2PJ2A 2PJ5A 5ELYA 5CBMA 1YMEA 2Q4ZA 3FJUA 4ONWA 2PJBA 1EE3P 3D68A 4BD9A 2BOAA 3NH8A 2ZEPA 1ARLA 4NGRA 3NFZA 3ISXA 1TF9A 5HVGA 2BCOA 4F9UA 4PXDA 4DJLA 4UIBA 2PIZA 1TKFA 4FBEA 3S9MA 2XEJA 3IWWA 3VH9A 2ZEHA 3FF3A 4F8ZA 4MMOA 3BI1A 3IEHA 4P4IA 3KR4A 1LCPA 3FH4A 3PRTA 4IK2A 4JYWA 3KHXA 4CDJA 5LYFA 4ZYQA 2PJAA 2C5QA 1F2OA 3EIFA 1CBXA 2IQ6A 3WT4A 3PB9X 4C85A 3KR5A 4MHZA 4UEEA 2NYQA 3DLJA 5D29A 4EMEA 5HVHA 1AYEA 3KHZA 1HDUA 4P6YA 3I6SA 3NA6A 4W9YA 4NGMA 4C8TA 3H8FA 1OBRA 1YW4A 4A38A 4P45A 4RUHA 2PJ4A 4FWUA 4C8CA 1JQGA 4ZI6A 3BXMA 2IMOA 1IY7A 2PCUA 1ELLP 4YWYA 1XMBA 2CIJA 2QVPA 4NGPA 2ZEEA 4F9VA 2CTCA 3IIBA 4NGNA 4K3NA 2V8VA 3GLJA 4NGSA 1VGYA 4P10A 5J1QA 3I74A 2OR4A 2AFWA 4CPAA 1ZG9A 4ZX9A 3D7FA 2ZENA 1YSJA 4PXBA 4MCQA 3KQXA 3SI2A 4UF4A 1TXRA 1ZG8A 5K8OA 1QMUA 2WYRA 4ZY2A 4OC5A 4OC2A 2PJ0A 3IFEA 3IJ3A 2ZEDA 4UIAA 5HXDA 2WZNA 2OOTA 4MCSA 4P44A 1BLLE 1GYTA 3B3VA 3D7DA 1Z8LA 3VTAA 1TKHA 4Z65A 4OMEA 7CPAA 4C8UA 3NH4A 5D8NA 2ZEMA 2PJ3A 3H8GA 3D67A 2IJZA 1BPMA 1LANA 3D7GA 4MHYA 2F7VA 4DUKA 1NSAA 5JM6A 5LYDA 4C8PA 4OKOA 3CPAA 3KL9A 4OIDA 3WABA 3TX8A 2V77A 1V6CA 3KQZA 3SJEA 1Y9ZA 1XRYA 1PYTB 4TJXA 4FUUA 4IAVA 3KASA 4AXVA 1Z5RA 1CPSA 2RFHA 4O23A 1PCAA 5JH9A 4R6TA 3H8EA 2I3CA 1LFWA 3PBBA 1R3NA 4OIWA 2Q51A 4X8IA 4NJRA 3NH5A 3FMCA 1CG2A 3SI1A 5JGFA 3K2KA 3T8WA 1CP7A 2G9DA 5I4MA 2C1CA 2PJ9A 4MXUA 1FNOA 3V38A 4C86A 3GB0A 2POKA 2ZOGA 5LRKA 4KNGE 1XBUA 4C84A 3N5FA 4TNUA 2XEFA 4EFDA 2HC9A 1CPXA 1HDQA 5LRGA 1R43A 3IC1A 1YW6A 2PJ8A 3JRUA 3I1UA 2CTBA 2AFXA 5CPAA 4OC4A 1Q7LA 3ICUA 5IR2A 3D4UA 2ZELA 5DS0A 3MRUA 3CT9A 3SJGA 1BAVA 3S9LA 2V8HA 2NSMA 3PEIA 8CPAA 3SJXA 4YU9A 4C9AA 2XEIA 3SJFA 1XFOA 1FT7A 4EWTA 3FEDA 2GLJA 2AFZA 4X3RA 4P4DA 4PXEA 1XJOA 1DTDA 3GUXA 1UWYA 1LAPA 5LYLA 5K8NA 2ZEOA 3L2NA 3D66A 2V8GA 1M4LA 3IO1A 1TF8A 2PJ1A 3SI0A 3S9NA 2JBKA 4NJQA 2GP4A 4P4JA 4MRIA 4MHNA 4MCRA 2ZOFA 4PXCA 4OC3A 5IB9A 2ABZA 1CP6A 3WC5A 1BPNA 4R8FA 3HUVA 1DE4C 2ANPA 3B3WA 3FVLA 1Y0RA 2GLFA 2VL1A 1VHEA 4MHPA 2GU2A 3CDXA 4P4EA 1Z2LA 4C9RA 4R7MA 3FECA 2PJ6A 4G1PA 3ISZA 4CDKA 5K8MA 1H8LA 4MCPA 2XEGA 4PPZA 4IHMA 2V8DA 1ZLIA 2AFOA 4NGTA 2FVGA 4KSIA 2C6PA 2O53A 4PQAA 2PIYA 3B3CA 4ZY0A 4NFRA 4UEZA 3KI9A 4B6ZA 5THWA 4YN3A 1LAMA 1VIXA 4OP4A 3RZAA 3VARA 2JBJA 4OC1A 3VATA 4C9VA 4H2KA 2HB6A 2Q43A 2RB7A 1YLOA 1Y7EA 3PB6X 2QJ8A 3KZWA 3BHXA 3B35A 1KWMA 2EWBA 3K9TA 3LMSA 4GM5A 3PBEA 3B3SA 4P4BA 4JZ0A 1AMPA 2EK8A 2GREA 2PVVA 3D7HA 1TKJA 5K8PA 1ARMA 4R76A 3BI0A 3LWUA 4P4FA 3FEEA 1F2PA 2PJCA 4ZY1A 3PFOA 5HVFA 4TJVA 4TWEA 5F09A 6CPAA 3PFEA 2O4HA 2C6CA 4C99A 1XF1A 1WVMA 4C8FA 3MN8A 2BO9A 2ZEGA 1F57A 4OC0A 3V7ZA 3WC6A 2F8HA 1LOKA 4Q7AA 4C9EA 4WWVA 3PB4X 3PB8X 3KGQA 1ELMP 3B3TA 5LRJA 2EK9A 3QNVA 2PVWA 1IGBA 4A37A 2DEAA 2PE3A 4FAIA 4DYOA 1QQ9A 2AFSA 2PJ7A 1Y0YA 1ZG7A 3PB7X 1CX8A 3RAMA 5LYIA 3CPXA 4ZX8A 3B2YA 3RBUA 2AFMA 2AFUA 3WC7A 4LQGA 4C8AA 4C9UA 3B7IA 1RTQA 1HEEA 2QYVA 4A94A 2C6GA 3FX6A 3HLPA 2JEWA 1ZLHA 2ZEFA 3TC8A 2CF4A 2PRQA 2J9AA 1VHOA 4WJBA 4X2TA 4NGQA 3DGVA 4A39A 4UEFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PJ2 A;  2PJ5 A;  5ELY A;  5CBM A;  1YME A;  2Q4Z A;  3FJU A;  4ONW A;  2PJB A;  1EE3 P;  3D68 A;  4BD9 A;  2BOA A;  3NH8 A;  2ZEP A;  1ARL A;  4NGR A;  3NFZ A;  3ISX A;  1TF9 A;  5HVG A;  2BCO A;  4F9U A;  4PXD A;  4DJL A;  4UIB A;  2PIZ A;  1TKF A;  4FBE A;  3S9M A;  2XEJ A;  3IWW A;  3VH9 A;  2ZEH A;  3FF3 A;  4F8Z A;  4MMO A;  3BI1 A;  3IEH A;  4P4I A;  3KR4 A;  1LCP A;  3FH4 A;  3PRT A;  4IK2 A;  4JYW A;  3KHX A;  4CDJ A;  5LYF A;  4ZYQ A;  2PJA A;  1F2O A;  3EIF A;  1CBX A;  2IQ6 A;  3WT4 A;  3PB9 X;  4C85 A;  3KR5 A;  4MHZ A;  4UEE A;  2NYQ A;  3DLJ A;  5D29 A;  4EME A;  5HVH A;  1AYE A;  3KHZ A;  1HDU A;  4P6Y A;  3I6S A;  3NA6 A;  4W9Y A;  4NGM A;  4C8T A;  3H8F A;  1OBR A;  1YW4 A;  4A38 A;  4P45 A;  4RUH A;  2PJ4 A;  4FWU A;  4C8C A;  1JQG A;  4ZI6 A;  3BXM A;  2IMO A;  1IY7 A;  2PCU A;  1ELL P;  4YWY A;  1XMB A;  2CIJ A;  2QVP A;  4NGP A;  2ZEE A;  4F9V A;  2CTC A;  3IIB A;  4NGN A;  4K3N A;  2V8V A;  3GLJ A;  4NGS A;  1VGY A;  4P10 A;  5J1Q A;  3I74 A;  2OR4 A;  2AFW A;  4CPA A;  1ZG9 A;  4ZX9 A;  3D7F A;  2ZEN A;  1YSJ A;  4PXB A;  4MCQ A;  3KQX A;  3SI2 A;  4UF4 A;  1TXR A;  1ZG8 A;  5K8O A;  1QMU A;  2WYR A;  4ZY2 A;  4OC5 A;  4OC2 A;  2PJ0 A;  3IFE A;  3IJ3 A;  2ZED A;  4UIA A;  5HXD A;  2WZN A;  2OOT A;  4MCS A;  4P44 A;  1BLL E;  1GYT A;  3B3V A;  3D7D A;  1Z8L A;  3VTA A;  1TKH A;  4Z65 A;  4OME A;  7CPA A;  4C8U A;  3NH4 A;  5D8N A;  2ZEM A;  2PJ3 A;  3H8G A;  3D67 A;  2IJZ A;  1BPM A;  1LAN A;  3D7G A;  4MHY A;  2F7V A;  4DUK A;  1NSA A;  5JM6 A;  5LYD A;  4C8P A;  4OKO A;  3CPA A;  3KL9 A;  4OID A;  3WAB A;  3TX8 A;  2V77 A;  1V6C A;  3KQZ A;  3SJE A;  1Y9Z A;  1XRY A;  1PYT B;  4TJX A;  4FUU A;  4IAV A;  3KAS A;  4AXV A;  1Z5R A;  1CPS A;  2RFH A;  4O23 A;  1PCA A;  5JH9 A;  4R6T A;  3H8E A;  2I3C A;  1LFW A;  3PBB A;  1R3N A;  4OIW A;  2Q51 A;  4X8I A;  4NJR A;  3NH5 A;  3FMC A;  1CG2 A;  3SI1 A;  5JGF A;  3K2K A;  3T8W A;  1CP7 A;  2G9D A;  5I4M A;  2C1C A;  2PJ9 A;  4MXU A;  1FNO A;  3V38 A;  4C86 A;  3GB0 A;  2POK A;  2ZOG A;  5LRK A;  4KNG E;  1XBU A;  4C84 A;  3N5F A;  4TNU A;  2XEF A;  4EFD A;  2HC9 A;  1CPX A;  1HDQ A;  5LRG A;  1R43 A;  3IC1 A;  1YW6 A;  2PJ8 A;  3JRU A;  3I1U A;  2CTB A;  2AFX A;  5CPA A;  4OC4 A;  1Q7L A;  3ICU A;  3D4U A;  2ZEL A;  5DS0 A;  3MRU A;  3CT9 A;  3SJG A;  1BAV A;  3S9L A;  2V8H A;  2NSM A;  3PEI A;  8CPA A;  3SJX A;  4YU9 A;  4C9A A;  2XEI A;  3SJF A;  1XFO A;  1FT7 A;  4EWT A;  3FED A;  2GLJ A;  2AFZ A;  4X3R A;  4P4D A;  4PXE A;  1XJO A;  1DTD A;  3GUX A;  1UWY A;  1LAP A;  5LYL A;  5K8N A;  2ZEO A;  3L2N A;  3D66 A;  2V8G A;  1M4L A;  3IO1 A;  1TF8 A;  2PJ1 A;  3SI0 A;  3S9N A;  2JBK A;  4NJQ A;  4P4J A;  4MRI A;  4MHN A;  4MCR A;  2ZOF A;  4PXC A;  4OC3 A;  5IB9 A;  2ABZ A;  1CP6 A;  3WC5 A;  1BPN A;  4R8F A;  3HUV A;  1DE4 C;  2ANP A;  3B3W A;  3FVL A;  1Y0R A;  2GLF A;  2VL1 A;  1VHE A;  4MHP A;  2GU2 A;  3CDX A;  4P4E A;  1Z2L A;  4C9R A;  4R7M A;  3FEC A;  2PJ6 A;  4G1P A;  3ISZ A;  4CDK A;  5K8M A;  1H8L A;  4MCP A;  2XEG A;  4PPZ A;  4IHM A;  2V8D A;  1ZLI A;  2AFO A;  4NGT A;  2FVG A;  4KSI A;  2C6P A;  2O53 A;  4PQA A;  2PIY A;  3B3C A;  4ZY0 A;  4NFR A;  4UEZ A;  3KI9 A;  4B6Z A;  5THW A;  4YN3 A;  1LAM A;  1VIX A;  4OP4 A;  3RZA A;  3VAR A;  2JBJ A;  4OC1 A;  3VAT A;  4C9V A;  4H2K A;  2HB6 A;  2Q43 A;  2RB7 A;  1YLO A;  1Y7E A;  3PB6 X;  2QJ8 A;  3KZW A;  3BHX A;  3B35 A;  1KWM A;  2EWB A;  3K9T A;  3LMS A;  4GM5 A;  3PBE A;  3B3S A;  4P4B A;  4JZ0 A;  1AMP A;  2EK8 A;  2GRE A;  2PVV A;  3D7H A;  1TKJ A;  5K8P A;  1ARM A;  4R76 A;  3BI0 A;  3LWU A;  4P4F A;  3FEE A;  1F2P A;  2PJC A;  4ZY1 A;  3PFO A;  5HVF A;  4TJV A;  4TWE A;  5F09 A;  6CPA A;  3PFE A;  2O4H A;  2C6C A;  4C99 A;  1XF1 A;  1WVM A;  4C8F A;  3MN8 A;  2BO9 A;  2ZEG A;  1F57 A;  4OC0 A;  3V7Z A;  3WC6 A;  2F8H A;  1LOK A;  4Q7A A;  4C9E A;  4WWV A;  3PB4 X;  3PB8 X;  3KGQ A;  1ELM P;  3B3T A;  5LRJ A;  2EK9 A;  3QNV A;  2PVW A;  1IGB A;  4A37 A;  2DEA A;  2PE3 A;  4FAI A;  4DYO A;  1QQ9 A;  2AFS A;  2PJ7 A;  1Y0Y A;  1ZG7 A;  3PB7 X;  1CX8 A;  3RAM A;  5LYI A;  3CPX A;  4ZX8 A;  3B2Y A;  3RBU A;  2AFM A;  2AFU A;  3WC7 A;  4LQG A;  4C8A A;  4C9U A;  3B7I A;  1RTQ A;  1HEE A;  2QYV A;  4A94 A;  2C6G A;  3FX6 A;  3HLP A;  2JEW A;  1ZLH A;  2ZEF A;  3TC8 A;  2CF4 A;  2PRQ A;  2J9A A;  1VHO A;  4WJB A;  4X2T A;  4NGQ A;  3DGV A;  4A39 A;  4UEF A; 
#chains in the Genus database with same CATH topology
 2PJ2 A;  5A27 A;  1VI4 A;  2PJ5 A;  1BXR B;  3DDD A;  4C2X A;  5F46 A;  3OB1 B;  5ELY A;  5EMI A;  3IU2 A;  4CGO A;  5CBM A;  3PLF B;  2ZPA A;  3JTK A;  4MY3 A;  5BWA B;  4IIY A;  3TO7 A;  3VRO A;  2ZW6 A;  1YME A;  3KKW A;  1YVO A;  2Q4Z A;  3FJU A;  4YFJ A;  1I12 A;  2REE A;  4JJX A;  1JDE A;  1YQE A;  4ONW A;  3R9E A;  5IX3 A;  4AG7 A;  2PJB A;  5CNP A;  4R57 A;  1EE3 P;  3D68 A;  2R98 A;  4BD9 A;  4A31 A;  2EUI A;  4J0N A;  2BOA A;  3NH8 A;  2ZEP A;  1ARL A;  5G22 A;  4CAE A;  4NGR A;  3NFZ A;  5AXI A;  3ISX A;  1TF9 A;  5HVG A;  4MFK A;  2BCO A;  1FBV A;  4F9U A;  1KUX A;  4PXD A;  3ZJ0 A;  4BMH A;  4M6H A;  4DJL A;  3F9K C;  4UIB A;  2PIZ A;  3OB2 B;  3EXN A;  4QUS A;  1TKF A;  4FBE A;  4NEX A;  4CS0 B;  5HKY A;  3S9M A;  2XEJ A;  3IWW A;  3VH9 A;  2JEV A;  2ZEH A;  3BJ8 A;  3FF3 A;  4F8Z A;  2CNT A;  4MMO A;  3D2P A;  4JD6 A;  3BI1 A;  3IEH A;  4P4I A;  3R96 A;  1M1D A;  4X5K A;  3KR4 A;  3F0A A;  3F8K A;  2DLA A;  4RS2 A;  5AG5 A;  2Q7B A;  1LCP A;  3FH4 A;  3PRT A;  3TE4 A;  4IK2 A;  5HKW A;  2C27 A;  4UFV A;  2HRO A;  4JYW A;  1YVH A;  3EZA A;  3KHX A;  2P0W A;  1M4G A;  3QAH A;  4EVY A;  2GFQ A;  2PJA A;  4ZYQ A;  1U6M A;  4BBH A;  5LYF A;  2C5Q A;  3TLC A;  4BTF A;  2OLS A;  1F2O A;  3FIX A;  3EIF A;  1WWZ A;  4MFL A;  3V8I A;  5C88 A;  3RYO A;  1CBX A;  2IQ6 A;  3WT4 A;  2B58 A;  1S7K A;  3PB9 X;  4C85 A;  2JLM A;  3I9S A;  3R9G A;  3KR5 A;  2YJT A;  2OU2 A;  4MHZ A;  4UEE A;  2DIK A;  4A95 A;  2NYQ A;  3DLJ A;  5D29 A;  4EME A;  5HVH A;  1Z9U A;  1AYE A;  1IB1 E;  3KHZ A;  5G21 A;  1HDU A;  4P6Y A;  3I6S A;  4CO9 A;  3NA6 A;  4W9Y A;  4NGM A;  4C8T A;  3H8F A;  1OBR A;  1YW4 A;  4NXY A;  4QB9 A;  4A38 A;  4P45 A;  2ZW4 A;  3CXS A;  3FYN A;  4NCZ A;  3LD2 A;  2EO8 A;  2PJ4 A;  1PUA A;  2Q4V A;  4FWU A;  4E8O A;  4RUH A;  4IIX A;  4C8C A;  4E5S A;  3TO6 A;  1JQG A;  2G3T A;  4ZI6 A;  3PFV A;  4FD5 A;  3BXM A;  4C7H A;  2IMO A;  1IY7 A;  5F48 A;  2PCU A;  3P2H A;  2H5M A;  1ELL P;  4PV6 A;  4YWY A;  3S6G A;  2AUN A;  4GPL B;  1XMB A;  4K30 A;  2CIJ A;  3E0K A;  4NF1 A;  5G20 A;  2QVP A;  5C82 A;  3TLG B;  3S6H A;  4PSW A;  3GIU A;  3D2M A;  4NGP A;  2ZEE A;  3VRR A;  1Z4E A;  4F9V A;  4B12 A;  4XPD C;  4II9 A;  3EZB A;  2CTC A;  3MGD A;  2ZW7 A;  4NGN A;  3IIB A;  1Z8X A;  2OZU A;  4K3N A;  3EO4 A;  1S60 A;  1S3Z A;  2V8V A;  3GLJ A;  4NGS A;  1EZB A;  4KVX A;  2Z3L A;  3P2F A;  4I49 A;  3DNS A;  1IU8 A;  1VGY A;  4P10 A;  5J1Q A;  4JXQ A;  3I74 A;  2VZY A;  2HV2 A;  5F47 A;  2OR4 A;  4MFQ A;  4CAX A;  3H4Q A;  2AFW A;  4CPA A;  4AVA A;  1ZG9 A;  4UBR A;  2B3U A;  4M3S A;  4ZX9 A;  3D7F A;  2ZEN A;  1QSO A;  1YSJ A;  4PXB A;  3DR6 A;  4HNY B;  2CNS A;  2XPL A;  4MCQ A;  3VRP A;  2BEI A;  3KQX A;  2HWG A;  3GKR A;  5F1Y A;  3SI2 A;  4LQ6 A;  1TXR A;  4UF4 A;  2UV8 G;  1ZG8 A;  2I79 A;  4CRY B;  1SQH A;  2CXA A;  2YNC A;  2WPW A;  5K8O A;  1C3O B;  4CGL A;  3FB3 A;  1QMU A;  2WYR A;  3EC4 A;  4ZY2 A;  4OC5 A;  4Y49 B;  4OC2 A;  2PJ0 A;  3IFE A;  3IJ3 A;  2ZED A;  3GY9 A;  4UIA A;  1C30 B;  3TLY A;  4M6I A;  4ZGY B;  3IU1 A;  2Q0Y A;  3JVN A;  5HXD A;  2WZN A;  2OOT A;  4MCS A;  4P44 A;  4HNW B;  2Q44 A;  4C68 A;  3I3G A;  1KUY A;  3TOA A;  1BLL E;  5BY0 A;  1GYT A;  3B3V A;  4E0A A;  3D7D A;  2GAN A;  5HMN A;  1Z8L A;  4B13 A;  1DIK A;  3VTA A;  4CYN A;  2FE7 A;  3T0T A;  1TKH A;  1QSR A;  1K4J A;  3RNZ A;  4Z65 A;  2MP0 A;  3T07 A;  4OME A;  2WSA A;  3W6X A;  4U9Z A;  7CPA A;  3GJZ A;  4C8U A;  1QSM A;  3NH4 A;  2O28 A;  2ZEM A;  5D8N A;  4B5P A;  2PJ3 A;  3H8G A;  4PK2 A;  3D67 A;  2IJZ A;  3NOJ A;  5EBV A;  4COG A;  2R8V A;  3U88 C;  4PK3 A;  1ZL0 A;  1BPM A;  4KUA A;  3TLB A;  2FIW A;  1LAN A;  3D7G A;  1KZF A;  4QC6 A;  4L89 A;  1YGH A;  4MHY A;  2F7V A;  2JDD A;  1NSA A;  3A9L A;  4DUK A;  5JM6 A;  2B4B A;  1EZA A;  1IID A;  4BPU B;  5LYD A;  4C8P A;  4OKO A;  3CPA A;  1YRE A;  3KL9 A;  2PDO A;  4OID A;  4B11 A;  4KOS A;  3WAB A;  3TX8 A;  4ORF A;  2V77 A;  1VHS A;  3T90 A;  2N3A B;  1M4D A;  3KQZ A;  1V6C A;  3SJE A;  4OAE A;  2VBQ A;  1Y9Z A;  1XRY A;  5EC4 A;  4R3L A;  3HPH E;  2X7B A;  1S7N A;  2X0S A;  1PYT B;  4TJX A;  2YNC C;  2VQY A;  4FUU A;  4IAV A;  3KAS A;  3EY5 A;  4AXV A;  3JUW A;  2Z3O A;  1Z5R A;  1CPS A;  2RFH A;  3R9F A;  4LUA A;  1WJT A;  4O23 A;  1PCA A;  2FIA A;  4KLV A;  5JH9 A;  3BUM B;  4AVB A;  4M8D A;  4R6T A;  4NSQ A;  3NFQ A;  3H8E A;  2EVN A;  2I3C A;  2J8M A;  1LFW A;  4B5P B;  1R57 A;  4YRH A;  5J8C A;  3VRQ A;  5KTC A;  1IOI A;  3PBB A;  1R3N A;  4OIW A;  2Q51 A;  3TFY A;  4X8I A;  5FVJ A;  3PP9 A;  3ZNI A;  4NJR A;  4M6G A;  3DR8 A;  3NH5 A;  2HI6 A;  3FMC A;  1B87 A;  1CG2 A;  3FXT A;  4UFX A;  2PSW A;  3BUX B;  3SI1 A;  5JGF A;  3K2K A;  4B14 A;  3N7Z A;  2HQY A;  1KC7 A;  1VKC A;  3T8W A;  4BIN A;  1PU9 A;  1XF8 A;  3G3S A;  1Q5X A;  1CP7 A;  2D4O A;  4KS9 A;  1B6B A;  1KBL A;  2G9D A;  4YGO A;  2C1C A;  4ZBG A;  5I4M A;  1JDB C;  3TTH A;  3SR3 A;  2PJ9 A;  2Q7S A;  4MXU A;  1FNO A;  3V38 A;  4JVO A;  4C86 A;  3GB0 A;  1VBG A;  2POK A;  1YLE A;  2ZOG A;  5LRK A;  4KNG E;  1XBU A;  2B3V A;  4GXH A;  4C84 A;  2BUE A;  4R3K A;  1ON0 A;  1EO0 A;  3EFA A;  2B0A A;  3N5F A;  3QAY A;  4TNU A;  2XEF A;  3BUO B;  3TO9 A;  3T05 A;  1S7F A;  3CXP A;  1MJA A;  4KOX A;  2XPN A;  3PT1 A;  4U9Y A;  4EFD A;  4MFP A;  2HC9 A;  1CPX A;  1HDQ A;  1QST A;  2FT0 A;  5LRG A;  4CAV A;  4E2A A;  1R43 A;  5IV0 A;  1BOB A;  2P6E A;  3IC1 A;  4A4B A;  2PCN A;  4HKF A;  1YW6 A;  2PJ8 A;  2PR1 A;  4CYQ A;  1NXJ A;  3JRU A;  1X10 A;  4UEF A;  4UCP A;  3I1U A;  5HKZ A;  2CTB A;  4Q38 A;  1P4N A;  2AFX A;  5KTA A;  3UY5 A;  2NMT A;  5CPA A;  4OC4 A;  4KVM E;  1YX0 A;  1Q7L A;  5K99 A;  3ICU A;  1N71 A;  4R87 A;  4AB7 A;  4MHD A;  2R7H A;  4XPL A;  3D4U A;  3VWE A;  5IR2 A;  2PR8 A;  2DF5 A;  2K5T A;  2ZEL A;  4FD7 A;  5DS0 A;  3IWE A;  3MRU A;  2R82 A;  3CT9 A;  3SJG A;  1BAV A;  4H1H A;  3S9L A;  2V8H A;  2NSM A;  3C26 A;  4OLL A;  4CGN A;  3PEI A;  8CPA A;  3SJX A;  1LRZ A;  4YU9 A;  4C9A A;  2XEI A;  5JVL A;  4CAW A;  4CYP A;  3SJF A;  1XFO A;  4JLY A;  3T5M A;  1FT7 A;  4EWT A;  3SHP A;  1Y9W A;  3FED A;  2GLJ A;  5F9M A;  4KZT A;  2AFZ A;  4KOW A;  2HUZ A;  2Z3N A;  3LOD A;  4IUS A;  4F0X A;  2WUU A;  4C7I A;  4X3R A;  4P4D A;  2REF A;  4PXE A;  1XJO A;  1YR0 A;  5F13 A;  3R1K A;  1AUG A;  1DTD A;  2OB0 A;  2B5G B;  3GUX A;  1UWY A;  1LAP A;  2FCK A;  5LYL A;  4B5O A;  5K8N A;  1XMT A;  2ZEO A;  3L2N A;  4A32 A;  4XPK A;  1XEB A;  3D66 A;  2V8G A;  4UWI A;  1M4L A;  3IO1 A;  1TF8 A;  1X12 A;  5JYB A;  2PJ1 A;  3SI0 A;  3S9N A;  1J3L A;  4A2Z A;  4UWJ A;  2FM4 A;  2JBK A;  4RR2 B;  4NJQ A;  2J8R A;  2QIR A;  3HMJ G;  1I1D A;  1KUV A;  4H6U A;  4CGM A;  4P4J A;  2PC1 A;  2GP4 A;  3VGO A;  4MRI A;  5IB0 A;  1L0C A;  2CY2 A;  4MHN A;  3FNC A;  3RO0 A;  2D0P A;  4MCR A;  2ZOF A;  4PXC A;  4C2Y A;  4OC3 A;  2CNM A;  2QML A;  5IB9 A;  1YK3 A;  4ONU A;  3W6S A;  3TCV A;  2ABZ A;  2P6G A;  2D0O A;  1CP6 A;  2RC4 A;  1BPN A;  4JXR A;  4R8F A;  3WC5 A;  3HUV A;  5J3X A;  1DE4 C;  2KCW A;  2ANP A;  3B3W A;  3FVL A;  4H6Z A;  2CBL A;  4A4C A;  1Y0R A;  4OAD A;  2GLF A;  5AG4 A;  2VL1 A;  1WK4 A;  5H86 A;  2DXQ A;  1VHE A;  1MK4 A;  4MHP A;  3TLE A;  2GU2 A;  2B4J C;  2B5G A;  1CM0 A;  1Q2Y A;  3CDX A;  4P4E A;  1Z2L A;  4JWP A;  5F49 A;  4R7M A;  4C9R A;  2D4P A;  2Z3K A;  3FEC A;  2ZW5 A;  3B8G A;  1NBW A;  2B4D B;  2PJ6 A;  4G1P A;  3ISZ A;  4CDK A;  1IOF A;  2ODF A;  5K8M A;  1Y7R A;  1H8L A;  1ZO0 A;  3TOB A;  3ZZI A;  2OZH A;  4INJ A;  2OZG A;  2F5I A;  3F5B A;  4MCP A;  2FSR A;  1IYK A;  2XEG A;  4L8A A;  4PPZ A;  4IHM A;  3FRM A;  2AE6 A;  4M85 A;  3QB8 A;  2V8D A;  2FL4 A;  1ZLI A;  2AFO A;  2IL4 A;  4KOY A;  4A30 A;  4NGT A;  2FVG A;  4KSI A;  2Q4Y A;  4MBU A;  4MI4 A;  4CYO A;  1GGO A;  4B10 A;  1T36 B;  5A28 A;  3U1B A;  4F0Y A;  2C6P A;  2ZXV A;  2Z0Z A;  2Y1M A;  2O53 A;  4MJ8 A;  4PQA A;  1V0C A;  4RN7 A;  2PIY A;  3HPG G;  3B3C A;  5KTD A;  2VEZ A;  4Y49 C;  4NFR A;  4ZY0 A;  2R1I A;  2A4N A;  4UEZ A;  3KI9 A;  1XOV A;  3S6K A;  4AVC A;  4B6Z A;  4KLW A;  3SXO A;  2G3A A;  2Z3M A;  1FY7 A;  3BJ7 A;  5THW A;  4XNH B;  4YN3 A;  4UFW A;  1LAM A;  2Y0M A;  4PSX A;  1M4I A;  1XIX A;  3BUN B;  1VIX A;  4OP4 A;  3RZA A;  3VAR A;  2JBJ A;  2PQ8 A;  4GS4 A;  5HH1 A;  4OC1 A;  2EZC A;  3IWG A;  4MI1 A;  2VKZ G;  3VAT A;  2EZA A;  2ATR A;  1QSN A;  2Z11 A;  1A2Z A;  4FD6 A;  2GE3 A;  4XPD B;  4HPS A;  4A33 A;  2Z10 A;  3OAK A;  4H2K A;  2Y1N A;  4KOT A;  5GCN A;  4QBJ A;  4C9V A;  2HB6 A;  3IGR A;  4CZ1 A;  2Q43 A;  2RB7 A;  4KOR A;  1YLO A;  1Y7E A;  2QJ8 A;  3KZW A;  2VXK A;  2QEC A;  3PB6 X;  3BHX A;  2G0B A;  3B35 A;  3PGP A;  2YND A;  3BLN A;  3TT2 A;  3K4I A;  1Z8T A;  4IF5 A;  1KWM A;  3H5Z A;  4J3G A;  2EWB A;  3K9T A;  1MJB A;  3LMS A;  5J8F A;  4BPW B;  1MJ9 A;  3PBE A;  4GM5 A;  4KUB A;  2ARH A;  3B3S A;  1NSL A;  3W91 A;  2YJV A;  4P4B A;  1OZP A;  4JZ0 A;  1AMP A;  1I21 A;  2EK8 A;  2GRE A;  2PVV A;  3D7H A;  3NE8 A;  3DSB A;  3WR7 A;  1TKJ A;  3S6F A;  5K8P A;  1YVK A;  1Q2D A;  1ARM A;  3VRN A;  3G8W A;  3BI0 A;  4R76 A;  1R61 A;  3KRV A;  3LWU A;  3EZE A;  4P4F A;  3FEE A;  1F2P A;  2PJC A;  4ZY1 A;  4CAF A;  3PFO A;  4MFZ A;  5DWN A;  3OWC A;  3CXQ A;  5HVF A;  2DPS A;  4TJV A;  4TWE A;  5F09 A;  6CPA A;  3TYX A;  3PFE A;  2WPX A;  2O4H A;  4C2Z A;  4BPX B;  2C6C A;  2AJ6 A;  1IYL A;  2GIV A;  2J8N A;  4FD4 A;  3NE7 A;  4QVT A;  4CGP A;  1XF1 A;  4C99 A;  1WVM A;  4C8F A;  1BO4 A;  2PRB A;  3MN8 A;  1A9X B;  1RXT A;  2YNE A;  2YGW A;  4COB A;  1NE9 A;  2BO9 A;  4MJX A;  2ZEG A;  5I0C A;  1IIC A;  1F57 A;  4UCM A;  4OC0 A;  2VI7 A;  4RI1 A;  2F8H A;  5AG6 A;  3V7Z A;  3WC6 A;  5F5X A;  1RO5 A;  1LOK A;  4Q7A A;  2DPT A;  4HNX B;  1J4J A;  2EZB A;  4WWV A;  4C9E A;  3O8Z A;  3PB4 X;  3PB8 X;  2E28 A;  3G23 A;  3KGQ A;  1Z9E A;  1ELM P;  3B3T A;  3OP0 A;  3CZX A;  5LRJ A;  3VWD A;  2EK9 A;  4Q36 A;  5FD8 A;  3TLA A;  3QNV A;  2PVW A;  5H84 A;  3K9U A;  3TLG A;  1IGB A;  4A37 A;  2DEA A;  2PE3 A;  4FAI A;  4E94 A;  4XNH C;  1CJW A;  1P0H A;  4DYO A;  1VBH A;  4KOV A;  1QQ9 A;  1B47 A;  2AFS A;  1M44 A;  2Z3P A;  2PJ7 A;  4KVO E;  4CRZ B;  1Y0Y A;  5E96 A;  4KSF A;  5G1Z A;  4R9M A;  2XPO A;  1ZG7 A;  1NMT A;  1CX8 A;  3PB7 X;  5DWM A;  5LYI A;  2P6F A;  3RAM A;  3CPX A;  4ZX8 A;  3B2Y A;  3RBU A;  2AFM A;  2BL1 A;  2AFU A;  5AGE A;  3D8P A;  3WC7 A;  4LQG A;  1CS0 B;  1JWQ A;  2Q04 A;  4UA3 A;  3C8O A;  1ZYM A;  4C8A A;  4KSA A;  3GYA A;  5AG7 A;  2JDC A;  4C9U A;  3B7I A;  1RTQ A;  1TIQ A;  1HEE A;  1KEE B;  1UFH A;  2BSW A;  2QYV A;  2VZZ A;  4MY0 A;  4H89 A;  4AG9 A;  4A94 A;  1ZRS A;  2AUM A;  1XE4 A;  2XPP A;  5JPH A;  2C6G A;  3FX6 A;  3HLP A;  3SXN A;  2EBJ A;  2JEW A;  1ZLH A;  2ZEF A;  1Z4R A;  3TC8 A;  4F6A A;  1M6V B;  3TLZ A;  2CF4 A;  5ISV A;  3LAC A;  4EYS A;  2PRQ A;  4UCN A;  2J9A A;  1VHO A;  2FXF A;  3PZJ A;  4WJB A;  4X2T A;  3FBU A;  4KOU A;  4U5Y A;  2FS5 A;  4NGQ A;  1S7L A;  3R95 A;  2B4D A;  3T9Y A;  2I00 A;  1Y9K A;  3D3S A;  1S5K A;  2OH1 A;  4LX9 A;  4CDJ A;  3DGV A;  4A39 A;  1CE8 B;  1Q2C A;  1GHE A;  4DNC A;  4MFJ A;  1Z8W A;  3BUW B;  5JQ4 A; 
#chains in the Genus database with same CATH homology
 2PJ2 A;  2PJ5 A;  5ELY A;  5CBM A;  1YME A;  2Q4Z A;  3FJU A;  4ONW A;  2PJB A;  1EE3 P;  3D68 A;  4BD9 A;  2BOA A;  3NH8 A;  2ZEP A;  1ARL A;  4NGR A;  3NFZ A;  3ISX A;  1TF9 A;  5HVG A;  2BCO A;  4F9U A;  4PXD A;  4DJL A;  4UIB A;  2PIZ A;  1TKF A;  4FBE A;  3S9M A;  2XEJ A;  3IWW A;  3VH9 A;  2ZEH A;  3FF3 A;  4F8Z A;  4MMO A;  3BI1 A;  3IEH A;  4P4I A;  3KR4 A;  1LCP A;  3FH4 A;  3PRT A;  4IK2 A;  4JYW A;  3KHX A;  4CDJ A;  5LYF A;  4ZYQ A;  2PJA A;  2C5Q A;  1F2O A;  3EIF A;  1CBX A;  2IQ6 A;  3WT4 A;  3PB9 X;  4C85 A;  3KR5 A;  4MHZ A;  4UEE A;  2NYQ A;  3DLJ A;  5D29 A;  4EME A;  5HVH A;  1AYE A;  3KHZ A;  1HDU A;  4P6Y A;  3I6S A;  3NA6 A;  4W9Y A;  4NGM A;  4C8T A;  3H8F A;  1OBR A;  1YW4 A;  4A38 A;  4P45 A;  4RUH A;  2PJ4 A;  4FWU A;  4C8C A;  1JQG A;  4ZI6 A;  3BXM A;  2IMO A;  1IY7 A;  2PCU A;  1ELL P;  4YWY A;  1XMB A;  2CIJ A;  2QVP A;  4NGP A;  2ZEE A;  4F9V A;  2CTC A;  3IIB A;  4NGN A;  4K3N A;  2V8V A;  3GLJ A;  4NGS A;  1VGY A;  4P10 A;  5J1Q A;  3I74 A;  2OR4 A;  2AFW A;  4CPA A;  1ZG9 A;  4ZX9 A;  3D7F A;  2ZEN A;  1YSJ A;  4PXB A;  4MCQ A;  3KQX A;  3SI2 A;  4UF4 A;  1TXR A;  1ZG8 A;  5K8O A;  1QMU A;  2WYR A;  4ZY2 A;  4OC5 A;  4OC2 A;  2PJ0 A;  3IFE A;  3IJ3 A;  2ZED A;  4UIA A;  5HXD A;  2WZN A;  2OOT A;  4MCS A;  4P44 A;  1BLL E;  1GYT A;  3B3V A;  3D7D A;  1Z8L A;  3VTA A;  1TKH A;  4Z65 A;  4OME A;  7CPA A;  4C8U A;  3NH4 A;  5D8N A;  2ZEM A;  2PJ3 A;  3H8G A;  3D67 A;  2IJZ A;  1BPM A;  1LAN A;  3D7G A;  4MHY A;  2F7V A;  4DUK A;  1NSA A;  5JM6 A;  5LYD A;  4C8P A;  4OKO A;  3CPA A;  3KL9 A;  4OID A;  3WAB A;  3TX8 A;  2V77 A;  1V6C A;  3KQZ A;  3SJE A;  1Y9Z A;  1XRY A;  1PYT B;  4TJX A;  4FUU A;  4IAV A;  3KAS A;  4AXV A;  1Z5R A;  1CPS A;  2RFH A;  4O23 A;  1PCA A;  5JH9 A;  4R6T A;  3H8E A;  2I3C A;  1LFW A;  3PBB A;  1R3N A;  4OIW A;  2Q51 A;  4X8I A;  4NJR A;  3NH5 A;  3FMC A;  1CG2 A;  3SI1 A;  5JGF A;  3K2K A;  3T8W A;  1CP7 A;  2G9D A;  5I4M A;  2C1C A;  2PJ9 A;  4MXU A;  1FNO A;  3V38 A;  4C86 A;  3GB0 A;  2POK A;  2ZOG A;  5LRK A;  4KNG E;  1XBU A;  4C84 A;  3N5F A;  4TNU A;  2XEF A;  4EFD A;  2HC9 A;  1CPX A;  1HDQ A;  5LRG A;  1R43 A;  3IC1 A;  1YW6 A;  2PJ8 A;  3JRU A;  3I1U A;  2CTB A;  2AFX A;  5CPA A;  4OC4 A;  1Q7L A;  3ICU A;  5IR2 A;  3D4U A;  2ZEL A;  5DS0 A;  3MRU A;  3CT9 A;  3SJG A;  1BAV A;  3S9L A;  2V8H A;  2NSM A;  3PEI A;  8CPA A;  3SJX A;  4YU9 A;  4C9A A;  2XEI A;  3SJF A;  1XFO A;  1FT7 A;  4EWT A;  3FED A;  2GLJ A;  2AFZ A;  4X3R A;  4P4D A;  4PXE A;  1XJO A;  1DTD A;  3GUX A;  1UWY A;  1LAP A;  5LYL A;  5K8N A;  2ZEO A;  3L2N A;  3D66 A;  2V8G A;  1M4L A;  3IO1 A;  1TF8 A;  2PJ1 A;  3SI0 A;  3S9N A;  2JBK A;  4NJQ A;  2GP4 A;  4P4J A;  4MRI A;  4MHN A;  4MCR A;  2ZOF A;  4PXC A;  4OC3 A;  5IB9 A;  2ABZ A;  1CP6 A;  3WC5 A;  1BPN A;  4R8F A;  3HUV A;  1DE4 C;  2ANP A;  3B3W A;  3FVL A;  1Y0R A;  2GLF A;  2VL1 A;  1VHE A;  4MHP A;  2GU2 A;  3CDX A;  4P4E A;  1Z2L A;  4C9R A;  4R7M A;  3FEC A;  2PJ6 A;  4G1P A;  3ISZ A;  4CDK A;  5K8M A;  1H8L A;  4MCP A;  2XEG A;  4PPZ A;  4IHM A;  2V8D A;  1ZLI A;  2AFO A;  4NGT A;  2FVG A;  4KSI A;  2C6P A;  2O53 A;  4PQA A;  2PIY A;  3B3C A;  4ZY0 A;  4NFR A;  4UEZ A;  3KI9 A;  4B6Z A;  5THW A;  4YN3 A;  1LAM A;  1VIX A;  4OP4 A;  3RZA A;  3VAR A;  2JBJ A;  4OC1 A;  3VAT A;  4C9V A;  4H2K A;  2HB6 A;  2Q43 A;  2RB7 A;  1YLO A;  1Y7E A;  3PB6 X;  2QJ8 A;  3KZW A;  3BHX A;  3B35 A;  1KWM A;  2EWB A;  3K9T A;  3LMS A;  4GM5 A;  3PBE A;  3B3S A;  4P4B A;  4JZ0 A;  1AMP A;  2EK8 A;  2GRE A;  2PVV A;  3D7H A;  1TKJ A;  5K8P A;  1ARM A;  4R76 A;  3BI0 A;  3LWU A;  4P4F A;  3FEE A;  1F2P A;  2PJC A;  4ZY1 A;  3PFO A;  5HVF A;  4TJV A;  4TWE A;  5F09 A;  6CPA A;  3PFE A;  2O4H A;  2C6C A;  4C99 A;  1XF1 A;  1WVM A;  4C8F A;  3MN8 A;  2BO9 A;  2ZEG A;  1F57 A;  4OC0 A;  3V7Z A;  3WC6 A;  2F8H A;  1LOK A;  4Q7A A;  4C9E A;  4WWV A;  3PB4 X;  3PB8 X;  3KGQ A;  1ELM P;  3B3T A;  5LRJ A;  2EK9 A;  3QNV A;  2PVW A;  1IGB A;  4A37 A;  2DEA A;  2PE3 A;  4FAI A;  4DYO A;  1QQ9 A;  2AFS A;  2PJ7 A;  1Y0Y A;  1ZG7 A;  3PB7 X;  1CX8 A;  3RAM A;  5LYI A;  3CPX A;  4ZX8 A;  3B2Y A;  3RBU A;  2AFM A;  2AFU A;  3WC7 A;  4LQG A;  4C8A A;  4C9U A;  3B7I A;  1RTQ A;  1HEE A;  2QYV A;  4A94 A;  2C6G A;  3FX6 A;  3HLP A;  2JEW A;  1ZLH A;  2ZEF A;  3TC8 A;  2CF4 A;  2PRQ A;  2J9A A;  1VHO A;  4WJB A;  4X2T A;  4NGQ A;  3DGV A;  4A39 A;  4UEF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...