4NH3A

Structure of human dicer platform-paz-connector helix cassette in complex with 13-mer sirna having 5'-pu and uu-3' ends (2.6 angstrom resolution)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
298
structure length
268
Chain Sequence
QPCYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFGILTAKPIPQIPHFPVYTRSGEVTISIELAASGFMLSLQMLELITRLHQYIFSHILRLYCVLPLNVVTLDIDFKFMEDIEKSEARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLHC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endoribonuclease Dicer
publication title A Phosphate-Binding Pocket within the Platform-PAZ-Connector Helix Cassette of Human Dicer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/rna
total genus 62
structure length 268
sequence length 298
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2013-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02170 PAZ PAZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.260.10 Mainly Beta Beta Complex paz domain paz domain 4nh3A02
1R6ZA 4NH5A 4NHAA 4W5OA 4NH6A 4Z4EA 4NH3A 4NGBA 4NGGA 3QIRA 5KI6A 4NGDA 4KRFA 2FFLA 3O3IX 4KREA 5JS2A 4Z4HA 1VYNA 3O6EX 1SI3A 4W5NA 2L5DA 4F3TA 4W5TA 4W5QA 2XFMA 1T2SA 4Z4GA 1R4KA 5JS1A 1T2RA 4OLBA 1SI2A 4NGFA 4Z4IA 4OLAA 3O7VX 4Z4CA 3O7XA 5T7BA 4W5RA 2QVWA 4NGCA 4Z4FA 2L5CA 3MJ0A
chains in the Genus database with same CATH superfamily
1R6ZA 3DA5A 3U1UA 4NH5A 4NHAA 4W5OA 4NH6A 4Z4EA 4NH3A 4NGBA 3DLHA 3F73A 4NGGA 1U04A 1Z26A 3QIRA 5KI6A 4NGDA 4KRFA 2FFLA 3O3IX 4KREA 1Z25A 5JS2A 4Z4HA 1VYNA 4L1PA 3O6EX 1SI3A 3DLBA 2L5DA 4W5NA 4F3TA 2BZEA 4W5QA 4W5TA 2XFMA 3HM9A 1T2SA 4Z4GA 1R4KA 3HO1A 5JS1A 1T2RA 3HVRA 4OLBA 1SI2A 4NGFA 4Z4IA 4OLAA 3O7VX 4Z4CA 2DB9A 3O7XA 5T7BA 4W5RA 3HK2A 4L1UA 2QVWA 4NGCA 4Z4FA 2L5CA 3MJ0A 3HJFA
chains in the Genus database with same CATH topology
1R6ZA 3DA5A 3U1UA 4NH5A 4NHAA 4W5OA 4NH6A 4Z4EA 4NH3A 4NGBA 3DLHA 3F73A 4NGGA 1U04A 1Z26A 3QIRA 5KI6A 4NGDA 4KRFA 2FFLA 3O3IX 4KREA 1Z25A 5JS2A 4Z4HA 1VYNA 4L1PA 3O6EX 1SI3A 3DLBA 2L5DA 4W5NA 4F3TA 2BZEA 4W5QA 4W5TA 2XFMA 3HM9A 1T2SA 4Z4GA 1R4KA 3HO1A 5JS1A 1T2RA 3HVRA 4OLBA 1SI2A 4NGFA 4Z4IA 4OLAA 3O7VX 4Z4CA 2DB9A 3O7XA 5T7BA 4W5RA 3HK2A 4L1UA 2QVWA 4NGCA 4Z4FA 2L5CA 3MJ0A 3HJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R6Z A;  4NH5 A;  4NHA A;  4W5O A;  4NH6 A;  4Z4E A;  4NH3 A;  4NGB A;  4NGG A;  3QIR A;  5KI6 A;  4NGD A;  4KRF A;  2FFL A;  3O3I X;  4KRE A;  5JS2 A;  4Z4H A;  1VYN A;  3O6E X;  1SI3 A;  4W5N A;  2L5D A;  4F3T A;  4W5T A;  4W5Q A;  2XFM A;  1T2S A;  4Z4G A;  1R4K A;  5JS1 A;  1T2R A;  4OLB A;  1SI2 A;  4NGF A;  4Z4I A;  4OLA A;  3O7V X;  4Z4C A;  3O7X A;  5T7B A;  4W5R A;  2QVW A;  4NGC A;  4Z4F A;  2L5C A;  3MJ0 A; 
#chains in the Genus database with same CATH topology
 1R6Z A;  3DA5 A;  3U1U A;  4NH5 A;  4NHA A;  4W5O A;  4NH6 A;  4Z4E A;  4NH3 A;  4NGB A;  3DLH A;  3F73 A;  4NGG A;  1U04 A;  1Z26 A;  3QIR A;  5KI6 A;  4NGD A;  4KRF A;  2FFL A;  3O3I X;  4KRE A;  1Z25 A;  5JS2 A;  4Z4H A;  1VYN A;  4L1P A;  3O6E X;  1SI3 A;  3DLB A;  2L5D A;  4W5N A;  4F3T A;  2BZE A;  4W5Q A;  4W5T A;  2XFM A;  3HM9 A;  1T2S A;  4Z4G A;  1R4K A;  3HO1 A;  5JS1 A;  1T2R A;  3HVR A;  4OLB A;  1SI2 A;  4NGF A;  4Z4I A;  4OLA A;  3O7V X;  4Z4C A;  2DB9 A;  3O7X A;  5T7B A;  4W5R A;  3HK2 A;  4L1U A;  2QVW A;  4NGC A;  4Z4F A;  2L5C A;  3MJ0 A;  3HJF A; 
#chains in the Genus database with same CATH homology
 1R6Z A;  3DA5 A;  3U1U A;  4NH5 A;  4NHA A;  4W5O A;  4NH6 A;  4Z4E A;  4NH3 A;  4NGB A;  3DLH A;  3F73 A;  4NGG A;  1U04 A;  1Z26 A;  3QIR A;  5KI6 A;  4NGD A;  4KRF A;  2FFL A;  3O3I X;  4KRE A;  1Z25 A;  5JS2 A;  4Z4H A;  1VYN A;  4L1P A;  3O6E X;  1SI3 A;  3DLB A;  2L5D A;  4W5N A;  4F3T A;  2BZE A;  4W5Q A;  4W5T A;  2XFM A;  3HM9 A;  1T2S A;  4Z4G A;  1R4K A;  3HO1 A;  5JS1 A;  1T2R A;  3HVR A;  4OLB A;  1SI2 A;  4NGF A;  4Z4I A;  4OLA A;  3O7V X;  4Z4C A;  2DB9 A;  3O7X A;  5T7B A;  4W5R A;  3HK2 A;  4L1U A;  2QVW A;  4NGC A;  4Z4F A;  2L5C A;  3MJ0 A;  3HJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...