4NGQA

Crystal structure of glutamate carboxypeptidase ii in a complex with urea-based inhibitor
Total Genus 257
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
257
sequence length
696
structure length
694
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Rational design of urea-based glutamate carboxypeptidase II (GCPII) inhibitors as versatile tools for specific drug targeting and delivery
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 257
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4ngqA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4ngqA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4ngqA02
3D67A 4P4FA 4MHYA 3PB9X 2EK8A 2PIYA 2ZEMA 3IEHA 3B3CA 2GLJA 3L2NA 1AYEA 1AMPA 3IWWA 4G1PA 2CF4A 5IB9A 3D4UA 1VIXA 3SJXA 5CBMA 2OR4A 4F9VA 4AXVA 2PRQA 4ZI6A 1YLOA 4IHMA 4MCSA 5LYIA 1LFWA 4OMEA 1PCAA 8CPAA 2PJAA 4C9AA 3KQZA 2IQ6A 4MMOA 3TX8A 3B2YA 4RUHA 3PBEA 2AFZA 5LRGA 1Y0RA 2ZELA 4CDKA 3LMSA 4C9EA 1M4LA 2RFHA 4PPZA 4A94A 3GUXA 4A38A 2O53A 1R3NA 1R43A 4C99A 3MN8A 4C8PA 1FT7A 4DYOA 1LAPA 2CTCA 2V8VA 4P45A 2Q51A 1BPMA 1XBUA 2CTBA 1XFOA 1H8LA 1VGYA 3N5FA 3IO1A 5JGFA 1QQ9A 3H8FA 4NGMA 3B35A 2GU2A 4UIBA 1ZG7A 2AFWA 4MHZA 2PIZA 4EFDA 4C8CA 4FWUA 1Z5RA 4NGTA 3H8GA 2XEGA 4ZY0A 3KGQA 1Q7LA 3FEDA 3DGVA 4P44A 2PJ0A 4NJRA 3SI0A 2RB7A 5LYDA 4LQGA 2ZENA 2EWBA 4OC1A 1XF1A 5LYLA 4P4EA 4R7MA 1YSJA 2PJCA 3KASA 3FF3A 4OC3A 3VTAA 5JH9A 2V8GA 3PB8X 2PJBA 1BPNA 3S9MA 3B7IA 3TC8A 2VL1A 1VHOA 2I3CA 3DLJA 4R76A 3D7DA 2AFOA 1YW6A 3WC6A 3ICUA 4JZ0A 1HEEA 1RTQA 4F8ZA 5J1QA 4MXUA 2AFSA 2BO9A 2PJ7A 4X3RA 3FH4A 3SJEA 2PVVA 3S9LA 4ZYQA 3FEEA 4P10A 3T8WA 2PE3A 4ZY2A 1BLLE 5I4MA 4TNUA 2ZEPA 4NGQA 4UEZA 1PYTB 2XEFA 1XJOA 1ARLA 3PRTA 2XEIA 3ISZA 3PEIA 5JM6A 1LAMA 1WVMA 4F9UA 4C8FA 4B6ZA 4P4DA 2GREA 1F2PA 3NA6A 4FBEA 3KI9A 3KHXA 3SI2A 1GYTA 3PFEA 4C8TA 3D68A 1CX8A 1DTDA 7CPAA 5K8NA 3WABA 4P4JA 2EK9A 4MRIA 3VARA 3BXMA 2ZOGA 3WT4A 1LCPA 4YWYA 3NH4A 2WZNA 4GM5A 1IGBA 4FAIA 4OC2A 3FJUA 3K2KA 3IJ3A 1BAVA 2F8HA 2OOTA 2PJ2A 2QYVA 4W9YA 4JYWA 2ZEHA 2ZEOA 5K8PA 1Y7EA 1LANA 2JEWA 2PJ6A 4ONWA 2AFMA 3K9TA 1ELMP 3FECA 4OKOA 5HVFA 2V8HA 3I6SA 4PXEA 3B3TA 4PXCA 3RZAA 1ZLHA 1TF9A 1TKFA 4OIWA 3VATA 1CBXA 1XRYA 1Z8LA 4TJVA 1CPXA 2G9DA 3RAMA 4X2TA 4CDJA 1QMUA 2BOAA 3NFZA 5K8MA 3B3SA 3LWUA 1TKHA 2FVGA 4NFRA 4WJBA 4C84A 1CG2A 3PB6X 2PJ5A 3FVLA 4MCPA 2QVPA 3PB4X 2Q4ZA 1KWMA 4C85A 4H2KA 5HVHA 1ARMA 2C6GA 4EMEA 4PXBA 4A39A 4OC4A 3SJGA 2IMOA 5HXDA 4MCQA 3HUVA 4R8FA 4O23A 4ZY1A 1TKJA 1DE4C 2F7VA 4BD9A 5F09A 2PVWA 4CPAA 2ZEDA 4KSIA 4UIAA 2DEAA 2GLFA 1YMEA 2QJ8A 2J9AA 1Z2LA 3D7FA 2AFUA 2ZEEA 4DJLA 1LOKA 2POKA 4NGNA 3KR5A 4R6TA 3CDXA 4C86A 3FX6A 1ELLP 2CIJA 1HDQA 3EIFA 2ZOFA 5K8OA 3IIBA 3PB7X 3KR4A 4YN3A 4P4IA 4C8AA 4UEFA 3CPAA 4DUKA 1OBRA 4MHPA 3NH8A 1CP6A 3WC5A 1FNOA 5D8NA 1NSAA 4PXDA 3H8EA 1ZG8A 5HVGA 3KHZA 3IFEA 3KL9A 1ZG9A 4IK2A 4UF4A 3BI1A 4YU9A 5D29A 3IC1A 4MHNA 4P6YA 1F2OA 2PJ3A 1Y9ZA 4TWEA 5DS0A 2HC9A 3WC7A 3B3VA 4KNGE 1ZLIA 1Y0YA 2ANPA 2C1CA 4C9VA 2JBJA 1CPSA 3B3WA 2O4HA 5THWA 4C9RA 5LRJA 4UEEA 3D66A 4OIDA 5ELYA 2PJ9A 3V7ZA 4FUUA 3S9NA 1EE3P 4NGRA 1IY7A 6CPAA 3JRUA 1JQGA 2PJ4A 2Q43A 2AFXA 3GB0A 4TJXA 4K3NA 3ISXA 3HLPA 3BI0A 2PJ8A 4ZX9A 2V8DA 2PJ1A 4OC0A 2JBKA 4Q7AA 2WYRA 1V6CA 4A37A 1TF8A 1CP7A 4MCRA 3KQXA 1VHEA 3NH5A 3SI1A 4C9UA 3CPXA 3D7HA 3SJFA 2ZEFA 2ZEGA 1XMBA 3MRUA 5CPAA 4NGPA 5LRKA 1YW4A 2PCUA 5LYFA 4ZX8A 1HDUA 2NSMA 4NGSA 2NYQA 4EWTA 4NJQA 4P4BA 4WWVA 4C8UA 3FMCA 3D7GA 4Z65A 3I74A 2C6PA 1TXRA 2HB6A 2C6CA 2IJZA 3RBUA 2V77A 2XEJA 3PFOA 3V38A 3QNVA 3KZWA 3I1UA 4OP4A 4IAVA 2BCOA 3CT9A 1UWYA 3PBBA 3GLJA 4X8IA 3BHXA 3VH9A 4OC5A 2ABZA 1F57A 4PQAA
chains in the Genus database with same CATH superfamily
3D67A 4P4FA 2ODFA 3TO9A 4MHYA 4A30A 2B4JC 3PB9X 2EK8A 4BMHA 4CYOA 5K99A 1XE4A 1QSOA 2PIYA 3OB1B 2ZEMA 3PFVA 4R87A 3EZAA 3IEHA 3B3CA 3SHPA 2GLJA 3TTHA 3L2NA 3D2MA 4PSXA 1AYEA 1AMPA 3G3SA 2JDCA 2P6FA 4X5KA 4KVOE 2PRBA 3IWWA 1YLEA 4G1PA 2CBLA 2CF4A 4I49A 2Q4VA 3TO7A 1RXTA 3R95A 5IB9A 3D4UA 1VIXA 2EUIA 3PZJA 3FB3A 5J3XA 3SJXA 4JD6A 2OR4A 2BL1A 5CBMA 2D4OA 2FE7A 4F9VA 3K4IA 4CAEA 3DNSA 4AXVA 2PRQA 3A9LA 2REFA 4ZI6A 1KBLA 2EZAA 3TLBA 1YLOA 4IHMA 4MCSA 5LYIA 1VKCA 2FXFA 4KSFA 3S6FA 2PR1A 5H86A 5F48A 1LFWA 1ON0A 2Z3OA 4OMEA 1PCAA 8CPAA 2PJAA 4A33A 4C9AA 4COGA 3OP0A 2D0OA 1KUVA 4CGNA 3EZEA 3U88C 2IQ6A 3KQZA 1GHEA 4MMOA 3TX8A 2YJTA 3B2YA 4NF1A 3RO0A 4JWPA 2CXAA 1JDBC 2ATRA 5FD8A 1YREA 4RUHA 2FL4A 1FBVA 4KOUA 3PBEA 2AFZA 4IIXA 5LRGA 1Y0RA 2QMLA 2ZELA 4JJXA 4CDKA 3LMSA 4C9EA 1Y7RA 2FT0A 1M4LA 4J0NA 2RFHA 4PPZA 4A94A 3GUXA 4A38A 3ZNIA 2R7HA 4QVTA 4XPDC 2O53A 4KOTA 4GPLB 1R3NA 1R43A 2EBJA 4C7IA 2PQ8A 3MN8A 3TFYA 2CNMA 4C99A 1Z8WA 5A27A 4C8PA 1FT7A 4DYOA 5G1ZA 1LAPA 2K5TA 2CTCA 2V8VA 4P45A 2Q51A 5C88A 2R98A 4CGMA 1T36B 3FNCA 4CS0B 1BPMA 2D0PA 1XBUA 2G3AA 3FXTA 4KS9A 2HWGA 2CTBA 4KVXA 1XFOA 5G21A 5F47A 1H8LA 1VGYA 1YX0A 3IO1A 3N5FA 4KVME 2YNEA 4JXRA 5JGFA 1QQ9A 1WK4A 3H8FA 5J8FA 2B4BA 4NGMA 5I0CA 4E0AA 3G8WA 1JWQA 3TOAA 3B35A 4MHDA 4KLWA 1C30B 5AG4A 5KTCA 2GU2A 4UIBA 4FD6A 1Y9WA 4RN7A 2YNCC 1ZG7A 2AFWA 4MHZA 2PIZA 4R57A 4MFJA 4COBA 4EFDA 4MI4A 4C8CA 1CJWA 5HKYA 2JEVA 4Q38A 1P4NA 2IL4A 4FWUA 4C2XA 4KUAA 3S6KA 1Z5RA 4NGTA 3BUOB 4B5PA 1Z4RA 1XF8A 3VGOA 3NFQA 2D4PA 4UCNA 3IU2A 4B12A 3TE4A 2YNDA 4MJXA 2EO8A 3H8GA 1S7LA 2EZCA 2J8RA 3GJZA 3H4QA 5IR2A 2XEGA 4ZY0A 4BPXB 3IGRA 3TLGA 3EFAA 3KGQA 4PK2A 1WWZA 1Q7LA 1VHSA 4MY0A 2PSWA 4CAXA 3KKWA 3FEDA 2Z0ZA 3DR6A 3DGVA 5JYBA 4P44A 4CYQA 1PU9A 2PJ0A 3GY9A 1Q5XA 4NJRA 3SI0A 1VI4A 2RB7A 5LYDA 4LQGA 4QBJA 2ZENA 4KOVA 5F5XA 2PR8A 2EWBA 4OC1A 3EY5A 1XF1A 4H1HA 4YFJA 3JUWA 2ZXVA 3QAHA 3HMJG 5HH1A 4MJ8A 1QSTA 5GCNA 2YJVA 3R9GA 5LYLA 4B5PB 4P4EA 4R7MA 1YSJA 2PJCA 3S6GA 3KASA 4CAWA 3FF3A 4OC3A 3VTAA 1X12A 5JH9A 3F9KC 2V8GA 3PB8X 2PJBA 1BPNA 3S9MA 3B7IA 3OWCA 3TC8A 3WR7A 2PCNA 1M4DA 2OU2A 2VL1A 1VHOA 4HKFA 3TLGB 2I3CA 3DLJA 3RYOA 4HNYB 4MFQA 4R76A 2AJ6A 3D7DA 2AFOA 5FVJA 1YW6A 3WC6A 3ICUA 1YQEA 4JZ0A 1HEEA 4R9MA 1RTQA 4F8ZA 5J1QA 3EXNA 4MXUA 4ONUA 2AFSA 5J8CA 1M1DA 4II9A 2B3UA 4RR2B 2BO9A 3NE7A 4QC6A 5AG7A 3W6XA 5A28A 2Z3LA 4KLVA 2Z3PA 3TOBA 4DNCA 4NEXA 3LACA 2PJ7A 4HNWB 3W6SA 5DWNA 4X3RA 3FH4A 4IIYA 3SJEA 2PVVA 3S9LA 2O28A 4ZYQA 3FEEA 4MFPA 4P10A 3T8WA 1IYLA 1JDEA 2PE3A 3CXSA 4ZY2A 1IICA 1UFHA 4Q36A 1BLLE 4LQ6A 5I4MA 2B58A 4TNUA 2ZEPA 4NGQA 3LD2A 4KOXA 4UEZA 1ZRSA 4R3KA 1PYTB 2VEZA 4Y49C 2XPLA 2XEFA 2HI6A 1XJOA 3TLYA 1ARLA 3DR8A 3IWEA 3PRTA 3D8PA 2XEIA 2GANA 4R3LA 3ISZA 3ZJ0A 3PEIA 5JM6A 5F9MA 2FCKA 1LAMA 4AVBA 1WVMA 2OZHA 4F9UA 3FRMA 5F13A 1B6BA 4KOWA 4B6ZA 4C8FA 5F46A 4P4DA 1S7FA 2GREA 2VZYA 4XPKA 1F2PA 3JTKA 3NA6A 4M6IA 5F49A 4FBEA 2ZW4A 4AG7A 3NOJA 1Z9UA 4F0XA 4M6HA 1KEEB 1YGHA 3KHXA 3E0KA 3KI9A 2DPSA 4H6UA 2AE6A 2OH1A 2VZZA 3GKRA 3MGDA 4ZBGA 2JLMA 1GYTA 3SI2A 4A95A 5AG5A 4E8OA 2Y1NA 3PFEA 3TO6A 2PC1A 2N3AB 5HKZA 1BO4A 4C8TA 3V8IA 4OLLA 3LODA 4HNXB 4BTFA 2B5GA 3T9YA 3D68A 1CX8A 3VROA 1DTDA 2KCWA 3FBUA 3EZBA 1B47A 1Z9EA 7CPAA 2GE3A 2B3VA 4F0YA 5JPHA 5CNPA 4B13A 4FD5A 5K8NA 3WABA 2VKZG 4P4JA 3F5BA 4MBUA 4MI1A 4AG9A 2EK9A 4Y49B 1EZAA 4MRIA 3BUXB 3VARA 4E5SA 3BXMA 2GFQA 2ZOGA 3WT4A 3PLFB 3O8ZA 3BUWB 5KTDA 2Z11A 4U9ZA 1LCPA 1MJAA 1RO5A 4YWYA 1Z8XA 3NH4A 1CS0B 3K9UA 2HROA 2XPNA 2H5MA 2WZNA 4GM5A 4BINA 4NXYA 1IGBA 1YVOA 2I79A 4PSWA 4UWIA 4FAIA 1VBHA 1XMTA 3VRPA 1K4JA 1QSMA 1IOIA 4BPWB 3BLNA 4OC2A 2RC4A 3FJUA 1Y9KA 4KUBA 3K2KA 1IOFA 3BJ8A 1FY7A 3IJ3A 1BAVA 2B5GB 2F8HA 1YR0A 2OLSA 2OOTA 2PJ2A 2E28A 2QYVA 4W9YA 5AG6A 5BWAB 2WUUA 1P0HA 4JYWA 1NE9A 1B87A 1S5KA 1WJTA 2HQYA 2ZEHA 2ZEOA 4RS2A 3SXOA 3W91A 5K8PA 4INJA 4UFXA 1Y7EA 1LANA 2PDOA 2JEWA 2PJ6A 1IYKA 4ONWA 4CGOA 2AFMA 3D3SA 1KC7A 2AUMA 3K9TA 1ELMP 3FECA 4UFVA 4J3GA 2MP0A 1M44A 4OKOA 5HVFA 4AB7A 2V8HA 3I6SA 4PXEA 3B3TA 4PXCA 5EBVA 3RZAA 1ZLHA 2EZBA 1TF9A 4UCPA 1Z4EA 4C7HA 4A32A 3TCVA 1EO0A 1TKFA 3R9FA 4BPUB 4OIWA 4YGOA 3VATA 3GIUA 1BXRB 1CBXA 1XRYA 1Z8LA 3EC4A 4M6GA 4TJVA 1CPXA 2GIVA 4CAFA 5KTAA 2G9DA 3RAMA 4X2TA 4CDJA 3VRQA 1QMUA 2BOAA 3NFZA 2Q0YA 3VWDA 5K8MA 2X0SA 4ORFA 4EVYA 4GXHA 3B3SA 4AVCA 3LWUA 1TKHA 2FVGA 4NFRA 2J8MA 4WJBA 4A2ZA 1CG2A 4XPLA 4C84A 3PB6X 2PJ5A 3FVLA 1J3LA 1EZBA 2BSWA 4MCPA 2QVPA 3CZXA 3PB4X 2HUZA 2Q4ZA 1OZPA 3CXPA 4FD7A 1KWMA 2Z10A 2QIRA 4C85A 2VI7A 4H2KA 4NSQA 3PP9A 5HVHA 1ARMA 2DXQA 2REEA 2C6GA 2FSRA 2Y0MA 4CYNA 3G23A 1BOBA 4EMEA 4PXBA 2C5QA 3TLEA 4A39A 3C26A 3FYNA 3TLCA 4C2YA 4OC4A 3FIXA 3SJGA 1M4GA 2IMOA 5EC4A 2P6GA 1VBGA 5G22A 5HXDA 4MCQA 3HUVA 4R8FA 4O23A 4ZY1A 4E94A 2QECA 1TKJA 3DDDA 1DE4C 4UBRA 2F7VA 1Q2YA 2BEIA 2Z3NA 5HMNA 2VQYA 3CXQA 4A4BA 1S3ZA 2AUNA 4BD9A 5F09A 2R82A 2PVWA 2ZPAA 1X10A 3IU1A 2F5IA 2JDDA 3KRVA 4CPAA 2CY2A 2ZEDA 4UWJA 4KSIA 4UIAA 3TYXA 2DEAA 2GLFA 1YMEA 2QJ8A 5E96A 2J9AA 1Z2LA 4C2ZA 4BBHA 3D7FA 2AFUA 5AGEA 3U1BA 2G3TA 2ZEEA 4DJLA 1LOKA 5JQ4A 1CE8B 2POKA 4NGNA 3KR5A 3R9EA 4CAVA 1I21A 3CDXA 4R6TA 4C86A 3FX6A 3D2PA 4CRZB 1ELLP 2CIJA 1S60A 4KOYA 3T90A 1HDQA 1NSLA 2BUEA 4PV6A 3EIFA 1Q2CA 2ZOFA 3TT2A 5K8OA 2B0AA 5DWMA 1YVHA 2DIKA 3T07A 3IIBA 3HPHE 3VRRA 3P2FA 2VBQA 3PB7X 2FS5A 3KR4A 4B14A 4YN3A 3BUMB 1M4IA 1IB1E 1NMTA 4P4IA 4IUSA 1A2ZA 4F6AA 1KUYA 4MFKA 4C8AA 4UEFA 3CPAA 4MFZA 1Q2DA 4DUKA 1ZL0A 1OBRA 1IIDA 4MHPA 3NH8A 4CZ1A 1CP6A 2FIAA 4HPSA 3WC5A 3VWEA 1FNOA 5D8NA 2R1IA 1NSAA 1XIXA 3H8EA 4PXDA 1ZG8A 2Q7BA 3ZZIA 3KHZA 5HVGA 2DF5A 4FD4A 4H89A 4OAEA 3IFEA 3KL9A 3T5MA 2ZW7A 1ZG9A 3H5ZA 4IK2A 4UF4A 2P6EA 1S7KA 4U5YA 1R61A 1R57A 3S6HA 2CNSA 3BUNB 3BI1A 4IF5A 4YU9A 5D29A 3IC1A 4MHNA 2C27A 4CO9A 4P6YA 1F2OA 4NCZA 3R96A 1AUGA 2I00A 1A9XB 2PJ3A 1Y9ZA 4TWEA 3PT1A 4KSAA 2HC9A 3GYAA 2DPTA 4L8AA 5DS0A 3WC7A 3B3VA 2WSAA 4KNGE 3RNZA 5HKWA 4LX9A 4H6ZA 5EMIA 1ZLIA 5ISVA 1GGOA 1Y0YA 3F0AA 2EVNA 2ANPA 4B11A 4XNHC 2C1CA 2NMTA 4RI1A 2JBJA 1CPSA 4M8DA 4JLYA 4C9VA 4EYSA 2J8NA 3B3WA 2VXKA 2O4HA 1ZO0A 5THWA 5LRJA 4C9RA 4UEEA 3C8OA 5C82A 4CGPA 3D66A 4OIDA 2A4NA 3I9SA 5ELYA 2PJ9A 2XPOA 3V7ZA 2CNTA 4FUUA 3S9NA 1EE3P 4NGRA 3IWGA 2Z3MA 4C68A 1IY7A 6CPAA 3JRUA 1JQGA 1IU8A 2OZGA 2PJ4A 2Q44A 4OADA 2Q43A 4MY3A 2GP4A 2AFXA 3NE8A 3SXNA 1YVKA 3GB0A 4TJXA 1S7NA 1I12A 4K3NA 2FM4A 1CM0A 1U6MA 3ISXA 1TIQA 2Y1MA 3HLPA 3TLAA 5F1YA 3BI0A 2PJ8A 3PGPA 2X7BA 1C3OB 4ZX9A 2YGWA 4CGLA 1J4JA 4A4CA 2V8DA 2PJ1A 2XPPA 4OC0A 4XNHB 2YNCA 2JBKA 4Q7AA 1KZFA 2WYRA 3DSBA 4AVAA 2Q7SA 1V6CA 4A37A 5IX3A 1TF8A 1CP7A 3QAYA 4MCRA 4UFWA 4XPDB 1ZYMA 5IB0A 2FIWA 2WPXA 3KQXA 1QSRA 1SQHA 2ARHA 2UV8G 1VHEA 3NH5A 4B10A 3SI1A 4M3SA 4C9UA 2DLAA 3CPXA 3N7ZA 4LUAA 3D7HA 4M85A 3SJFA 3F8KA 4YRHA 1MK4A 2ZEFA 2ZEGA 1XMBA 3EO4A 3MRUA 5CPAA 4NGPA 1MJ9A 1YW4A 2PCUA 2Q4YA 5LRKA 3T05A 4JVOA 2P0WA 2OB0A 1V0CA 4ZX8A 3P2HA 5LYFA 1HDUA 2NSMA 1L0CA 2B4DA 1XEBA 2ZW6A 3R1KA 4KOSA 4NGSA 1QSNA 2NYQA 3BJ7A 3JVNA 1M6VB 4EWTA 4PK3A 4NJQA 3VRNA 3SR3A 4P4BA 1NXJA 4WWVA 3I3GA 4CYPA 1MJBA 1PUAA 1DIKA 3HPGG 4C8UA 3QB8A 3FMCA 3D7GA 1YK3A 3OAKA 4Z65A 3I74A 4L89A 4ZGYB 1TXRA 2C6PA 2HB6A 2C6CA 2IJZA 3RBUA 2V77A 2XEJA 2R8VA 3PFOA 4KZTA 3V38A 3QNVA 1N71A 2G0BA 1LRZA 2OZUA 3B8GA 3KZWA 3I1UA 5AXIA 4OP4A 1NBWA 1Z8TA 4IAVA 5IV0A 2HV2A 2BCOA 5JVLA 1XOVA 4K30A 1KUXA 2Q04A 1I1DA 4JXQA 3UY5A 3OB2B 3CT9A 4A31A 1UWYA 3PBBA 3TLZA 2ZW5A 4KORA 4UA3A 4MFLA 3GLJA 4QB9A 4X8IA 3BHXA 5BY0A 4B5OA 4E2AA 5G20A 2Z3KA 4CRYB 3T0TA 3VH9A 2B4DB 4GS4A 5H84A 4OC5A 4QUSA 4U9YA 2ABZA 1F57A 4PQAA 2WPWA 4UCMA
chains in the Genus database with same CATH topology
3D67A 4P4FA 4MHYA 3PB9X 2EK8A 2PIYA 2ZEMA 3IEHA 3B3CA 2GLJA 3L2NA 1AYEA 1AMPA 3IWWA 4G1PA 2CF4A 5IB9A 3D4UA 1VIXA 3SJXA 5CBMA 2OR4A 4F9VA 4AXVA 2PRQA 4ZI6A 1YLOA 4IHMA 4MCSA 5LYIA 1LFWA 4OMEA 1PCAA 8CPAA 2PJAA 4C9AA 3KQZA 2IQ6A 4MMOA 3TX8A 3B2YA 4RUHA 3PBEA 2AFZA 5LRGA 1Y0RA 2ZELA 4CDKA 3LMSA 4C9EA 1M4LA 2RFHA 4PPZA 4A94A 3GUXA 4A38A 2O53A 1R3NA 1R43A 4C99A 3MN8A 4C8PA 1FT7A 4DYOA 1LAPA 2CTCA 2V8VA 4P45A 2Q51A 1BPMA 1XBUA 2CTBA 1XFOA 1H8LA 1VGYA 3N5FA 3IO1A 5JGFA 1QQ9A 3H8FA 4NGMA 3B35A 2GU2A 4UIBA 1ZG7A 2AFWA 4MHZA 2PIZA 4EFDA 4C8CA 4FWUA 1Z5RA 4NGTA 3H8GA 5IR2A 2XEGA 4ZY0A 3KGQA 1Q7LA 3FEDA 3DGVA 4P44A 2PJ0A 4NJRA 3SI0A 2RB7A 5LYDA 4LQGA 2ZENA 2EWBA 4OC1A 1XF1A 5LYLA 4P4EA 4R7MA 1YSJA 2PJCA 3KASA 3FF3A 4OC3A 3VTAA 5JH9A 2V8GA 3PB8X 2PJBA 1BPNA 3S9MA 3B7IA 3TC8A 2VL1A 1VHOA 2I3CA 3DLJA 4R76A 3D7DA 2AFOA 1YW6A 3WC6A 3ICUA 4JZ0A 1HEEA 1RTQA 4F8ZA 5J1QA 4MXUA 2AFSA 2BO9A 2PJ7A 4X3RA 3FH4A 3SJEA 2PVVA 3S9LA 4ZYQA 3FEEA 4P10A 3T8WA 2PE3A 4ZY2A 1BLLE 5I4MA 4TNUA 2ZEPA 4NGQA 4UEZA 1PYTB 2XEFA 1XJOA 1ARLA 3PRTA 2XEIA 3ISZA 3PEIA 5JM6A 1LAMA 1WVMA 4F9UA 4C8FA 4B6ZA 4P4DA 2GREA 1F2PA 3NA6A 4FBEA 3KI9A 3KHXA 3SI2A 1GYTA 3PFEA 4C8TA 3D68A 1CX8A 1DTDA 7CPAA 5K8NA 3WABA 4P4JA 2EK9A 4MRIA 3VARA 3BXMA 2ZOGA 3WT4A 1LCPA 4YWYA 3NH4A 2WZNA 4GM5A 1IGBA 4FAIA 4OC2A 3FJUA 3K2KA 3IJ3A 1BAVA 2F8HA 2OOTA 2PJ2A 2QYVA 4W9YA 4JYWA 2ZEHA 2ZEOA 5K8PA 1Y7EA 1LANA 2JEWA 2PJ6A 4ONWA 2AFMA 3K9TA 1ELMP 3FECA 4OKOA 5HVFA 2V8HA 3I6SA 4PXEA 3B3TA 4PXCA 3RZAA 1ZLHA 1TF9A 1TKFA 4OIWA 3VATA 1CBXA 1XRYA 1Z8LA 4TJVA 1CPXA 2G9DA 3RAMA 4X2TA 4CDJA 1QMUA 2BOAA 3NFZA 5K8MA 3B3SA 3LWUA 1TKHA 2FVGA 4NFRA 4WJBA 4C84A 1CG2A 3PB6X 2PJ5A 3FVLA 4MCPA 2QVPA 3PB4X 2Q4ZA 1KWMA 4C85A 4H2KA 5HVHA 1ARMA 2C6GA 4EMEA 4PXBA 2C5QA 4A39A 4OC4A 3SJGA 2IMOA 5HXDA 4MCQA 3HUVA 4R8FA 4O23A 4ZY1A 1TKJA 1DE4C 2F7VA 4BD9A 5F09A 2PVWA 4CPAA 2ZEDA 4KSIA 4UIAA 2DEAA 2GLFA 1YMEA 2QJ8A 2J9AA 1Z2LA 3D7FA 2AFUA 2ZEEA 4DJLA 1LOKA 2POKA 4NGNA 3KR5A 4R6TA 3CDXA 4C86A 3FX6A 1ELLP 2CIJA 1HDQA 3EIFA 2ZOFA 5K8OA 3IIBA 3PB7X 3KR4A 4YN3A 4P4IA 4C8AA 4UEFA 3CPAA 4DUKA 1OBRA 4MHPA 3NH8A 1CP6A 3WC5A 1FNOA 5D8NA 1NSAA 4PXDA 3H8EA 1ZG8A 5HVGA 3KHZA 3IFEA 3KL9A 1ZG9A 4IK2A 4UF4A 3BI1A 4YU9A 5D29A 3IC1A 4MHNA 4P6YA 1F2OA 2PJ3A 1Y9ZA 4TWEA 5DS0A 2HC9A 3WC7A 3B3VA 4KNGE 1ZLIA 1Y0YA 2ANPA 2C1CA 4C9VA 2JBJA 1CPSA 3B3WA 2O4HA 5THWA 4C9RA 5LRJA 4UEEA 3D66A 4OIDA 5ELYA 2PJ9A 3V7ZA 4FUUA 3S9NA 1EE3P 4NGRA 1IY7A 6CPAA 3JRUA 1JQGA 2PJ4A 2Q43A 2GP4A 2AFXA 3GB0A 4TJXA 4K3NA 3ISXA 3HLPA 3BI0A 2PJ8A 4ZX9A 2V8DA 2PJ1A 4OC0A 2JBKA 4Q7AA 2WYRA 1V6CA 4A37A 1TF8A 1CP7A 4MCRA 3KQXA 1VHEA 3NH5A 3SI1A 4C9UA 3CPXA 3D7HA 3SJFA 2ZEFA 2ZEGA 1XMBA 3MRUA 5CPAA 4NGPA 5LRKA 1YW4A 2PCUA 5LYFA 4ZX8A 1HDUA 2NSMA 4NGSA 2NYQA 4EWTA 4NJQA 4P4BA 4WWVA 4C8UA 3FMCA 3D7GA 4Z65A 3I74A 2C6PA 1TXRA 2HB6A 2C6CA 2IJZA 3RBUA 2V77A 2XEJA 3PFOA 3V38A 3QNVA 3KZWA 3I1UA 4OP4A 4IAVA 2BCOA 3CT9A 1UWYA 3PBBA 3GLJA 4X8IA 3BHXA 3VH9A 4OC5A 2ABZA 1F57A 4PQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D67 A;  4P4F A;  4MHY A;  3PB9 X;  2EK8 A;  2PIY A;  2ZEM A;  3IEH A;  3B3C A;  2GLJ A;  3L2N A;  1AYE A;  1AMP A;  3IWW A;  4G1P A;  2CF4 A;  5IB9 A;  3D4U A;  1VIX A;  3SJX A;  5CBM A;  2OR4 A;  4F9V A;  4AXV A;  2PRQ A;  4ZI6 A;  1YLO A;  4IHM A;  4MCS A;  5LYI A;  1LFW A;  4OME A;  1PCA A;  8CPA A;  2PJA A;  4C9A A;  3KQZ A;  2IQ6 A;  4MMO A;  3TX8 A;  3B2Y A;  4RUH A;  3PBE A;  2AFZ A;  5LRG A;  1Y0R A;  2ZEL A;  4CDK A;  3LMS A;  4C9E A;  1M4L A;  2RFH A;  4PPZ A;  4A94 A;  3GUX A;  4A38 A;  2O53 A;  1R3N A;  1R43 A;  4C99 A;  3MN8 A;  4C8P A;  1FT7 A;  4DYO A;  1LAP A;  2CTC A;  2V8V A;  4P45 A;  2Q51 A;  1BPM A;  1XBU A;  2CTB A;  1XFO A;  1H8L A;  1VGY A;  3N5F A;  3IO1 A;  5JGF A;  1QQ9 A;  3H8F A;  4NGM A;  3B35 A;  2GU2 A;  4UIB A;  1ZG7 A;  2AFW A;  4MHZ A;  2PIZ A;  4EFD A;  4C8C A;  4FWU A;  1Z5R A;  4NGT A;  3H8G A;  2XEG A;  4ZY0 A;  3KGQ A;  1Q7L A;  3FED A;  3DGV A;  4P44 A;  2PJ0 A;  4NJR A;  3SI0 A;  2RB7 A;  5LYD A;  4LQG A;  2ZEN A;  2EWB A;  4OC1 A;  1XF1 A;  5LYL A;  4P4E A;  4R7M A;  1YSJ A;  2PJC A;  3KAS A;  3FF3 A;  4OC3 A;  3VTA A;  5JH9 A;  2V8G A;  3PB8 X;  2PJB A;  1BPN A;  3S9M A;  3B7I A;  3TC8 A;  2VL1 A;  1VHO A;  2I3C A;  3DLJ A;  4R76 A;  3D7D A;  2AFO A;  1YW6 A;  3WC6 A;  3ICU A;  4JZ0 A;  1HEE A;  1RTQ A;  4F8Z A;  5J1Q A;  4MXU A;  2AFS A;  2BO9 A;  2PJ7 A;  4X3R A;  3FH4 A;  3SJE A;  2PVV A;  3S9L A;  4ZYQ A;  3FEE A;  4P10 A;  3T8W A;  2PE3 A;  4ZY2 A;  1BLL E;  5I4M A;  4TNU A;  2ZEP A;  4NGQ A;  4UEZ A;  1PYT B;  2XEF A;  1XJO A;  1ARL A;  3PRT A;  2XEI A;  3ISZ A;  3PEI A;  5JM6 A;  1LAM A;  1WVM A;  4F9U A;  4C8F A;  4B6Z A;  4P4D A;  2GRE A;  1F2P A;  3NA6 A;  4FBE A;  3KI9 A;  3KHX A;  3SI2 A;  1GYT A;  3PFE A;  4C8T A;  3D68 A;  1CX8 A;  1DTD A;  7CPA A;  5K8N A;  3WAB A;  4P4J A;  2EK9 A;  4MRI A;  3VAR A;  3BXM A;  2ZOG A;  3WT4 A;  1LCP A;  4YWY A;  3NH4 A;  2WZN A;  4GM5 A;  1IGB A;  4FAI A;  4OC2 A;  3FJU A;  3K2K A;  3IJ3 A;  1BAV A;  2F8H A;  2OOT A;  2PJ2 A;  2QYV A;  4W9Y A;  4JYW A;  2ZEH A;  2ZEO A;  5K8P A;  1Y7E A;  1LAN A;  2JEW A;  2PJ6 A;  4ONW A;  2AFM A;  3K9T A;  1ELM P;  3FEC A;  4OKO A;  5HVF A;  2V8H A;  3I6S A;  4PXE A;  3B3T A;  4PXC A;  3RZA A;  1ZLH A;  1TF9 A;  1TKF A;  4OIW A;  3VAT A;  1CBX A;  1XRY A;  1Z8L A;  4TJV A;  1CPX A;  2G9D A;  3RAM A;  4X2T A;  4CDJ A;  1QMU A;  2BOA A;  3NFZ A;  5K8M A;  3B3S A;  3LWU A;  1TKH A;  2FVG A;  4NFR A;  4WJB A;  4C84 A;  1CG2 A;  3PB6 X;  2PJ5 A;  3FVL A;  4MCP A;  2QVP A;  3PB4 X;  2Q4Z A;  1KWM A;  4C85 A;  4H2K A;  5HVH A;  1ARM A;  2C6G A;  4EME A;  4PXB A;  4A39 A;  4OC4 A;  3SJG A;  2IMO A;  5HXD A;  4MCQ A;  3HUV A;  4R8F A;  4O23 A;  4ZY1 A;  1TKJ A;  1DE4 C;  2F7V A;  4BD9 A;  5F09 A;  2PVW A;  4CPA A;  2ZED A;  4KSI A;  4UIA A;  2DEA A;  2GLF A;  1YME A;  2QJ8 A;  2J9A A;  1Z2L A;  3D7F A;  2AFU A;  2ZEE A;  4DJL A;  1LOK A;  2POK A;  4NGN A;  3KR5 A;  4R6T A;  3CDX A;  4C86 A;  3FX6 A;  1ELL P;  2CIJ A;  1HDQ A;  3EIF A;  2ZOF A;  5K8O A;  3IIB A;  3PB7 X;  3KR4 A;  4YN3 A;  4P4I A;  4C8A A;  4UEF A;  3CPA A;  4DUK A;  1OBR A;  4MHP A;  3NH8 A;  1CP6 A;  3WC5 A;  1FNO A;  5D8N A;  1NSA A;  4PXD A;  3H8E A;  1ZG8 A;  5HVG A;  3KHZ A;  3IFE A;  3KL9 A;  1ZG9 A;  4IK2 A;  4UF4 A;  3BI1 A;  4YU9 A;  5D29 A;  3IC1 A;  4MHN A;  4P6Y A;  1F2O A;  2PJ3 A;  1Y9Z A;  4TWE A;  5DS0 A;  2HC9 A;  3WC7 A;  3B3V A;  4KNG E;  1ZLI A;  1Y0Y A;  2ANP A;  2C1C A;  4C9V A;  2JBJ A;  1CPS A;  3B3W A;  2O4H A;  5THW A;  4C9R A;  5LRJ A;  4UEE A;  3D66 A;  4OID A;  5ELY A;  2PJ9 A;  3V7Z A;  4FUU A;  3S9N A;  1EE3 P;  4NGR A;  1IY7 A;  6CPA A;  3JRU A;  1JQG A;  2PJ4 A;  2Q43 A;  2AFX A;  3GB0 A;  4TJX A;  4K3N A;  3ISX A;  3HLP A;  3BI0 A;  2PJ8 A;  4ZX9 A;  2V8D A;  2PJ1 A;  4OC0 A;  2JBK A;  4Q7A A;  2WYR A;  1V6C A;  4A37 A;  1TF8 A;  1CP7 A;  4MCR A;  3KQX A;  1VHE A;  3NH5 A;  3SI1 A;  4C9U A;  3CPX A;  3D7H A;  3SJF A;  2ZEF A;  2ZEG A;  1XMB A;  3MRU A;  5CPA A;  4NGP A;  5LRK A;  1YW4 A;  2PCU A;  5LYF A;  4ZX8 A;  1HDU A;  2NSM A;  4NGS A;  2NYQ A;  4EWT A;  4NJQ A;  4P4B A;  4WWV A;  4C8U A;  3FMC A;  3D7G A;  4Z65 A;  3I74 A;  2C6P A;  1TXR A;  2HB6 A;  2C6C A;  2IJZ A;  3RBU A;  2V77 A;  2XEJ A;  3PFO A;  3V38 A;  3QNV A;  3KZW A;  3I1U A;  4OP4 A;  4IAV A;  2BCO A;  3CT9 A;  1UWY A;  3PBB A;  3GLJ A;  4X8I A;  3BHX A;  3VH9 A;  4OC5 A;  2ABZ A;  1F57 A;  4PQA A; 
#chains in the Genus database with same CATH topology
 3D67 A;  4P4F A;  2ODF A;  3TO9 A;  4MHY A;  4A30 A;  2B4J C;  3PB9 X;  2EK8 A;  4BMH A;  4CYO A;  5K99 A;  1XE4 A;  1QSO A;  2PIY A;  3OB1 B;  2ZEM A;  3PFV A;  4R87 A;  3EZA A;  3IEH A;  3B3C A;  3SHP A;  2GLJ A;  3TTH A;  3L2N A;  3D2M A;  4PSX A;  1AYE A;  1AMP A;  3G3S A;  2JDC A;  2P6F A;  4X5K A;  4KVO E;  2PRB A;  3IWW A;  1YLE A;  4G1P A;  2CBL A;  2CF4 A;  4I49 A;  2Q4V A;  3TO7 A;  1RXT A;  3R95 A;  5IB9 A;  3D4U A;  1VIX A;  2EUI A;  3PZJ A;  3FB3 A;  5J3X A;  3SJX A;  4JD6 A;  2OR4 A;  2BL1 A;  5CBM A;  2D4O A;  2FE7 A;  4F9V A;  3K4I A;  4CAE A;  3DNS A;  4AXV A;  2PRQ A;  3A9L A;  2REF A;  4ZI6 A;  1KBL A;  2EZA A;  3TLB A;  1YLO A;  4IHM A;  4MCS A;  5LYI A;  1VKC A;  2FXF A;  4KSF A;  3S6F A;  2PR1 A;  5H86 A;  5F48 A;  1LFW A;  1ON0 A;  2Z3O A;  4OME A;  1PCA A;  8CPA A;  2PJA A;  4A33 A;  4C9A A;  4COG A;  3OP0 A;  2D0O A;  1KUV A;  4CGN A;  3EZE A;  3U88 C;  2IQ6 A;  3KQZ A;  1GHE A;  4MMO A;  3TX8 A;  2YJT A;  3B2Y A;  4NF1 A;  3RO0 A;  4JWP A;  2CXA A;  1JDB C;  2ATR A;  5FD8 A;  1YRE A;  4RUH A;  2FL4 A;  1FBV A;  4KOU A;  3PBE A;  2AFZ A;  4IIX A;  5LRG A;  1Y0R A;  2QML A;  2ZEL A;  4JJX A;  4CDK A;  3LMS A;  4C9E A;  1Y7R A;  2FT0 A;  1M4L A;  4J0N A;  2RFH A;  4PPZ A;  4A94 A;  3GUX A;  4A38 A;  3ZNI A;  2R7H A;  4QVT A;  4XPD C;  2O53 A;  4KOT A;  4GPL B;  1R3N A;  1R43 A;  2EBJ A;  4C7I A;  2PQ8 A;  3MN8 A;  3TFY A;  2CNM A;  4C99 A;  1Z8W A;  5A27 A;  4C8P A;  1FT7 A;  4DYO A;  5G1Z A;  1LAP A;  2K5T A;  2CTC A;  2V8V A;  4P45 A;  2Q51 A;  5C88 A;  2R98 A;  4CGM A;  1T36 B;  3FNC A;  4CS0 B;  1BPM A;  2D0P A;  1XBU A;  2G3A A;  3FXT A;  4KS9 A;  2HWG A;  2CTB A;  4KVX A;  1XFO A;  5G21 A;  5F47 A;  1H8L A;  1VGY A;  1YX0 A;  3IO1 A;  3N5F A;  4KVM E;  2YNE A;  4JXR A;  5JGF A;  1QQ9 A;  1WK4 A;  3H8F A;  5J8F A;  2B4B A;  4NGM A;  5I0C A;  4E0A A;  3G8W A;  1JWQ A;  3TOA A;  3B35 A;  4MHD A;  4KLW A;  1C30 B;  5AG4 A;  5KTC A;  2GU2 A;  4UIB A;  4FD6 A;  1Y9W A;  4RN7 A;  2YNC C;  1ZG7 A;  2AFW A;  4MHZ A;  2PIZ A;  4R57 A;  4MFJ A;  4COB A;  4EFD A;  4MI4 A;  4C8C A;  1CJW A;  5HKY A;  2JEV A;  4Q38 A;  1P4N A;  2IL4 A;  4FWU A;  4C2X A;  4KUA A;  3S6K A;  1Z5R A;  4NGT A;  3BUO B;  4B5P A;  1Z4R A;  1XF8 A;  3VGO A;  3NFQ A;  2D4P A;  4UCN A;  3IU2 A;  4B12 A;  3TE4 A;  2YND A;  4MJX A;  2EO8 A;  3H8G A;  1S7L A;  2EZC A;  2J8R A;  3GJZ A;  3H4Q A;  5IR2 A;  2XEG A;  4ZY0 A;  4BPX B;  3IGR A;  3TLG A;  3EFA A;  3KGQ A;  4PK2 A;  1WWZ A;  1Q7L A;  1VHS A;  4MY0 A;  2PSW A;  4CAX A;  3KKW A;  3FED A;  2Z0Z A;  3DR6 A;  3DGV A;  5JYB A;  4P44 A;  4CYQ A;  1PU9 A;  2PJ0 A;  3GY9 A;  1Q5X A;  4NJR A;  3SI0 A;  1VI4 A;  2RB7 A;  5LYD A;  4LQG A;  4QBJ A;  2ZEN A;  4KOV A;  5F5X A;  2PR8 A;  2EWB A;  4OC1 A;  3EY5 A;  1XF1 A;  4H1H A;  4YFJ A;  3JUW A;  2ZXV A;  3QAH A;  3HMJ G;  5HH1 A;  4MJ8 A;  1QST A;  5GCN A;  2YJV A;  3R9G A;  5LYL A;  4B5P B;  4P4E A;  4R7M A;  1YSJ A;  2PJC A;  3S6G A;  3KAS A;  4CAW A;  3FF3 A;  4OC3 A;  3VTA A;  1X12 A;  5JH9 A;  3F9K C;  2V8G A;  3PB8 X;  2PJB A;  1BPN A;  3S9M A;  3B7I A;  3OWC A;  3TC8 A;  3WR7 A;  2PCN A;  1M4D A;  2OU2 A;  2VL1 A;  1VHO A;  4HKF A;  3TLG B;  2I3C A;  3DLJ A;  3RYO A;  4HNY B;  4MFQ A;  4R76 A;  2AJ6 A;  3D7D A;  2AFO A;  5FVJ A;  1YW6 A;  3WC6 A;  3ICU A;  1YQE A;  4JZ0 A;  1HEE A;  4R9M A;  1RTQ A;  4F8Z A;  5J1Q A;  3EXN A;  4MXU A;  4ONU A;  2AFS A;  5J8C A;  1M1D A;  4II9 A;  2B3U A;  4RR2 B;  2BO9 A;  3NE7 A;  4QC6 A;  5AG7 A;  3W6X A;  5A28 A;  2Z3L A;  4KLV A;  2Z3P A;  3TOB A;  4DNC A;  4NEX A;  3LAC A;  2PJ7 A;  4HNW B;  3W6S A;  5DWN A;  4X3R A;  3FH4 A;  4IIY A;  3SJE A;  2PVV A;  3S9L A;  2O28 A;  4ZYQ A;  3FEE A;  4MFP A;  4P10 A;  3T8W A;  1IYL A;  1JDE A;  2PE3 A;  3CXS A;  4ZY2 A;  1IIC A;  1UFH A;  4Q36 A;  1BLL E;  4LQ6 A;  5I4M A;  2B58 A;  4TNU A;  2ZEP A;  4NGQ A;  3LD2 A;  4KOX A;  4UEZ A;  1ZRS A;  4R3K A;  1PYT B;  2VEZ A;  4Y49 C;  2XPL A;  2XEF A;  2HI6 A;  1XJO A;  3TLY A;  1ARL A;  3DR8 A;  3IWE A;  3PRT A;  3D8P A;  2XEI A;  2GAN A;  4R3L A;  3ISZ A;  3ZJ0 A;  3PEI A;  5JM6 A;  5F9M A;  2FCK A;  1LAM A;  4AVB A;  1WVM A;  2OZH A;  4F9U A;  3FRM A;  5F13 A;  1B6B A;  4KOW A;  4B6Z A;  4C8F A;  5F46 A;  4P4D A;  1S7F A;  2GRE A;  2VZY A;  4XPK A;  1F2P A;  3JTK A;  3NA6 A;  4M6I A;  5F49 A;  4FBE A;  2ZW4 A;  4AG7 A;  3NOJ A;  1Z9U A;  4F0X A;  4M6H A;  1KEE B;  1YGH A;  3KHX A;  3E0K A;  3KI9 A;  2DPS A;  4H6U A;  2AE6 A;  2OH1 A;  2VZZ A;  3GKR A;  3MGD A;  4ZBG A;  2JLM A;  1GYT A;  3SI2 A;  4A95 A;  5AG5 A;  4E8O A;  2Y1N A;  3PFE A;  3TO6 A;  2PC1 A;  2N3A B;  5HKZ A;  1BO4 A;  4C8T A;  3V8I A;  4OLL A;  3LOD A;  4HNX B;  4BTF A;  2B5G A;  3T9Y A;  3D68 A;  1CX8 A;  3VRO A;  1DTD A;  2KCW A;  3FBU A;  3EZB A;  1B47 A;  1Z9E A;  7CPA A;  2GE3 A;  2B3V A;  4F0Y A;  5JPH A;  5CNP A;  4B13 A;  4FD5 A;  5K8N A;  3WAB A;  2VKZ G;  4P4J A;  3F5B A;  4MBU A;  4MI1 A;  4AG9 A;  2EK9 A;  4Y49 B;  1EZA A;  4MRI A;  3BUX B;  3VAR A;  4E5S A;  3BXM A;  2GFQ A;  2ZOG A;  3WT4 A;  3PLF B;  3O8Z A;  3BUW B;  5KTD A;  2Z11 A;  4U9Z A;  1LCP A;  1MJA A;  1RO5 A;  4YWY A;  1Z8X A;  3NH4 A;  1CS0 B;  3K9U A;  2HRO A;  2XPN A;  2H5M A;  2WZN A;  4GM5 A;  4BIN A;  4NXY A;  1IGB A;  1YVO A;  2I79 A;  4PSW A;  4UWI A;  4FAI A;  1VBH A;  1XMT A;  3VRP A;  1K4J A;  1QSM A;  1IOI A;  4BPW B;  3BLN A;  4OC2 A;  2RC4 A;  3FJU A;  1Y9K A;  4KUB A;  3K2K A;  1IOF A;  3BJ8 A;  1FY7 A;  3IJ3 A;  1BAV A;  2B5G B;  2F8H A;  1YR0 A;  2OLS A;  2OOT A;  2PJ2 A;  2E28 A;  2QYV A;  4W9Y A;  5AG6 A;  5BWA B;  2WUU A;  1P0H A;  4JYW A;  1NE9 A;  1B87 A;  1S5K A;  1WJT A;  2HQY A;  2ZEH A;  2ZEO A;  4RS2 A;  3SXO A;  3W91 A;  5K8P A;  4INJ A;  4UFX A;  1Y7E A;  1LAN A;  2PDO A;  2JEW A;  2PJ6 A;  1IYK A;  4ONW A;  4CGO A;  2AFM A;  3D3S A;  1KC7 A;  2AUM A;  3K9T A;  1ELM P;  3FEC A;  4UFV A;  4J3G A;  2MP0 A;  1M44 A;  4OKO A;  5HVF A;  4AB7 A;  2V8H A;  3I6S A;  4PXE A;  3B3T A;  4PXC A;  5EBV A;  3RZA A;  1ZLH A;  2EZB A;  1TF9 A;  4UCP A;  1Z4E A;  4C7H A;  4A32 A;  3TCV A;  1EO0 A;  1TKF A;  3R9F A;  4BPU B;  4OIW A;  4YGO A;  3VAT A;  3GIU A;  1BXR B;  1CBX A;  1XRY A;  1Z8L A;  3EC4 A;  4M6G A;  4TJV A;  1CPX A;  2GIV A;  4CAF A;  5KTA A;  2G9D A;  3RAM A;  4X2T A;  4CDJ A;  3VRQ A;  1QMU A;  2BOA A;  3NFZ A;  2Q0Y A;  3VWD A;  5K8M A;  2X0S A;  4ORF A;  4EVY A;  4GXH A;  3B3S A;  4AVC A;  3LWU A;  1TKH A;  2FVG A;  4NFR A;  2J8M A;  4WJB A;  4A2Z A;  1CG2 A;  4XPL A;  4C84 A;  3PB6 X;  2PJ5 A;  3FVL A;  1J3L A;  1EZB A;  2BSW A;  4MCP A;  2QVP A;  3CZX A;  3PB4 X;  2HUZ A;  2Q4Z A;  1OZP A;  3CXP A;  4FD7 A;  1KWM A;  2Z10 A;  2QIR A;  4C85 A;  2VI7 A;  4H2K A;  4NSQ A;  3PP9 A;  5HVH A;  1ARM A;  2DXQ A;  2REE A;  2C6G A;  2FSR A;  2Y0M A;  4CYN A;  3G23 A;  1BOB A;  4EME A;  4PXB A;  2C5Q A;  3TLE A;  4A39 A;  3C26 A;  3FYN A;  3TLC A;  4C2Y A;  4OC4 A;  3FIX A;  3SJG A;  1M4G A;  2IMO A;  5EC4 A;  2P6G A;  1VBG A;  5G22 A;  5HXD A;  4MCQ A;  3HUV A;  4R8F A;  4O23 A;  4ZY1 A;  4E94 A;  2QEC A;  1TKJ A;  3DDD A;  1DE4 C;  4UBR A;  2F7V A;  1Q2Y A;  2BEI A;  2Z3N A;  5HMN A;  2VQY A;  3CXQ A;  4A4B A;  1S3Z A;  2AUN A;  4BD9 A;  5F09 A;  2R82 A;  2PVW A;  2ZPA A;  1X10 A;  3IU1 A;  2F5I A;  2JDD A;  3KRV A;  4CPA A;  2CY2 A;  2ZED A;  4UWJ A;  4KSI A;  4UIA A;  3TYX A;  2DEA A;  2GLF A;  1YME A;  2QJ8 A;  5E96 A;  2J9A A;  1Z2L A;  4C2Z A;  4BBH A;  3D7F A;  2AFU A;  5AGE A;  3U1B A;  2G3T A;  2ZEE A;  4DJL A;  1LOK A;  5JQ4 A;  1CE8 B;  2POK A;  4NGN A;  3KR5 A;  3R9E A;  4CAV A;  1I21 A;  3CDX A;  4R6T A;  4C86 A;  3FX6 A;  3D2P A;  4CRZ B;  1ELL P;  2CIJ A;  1S60 A;  4KOY A;  3T90 A;  1HDQ A;  1NSL A;  2BUE A;  4PV6 A;  3EIF A;  1Q2C A;  2ZOF A;  3TT2 A;  5K8O A;  2B0A A;  5DWM A;  1YVH A;  2DIK A;  3T07 A;  3IIB A;  3HPH E;  3VRR A;  3P2F A;  2VBQ A;  3PB7 X;  2FS5 A;  3KR4 A;  4B14 A;  4YN3 A;  3BUM B;  1M4I A;  1IB1 E;  1NMT A;  4P4I A;  4IUS A;  1A2Z A;  4F6A A;  1KUY A;  4MFK A;  4C8A A;  4UEF A;  3CPA A;  4MFZ A;  1Q2D A;  4DUK A;  1ZL0 A;  1OBR A;  1IID A;  4MHP A;  3NH8 A;  4CZ1 A;  1CP6 A;  2FIA A;  4HPS A;  3WC5 A;  3VWE A;  1FNO A;  5D8N A;  2R1I A;  1NSA A;  1XIX A;  3H8E A;  4PXD A;  1ZG8 A;  2Q7B A;  3ZZI A;  3KHZ A;  5HVG A;  2DF5 A;  4FD4 A;  4H89 A;  4OAE A;  3IFE A;  3KL9 A;  3T5M A;  2ZW7 A;  1ZG9 A;  3H5Z A;  4IK2 A;  4UF4 A;  2P6E A;  1S7K A;  4U5Y A;  1R61 A;  1R57 A;  3S6H A;  2CNS A;  3BUN B;  3BI1 A;  4IF5 A;  4YU9 A;  5D29 A;  3IC1 A;  4MHN A;  2C27 A;  4CO9 A;  4P6Y A;  1F2O A;  4NCZ A;  3R96 A;  1AUG A;  2I00 A;  1A9X B;  2PJ3 A;  1Y9Z A;  4TWE A;  3PT1 A;  4KSA A;  2HC9 A;  3GYA A;  2DPT A;  4L8A A;  5DS0 A;  3WC7 A;  3B3V A;  2WSA A;  4KNG E;  3RNZ A;  5HKW A;  4LX9 A;  4H6Z A;  5EMI A;  1ZLI A;  5ISV A;  1GGO A;  1Y0Y A;  3F0A A;  2EVN A;  2ANP A;  4B11 A;  4XNH C;  2C1C A;  2NMT A;  4RI1 A;  2JBJ A;  1CPS A;  4M8D A;  4JLY A;  4C9V A;  4EYS A;  2J8N A;  3B3W A;  2VXK A;  2O4H A;  1ZO0 A;  5THW A;  5LRJ A;  4C9R A;  4UEE A;  3C8O A;  5C82 A;  4CGP A;  3D66 A;  4OID A;  2A4N A;  3I9S A;  5ELY A;  2PJ9 A;  2XPO A;  3V7Z A;  2CNT A;  4FUU A;  3S9N A;  1EE3 P;  4NGR A;  3IWG A;  2Z3M A;  4C68 A;  1IY7 A;  6CPA A;  3JRU A;  1JQG A;  1IU8 A;  2OZG A;  2PJ4 A;  2Q44 A;  4OAD A;  2Q43 A;  4MY3 A;  2GP4 A;  2AFX A;  3NE8 A;  3SXN A;  1YVK A;  3GB0 A;  4TJX A;  1S7N A;  1I12 A;  4K3N A;  2FM4 A;  1CM0 A;  1U6M A;  3ISX A;  1TIQ A;  2Y1M A;  3HLP A;  3TLA A;  5F1Y A;  3BI0 A;  2PJ8 A;  3PGP A;  2X7B A;  1C3O B;  4ZX9 A;  2YGW A;  4CGL A;  1J4J A;  4A4C A;  2V8D A;  2PJ1 A;  2XPP A;  4OC0 A;  4XNH B;  2YNC A;  2JBK A;  4Q7A A;  1KZF A;  2WYR A;  3DSB A;  4AVA A;  2Q7S A;  1V6C A;  4A37 A;  5IX3 A;  1TF8 A;  1CP7 A;  3QAY A;  4MCR A;  4UFW A;  4XPD B;  1ZYM A;  5IB0 A;  2FIW A;  2WPX A;  3KQX A;  1QSR A;  1SQH A;  2ARH A;  2UV8 G;  1VHE A;  3NH5 A;  4B10 A;  3SI1 A;  4M3S A;  4C9U A;  2DLA A;  3CPX A;  3N7Z A;  4LUA A;  3D7H A;  4M85 A;  3SJF A;  3F8K A;  4YRH A;  1MK4 A;  2ZEF A;  2ZEG A;  1XMB A;  3EO4 A;  3MRU A;  5CPA A;  4NGP A;  1MJ9 A;  1YW4 A;  2PCU A;  2Q4Y A;  5LRK A;  3T05 A;  4JVO A;  2P0W A;  2OB0 A;  1V0C A;  4ZX8 A;  3P2H A;  5LYF A;  1HDU A;  2NSM A;  1L0C A;  2B4D A;  1XEB A;  2ZW6 A;  3R1K A;  4KOS A;  4NGS A;  1QSN A;  2NYQ A;  3BJ7 A;  3JVN A;  1M6V B;  4EWT A;  4PK3 A;  4NJQ A;  3VRN A;  3SR3 A;  4P4B A;  1NXJ A;  4WWV A;  3I3G A;  4CYP A;  1MJB A;  1PUA A;  1DIK A;  3HPG G;  4C8U A;  3QB8 A;  3FMC A;  3D7G A;  1YK3 A;  3OAK A;  4Z65 A;  3I74 A;  4L89 A;  4ZGY B;  1TXR A;  2C6P A;  2HB6 A;  2C6C A;  2IJZ A;  3RBU A;  2V77 A;  2XEJ A;  2R8V A;  3PFO A;  4KZT A;  3V38 A;  3QNV A;  1N71 A;  2G0B A;  1LRZ A;  2OZU A;  3B8G A;  3KZW A;  3I1U A;  5AXI A;  4OP4 A;  1NBW A;  1Z8T A;  4IAV A;  5IV0 A;  2HV2 A;  2BCO A;  5JVL A;  1XOV A;  4K30 A;  1KUX A;  2Q04 A;  1I1D A;  4JXQ A;  3UY5 A;  3OB2 B;  3CT9 A;  4A31 A;  1UWY A;  3PBB A;  3TLZ A;  2ZW5 A;  4KOR A;  4UA3 A;  4MFL A;  3GLJ A;  4QB9 A;  4X8I A;  3BHX A;  5BY0 A;  4B5O A;  4E2A A;  5G20 A;  2Z3K A;  4CRY B;  3T0T A;  3VH9 A;  2B4D B;  4GS4 A;  5H84 A;  4OC5 A;  4QUS A;  4U9Y A;  2ABZ A;  1F57 A;  4PQA A;  2WPW A;  4UCM A; 
#chains in the Genus database with same CATH homology
 3D67 A;  4P4F A;  4MHY A;  3PB9 X;  2EK8 A;  2PIY A;  2ZEM A;  3IEH A;  3B3C A;  2GLJ A;  3L2N A;  1AYE A;  1AMP A;  3IWW A;  4G1P A;  2CF4 A;  5IB9 A;  3D4U A;  1VIX A;  3SJX A;  5CBM A;  2OR4 A;  4F9V A;  4AXV A;  2PRQ A;  4ZI6 A;  1YLO A;  4IHM A;  4MCS A;  5LYI A;  1LFW A;  4OME A;  1PCA A;  8CPA A;  2PJA A;  4C9A A;  3KQZ A;  2IQ6 A;  4MMO A;  3TX8 A;  3B2Y A;  4RUH A;  3PBE A;  2AFZ A;  5LRG A;  1Y0R A;  2ZEL A;  4CDK A;  3LMS A;  4C9E A;  1M4L A;  2RFH A;  4PPZ A;  4A94 A;  3GUX A;  4A38 A;  2O53 A;  1R3N A;  1R43 A;  4C99 A;  3MN8 A;  4C8P A;  1FT7 A;  4DYO A;  1LAP A;  2CTC A;  2V8V A;  4P45 A;  2Q51 A;  1BPM A;  1XBU A;  2CTB A;  1XFO A;  1H8L A;  1VGY A;  3N5F A;  3IO1 A;  5JGF A;  1QQ9 A;  3H8F A;  4NGM A;  3B35 A;  2GU2 A;  4UIB A;  1ZG7 A;  2AFW A;  4MHZ A;  2PIZ A;  4EFD A;  4C8C A;  4FWU A;  1Z5R A;  4NGT A;  3H8G A;  5IR2 A;  2XEG A;  4ZY0 A;  3KGQ A;  1Q7L A;  3FED A;  3DGV A;  4P44 A;  2PJ0 A;  4NJR A;  3SI0 A;  2RB7 A;  5LYD A;  4LQG A;  2ZEN A;  2EWB A;  4OC1 A;  1XF1 A;  5LYL A;  4P4E A;  4R7M A;  1YSJ A;  2PJC A;  3KAS A;  3FF3 A;  4OC3 A;  3VTA A;  5JH9 A;  2V8G A;  3PB8 X;  2PJB A;  1BPN A;  3S9M A;  3B7I A;  3TC8 A;  2VL1 A;  1VHO A;  2I3C A;  3DLJ A;  4R76 A;  3D7D A;  2AFO A;  1YW6 A;  3WC6 A;  3ICU A;  4JZ0 A;  1HEE A;  1RTQ A;  4F8Z A;  5J1Q A;  4MXU A;  2AFS A;  2BO9 A;  2PJ7 A;  4X3R A;  3FH4 A;  3SJE A;  2PVV A;  3S9L A;  4ZYQ A;  3FEE A;  4P10 A;  3T8W A;  2PE3 A;  4ZY2 A;  1BLL E;  5I4M A;  4TNU A;  2ZEP A;  4NGQ A;  4UEZ A;  1PYT B;  2XEF A;  1XJO A;  1ARL A;  3PRT A;  2XEI A;  3ISZ A;  3PEI A;  5JM6 A;  1LAM A;  1WVM A;  4F9U A;  4C8F A;  4B6Z A;  4P4D A;  2GRE A;  1F2P A;  3NA6 A;  4FBE A;  3KI9 A;  3KHX A;  3SI2 A;  1GYT A;  3PFE A;  4C8T A;  3D68 A;  1CX8 A;  1DTD A;  7CPA A;  5K8N A;  3WAB A;  4P4J A;  2EK9 A;  4MRI A;  3VAR A;  3BXM A;  2ZOG A;  3WT4 A;  1LCP A;  4YWY A;  3NH4 A;  2WZN A;  4GM5 A;  1IGB A;  4FAI A;  4OC2 A;  3FJU A;  3K2K A;  3IJ3 A;  1BAV A;  2F8H A;  2OOT A;  2PJ2 A;  2QYV A;  4W9Y A;  4JYW A;  2ZEH A;  2ZEO A;  5K8P A;  1Y7E A;  1LAN A;  2JEW A;  2PJ6 A;  4ONW A;  2AFM A;  3K9T A;  1ELM P;  3FEC A;  4OKO A;  5HVF A;  2V8H A;  3I6S A;  4PXE A;  3B3T A;  4PXC A;  3RZA A;  1ZLH A;  1TF9 A;  1TKF A;  4OIW A;  3VAT A;  1CBX A;  1XRY A;  1Z8L A;  4TJV A;  1CPX A;  2G9D A;  3RAM A;  4X2T A;  4CDJ A;  1QMU A;  2BOA A;  3NFZ A;  5K8M A;  3B3S A;  3LWU A;  1TKH A;  2FVG A;  4NFR A;  4WJB A;  4C84 A;  1CG2 A;  3PB6 X;  2PJ5 A;  3FVL A;  4MCP A;  2QVP A;  3PB4 X;  2Q4Z A;  1KWM A;  4C85 A;  4H2K A;  5HVH A;  1ARM A;  2C6G A;  4EME A;  4PXB A;  2C5Q A;  4A39 A;  4OC4 A;  3SJG A;  2IMO A;  5HXD A;  4MCQ A;  3HUV A;  4R8F A;  4O23 A;  4ZY1 A;  1TKJ A;  1DE4 C;  2F7V A;  4BD9 A;  5F09 A;  2PVW A;  4CPA A;  2ZED A;  4KSI A;  4UIA A;  2DEA A;  2GLF A;  1YME A;  2QJ8 A;  2J9A A;  1Z2L A;  3D7F A;  2AFU A;  2ZEE A;  4DJL A;  1LOK A;  2POK A;  4NGN A;  3KR5 A;  4R6T A;  3CDX A;  4C86 A;  3FX6 A;  1ELL P;  2CIJ A;  1HDQ A;  3EIF A;  2ZOF A;  5K8O A;  3IIB A;  3PB7 X;  3KR4 A;  4YN3 A;  4P4I A;  4C8A A;  4UEF A;  3CPA A;  4DUK A;  1OBR A;  4MHP A;  3NH8 A;  1CP6 A;  3WC5 A;  1FNO A;  5D8N A;  1NSA A;  4PXD A;  3H8E A;  1ZG8 A;  5HVG A;  3KHZ A;  3IFE A;  3KL9 A;  1ZG9 A;  4IK2 A;  4UF4 A;  3BI1 A;  4YU9 A;  5D29 A;  3IC1 A;  4MHN A;  4P6Y A;  1F2O A;  2PJ3 A;  1Y9Z A;  4TWE A;  5DS0 A;  2HC9 A;  3WC7 A;  3B3V A;  4KNG E;  1ZLI A;  1Y0Y A;  2ANP A;  2C1C A;  4C9V A;  2JBJ A;  1CPS A;  3B3W A;  2O4H A;  5THW A;  4C9R A;  5LRJ A;  4UEE A;  3D66 A;  4OID A;  5ELY A;  2PJ9 A;  3V7Z A;  4FUU A;  3S9N A;  1EE3 P;  4NGR A;  1IY7 A;  6CPA A;  3JRU A;  1JQG A;  2PJ4 A;  2Q43 A;  2GP4 A;  2AFX A;  3GB0 A;  4TJX A;  4K3N A;  3ISX A;  3HLP A;  3BI0 A;  2PJ8 A;  4ZX9 A;  2V8D A;  2PJ1 A;  4OC0 A;  2JBK A;  4Q7A A;  2WYR A;  1V6C A;  4A37 A;  1TF8 A;  1CP7 A;  4MCR A;  3KQX A;  1VHE A;  3NH5 A;  3SI1 A;  4C9U A;  3CPX A;  3D7H A;  3SJF A;  2ZEF A;  2ZEG A;  1XMB A;  3MRU A;  5CPA A;  4NGP A;  5LRK A;  1YW4 A;  2PCU A;  5LYF A;  4ZX8 A;  1HDU A;  2NSM A;  4NGS A;  2NYQ A;  4EWT A;  4NJQ A;  4P4B A;  4WWV A;  4C8U A;  3FMC A;  3D7G A;  4Z65 A;  3I74 A;  2C6P A;  1TXR A;  2HB6 A;  2C6C A;  2IJZ A;  3RBU A;  2V77 A;  2XEJ A;  3PFO A;  3V38 A;  3QNV A;  3KZW A;  3I1U A;  4OP4 A;  4IAV A;  2BCO A;  3CT9 A;  1UWY A;  3PBB A;  3GLJ A;  4X8I A;  3BHX A;  3VH9 A;  4OC5 A;  2ABZ A;  1F57 A;  4PQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...