4NH4A

Structure of the binary complex of a zingiber officinale double bond reductase in complex with nadp
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
352
structure length
352
Chain Sequence
VVVVNKQVLLKHFIPEGAPKETDMELVTTGTIRLRVPEGSNAVLLKNLYLSCDPYMRMRMTKHEEASYVDDFVPGAPITGFGVGKVVDSSHPDFKTGDYVWGLIGWEEYSLITKPQGLFKIHHTEIPLSYYTGILGMVGLTAYVGFYDICSPKKGERVFVSAAAGAVGQIVGQFAKQFGCYVVGSAGSDEKVNLLKTKFGFDEAFNYKKEPDLTKALKRYFPEGIDIYFENVGGPMLEAVLHNMRIKGRIAACGMISQYNLEKPEGVHNLFLIVGKRIRLEGFLVFDHYGSYPEFEEKVVQLIKEEKIKYLEDIVEGLENAPAALIGLFEGRNVGKQVVVVSREKGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of zingiber officinale double bond reductase
rcsb
source organism Zingiber officinale
molecule tags Plant protein
molecule keywords Zingiber officinale double bond reductase
total genus 117
structure length 352
sequence length 352
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF16884 ADH_N_2 N-terminal domain of oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4nh4A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4nh4A01
3IS3A 1V0JA 3AFNA 4II2A 1YDEA 1I3LA 2GSDA 1Q7CA 2EGHA 1PJSA 1XDWA 1FK8A 1BVRA 5C7LO 3M2TA 4XZ3A 2EEZA 4L0QA 2PH3A 4K6CA 5BT9A 4XR9A 3MJEA 1PJTA 3PXXA 4AJPA 4BMSA 3TZKA 2FR0A 3ZU4A 1LRLA 3U3XA 3SX2A 4K26A 2B0JA 4IJWA 1IOLA 1XG5A 3WQQA 1Y6JA 5AXAA 4LGVA 4RQUA 1EVIA 4CM8B 5A04A 4IIVA 4UVDA 1P31A 2VHYA 4GVLA 4D3DA 4C4OA 3HB4X 2QYTA 1BG6A 3GEDA 1C1DB 2A92A 1HYEA 2OBYA 1K6IA 4R9RA 5DCUA 1ISIA 1E3WB 3AWDA 4W9NC 1W4ZA 3QW2A 4PLWA 2ZTUA 5L4LA 3EZYA 3LT4A 1WDMA 1MXFA 3L6OO 1YBAA 2VYND 3GF4A 1HEUA 4JLWA 3DHNA 1LTHR 1O9BA 2Z1NA 3RC1A 2ZYDA 3WSVA 3CTMA 1DJNA 1KBZA 5T5QA 4MP8A 1A71A 4O0LA 2JFGA 1YH3A 1GFSA 1NX6A 2JJYA 1AE1A 2J3KA 3GMSA 4U6QA 3VOSA 4HFMA 4H3VA 5JCXA 1V3UA 3HDYA 5L45A 5MGBA 5I7VA 1G0NA 4DRYA 1IYZA 4WLFA 2BGMA 4NJMA 4ND2A 3ZNNA 4Z0PA 1TVEA 5JDCA 2Q4EA 5FI5A 4TZKA 3WSWA 4WJZA 1R37A 1DO8A 3FSRA 7MDHA 4AJJA 4B79A 5B4VA 3VH4A 3UN1A 2C0CA 2BRUA 2OFPA 4U8GA 3WX0A 3AI2A 1E7SA 4F45A 2C5AA 2RBEA 1LDEA 3ZWXA 2W2LA 2QG4A 4I8XA 1ENOA 4NBWA 5KJFA 1PJ3A 3B1FA 3D5TA 4ZJUA 4D0SA 3KYBA 5JDCC 2OORA 3OSUA 3H9JA 5DBGA 2JD1A 2B5VA 2VUUA 1EK5A 5I7SA 3GRPA 5ADHA 1IHXA 3ROKA 1S6YA 3DZIA 3WTBA 3ZW8A 4CL3A 4J0EA 1NAIA 3EZLA 3PIDA 1YBVA 3WS7A 1Y8QA 3HQ4O 4UEOA 1K2WA 2PGLA 3K2BA 8LDHA 1DAOA 3AM3A 5KOIA 4RVUA 1NHGA 4QTZA 4UULA 3OP4A 3UHAA 5CG2A 4OHUA 2AHRA 2GLXA 4TRMA 2C7VA 1EMDA 4EBFA 9LDTA 3GVHA 3JCZA 3LLSA 1UXIA 3U4IA 2OBNA 2DPGA 3PDJA 3NYWA 3L4BA 1NWCA 4UVEA 5I7FA 1YGYA 1DOHA 1TEHA 3SJ7A 5BSFA 3OJLA 3C1TA 4YCAA 5I9NA 2Z95A 2WYUA 3ZV5A 4IZIA 3JV7A 4CMIA 1GZ6A 3NJ8A 1SMKA 3VPHA 1N2SA 1W6UA 2NU7A 5L7TA 1H6DA 3VZPA 2DAPA 1HDYA 2GNAA 4LK3A 2QRLA 3OEYA 4WCFA 1ZK2A 4BKRA 4D3FA 4DA9A 2P5YA 2YV1A 3QV1A 4P4NA 1RYDA 4P8RA 1HLPA 1D4FA 1NNUA 1F14A 1GDHA 4XDZA 4XQCA 3FF4A 2HJRA 4PVDA 4RF2A 1YB4A 3DOJA 2NTVA 5TF4A 3WYCA 3S8MA 2Q2QA 2YY7A 2WD7A 4JNKA 1X1EA 4EEXA 3NT4A 1NP3A 2DBRA 4Q3EA 5A9TA 1XCBA 5AOVA 2OXIA 1G6KA 3P7MA 4LW8A 1I3NA 2VHXA 3VTZA 4JGBA 3PHGA 1XA0A 4HP8A 2ZYGA 3D4OA 1ONNA 4NHEA 4HFNA 1YL5A 1VL6A 4R5HA 1Z75A 3DZBA 4W7HA 4EDFA 3HN2A 2HCTA 2PZMA 4IQGA 2VQ3A 3A1NA 5C7OO 3FPCA 4UVGA 3B20A 4ZHSA 4IJKA 1DC5A 2W2KB 5T8KA 1ZK4A 3S2EA 4RLSA 1PL8A 5TJHA 3JYPA 3DZKA 1UP7A 3OA2A 4QSMA 4BKOA 1A72A 2P9GA 4J3FA 1T1SA 5AXDA 1Q7GA 1N9GA 3ZHZA 4CM9D 2W90A 4Z9FA 5ER6A 4HWKA 3AY7A 3GDOA 3IC5A 2B69A 4WKGA 3GGOA 3QVOA 4BO9A 4BNZA 2X23A 1Q7BA 2OOSA 1C0PA 6ADHA 4CM4A 4RGBA 4ZQBA 4EJ0A 2OP0A 2Y05A 1WXDA 3V2GA 4N7RA 2GCGA 4BNUA 2ZIZA 5EN4A 1UXGA 3QVWA 3F4LA 4DQUA 4BNTA 4NBTA 5EPOA 1BSVA 1ISFA 3RFXA 3KUXA 4W99A 1WMAA 1Y8RB 2D2IA 1RM0A 2P91A 4M49A 5KKCA 3NTQA 3UGKA 5FYDA 3EUWA 4GGPA 2CF5A 5TT1A 3E1KA 3ANLA 4A7PA 5G0VA 2BFOA 4MIOA 1Q0QA 3ANNA 4R4JA 2CFCA 1CQJA 1PL7A 3BTVA 4O63O 1C0IA 3VHRA 4DIFA 4CMKA 3U4CA 1T4DA 1BXKA 1PX0A 1I0ZA 3A06A 4Y98A 4CMJA 1LQTA 1GL3A 1LDMA 2RH8A 2Q2WA 1GUYA 2ZJ0A 3VDQA 4XIYA 4XR4A 5A03A 2O7QA 5J23A 2PKQO 4UAGA 4OOEA 1LNQA 4P38A 1ISMA 4BIIA 3SLKA 3VVBA 2GF2A 1TT5A 4GSKA 4EJ6A 3KLMX 1O5IA 5DN9A 3JQ6A 3PQFA 3WGIA 1ZEMA 4FQ8A 3A28A 4QECA 1YB5A 1VJ0A 2O3TA 5DOVA 4UREA 5DULA 4MVJE 3PWZA 1KEWA 1NVGA 4FPXA 1NFQA 2J3JA 2WM3A 1DC4A 3GHYA 4JROA 4TMFA 4J4HA 2YFQA 1B0AA 3DXFA 4H16A 1QKIA 3ZWWA 3HHPA 1W73A 2JD0A 3GN2A 4M55A 2DU8A 3DZJA 4RF5A 5ITVA 2EP7A 2GR9A 2Y66A 1ZSVA 1QYXA 4J1QA 3W4IA 3QLJA 4IM7A 2FPIA 2IZZA 5JSFA 4RZIA 4IDDA 2Y93A 1YRLA 1E1KA 1R0LA 1E6WA 4XQGA 4O59O 4TKLA 4H15A 3NDRA 2Q4BA 1T1RA 3RUDA 1ZO8A 4Q3AA 4Y6RA 1PWZA 1PS0A 1CEQA 1BW9A 3C7CB 1FDWA 2X5OA 4ZA2A 4HNHA 3HG7A 3QVXA 3UF0A 3ZWNA 4L9RA 3E18A 1W0CA 1BXGA 1DBVO 4I5FA 2Y1FA 5IN5A 4KMSA 2Y0CA 4YXFA 4XRRA 3U5TA 1MFPA 3GNQA 4RPGA 2PD3A 4CMAA 3PP8A 3EK2A 2TMDA 3PQEA 4M86A 1OC4A 4BB5A 5MDHA 3BMOB 2D8AA 1CYDA 3W8DA 4AJLA 4BO8A 3A4VA 3OQBA 1E3LA 4DLAA 5IDXA 1LDGA 3WWYA 2AG8A 1PEDA 4BUCA 3VC7A 4NG5A 4NU6A 3H9QA 3QWFA 4YAEA 1H6BA 5HBRA 4MVJG 3WGYA 3FNFA 4A27A 2W2KA 3V5NA 1HXHA 1I36A 3DMTA 1Z82A 1M6HA 1ZFNA 3O03A 5CDYA 2C5EA 2HJSA 4R3WA 4Z9XA 3VH3A 5B4TA 3GLQA 1R0SA 2OMEA 3LC2O 3ZN2A 4LISA 3L07A 3PGXA 4HBGA 3SLGA 1JWAB 1EUZA 4DWVA 3FPLA 2EGGA 4IDCA 4FN4A 3IOYA 1IULA 4NFYA 4ALJA 2P2SA 2HLPA 2XF8A 2AQKA 2VNAA 4GX1A 2VHZA 4CM6A 4IDGA 4QUKA 2PGJA 2GZ1A 3ABIA 2WE7A 3WFJA 3GY0A 3QIVA 5T8KC 2EJVA 5ER9A 1P1RA 5A02A 4PLGA 4YTEA 2OGUA 3HFSA 4J6FA 3ZU5A 4OGWA 1DIGA 1FXSA 3I23A 5F5LA 4EW6A 4GMFA 3CMCO 1FDSA 3IJRA 1VE9A 1RJWA 4R5MA 3K30A 3NT5A 4MJLA 1MA0A 3GGGA 3FHLA 2HUNA 2BGKA 2V6BA 4JJFA 1U28A 2I5PO 4J7UA 1Y9EA 4R69A 5JMPA 4J49A 1E5QA 2PGDA 3H5RA 1RYEA 4M89A 1XYGA 4URFA 2B4TO 1PJ4A 1Q2XA 3NUGA 4BQRA 1MXHA 2EHDA 4PLYA 4BNGA 4PIVA 4CODB 4Z0TA 4E2XA 4CLDA 5JFOA 1VJTA 4CLXA 5IAAA 4AJEA 1FMCA 3OH8A 4AL4A 1F17A 1PJCA 1B3RA 3AI3A 1DC6A 2E6UX 3LU1A 2BFPA 5F3RA 3ZV3A 3NGXA 4DGSA 1JAYA 2Q1SA 3JQ9A 4L74A 3S55A 4OQYA 4KWHA 1LRJA 3DHYA 3GDGA 3I9LA 4KTVE 3KM0A 4QO7A 2EG9A 4CQLB 2J8ZA 5DDIP 3PRJA 1RM5A 1WPQA 4JP2A 1X0VA 5C37A 1QXSA 1RM4A 5GY7A 4WNCA 1X7GA 2FR1A 3KSUA 4R1UA 3D7LA 2NLOA 3PYLA 1IPFA 1B15A 1HDZA 4OXNA 2YYYA 3GVIA 4YA6A 1PSDA 3ZNQA 4RF4A 1BDMA 3AUTA 4E30A 3RC7A 4PG5A 1QORA 3JQ9C 4CPDA 1UDBA 3PQDA 4J1SA 4MP6A 1ZIDA 3PJDA 1PS9A 2EKQA 2WE8A 4PZCA 4CQLA 2C29D 3VAZA 3GQVA 5JYEA 5JCJD 3DR3A 4MVJI 4E5MA 4X54A 5C7IO 3HE3A 3V8BA 4AG3A 5FWNA 1B8VA 4ALLA 1JN0A 4PLZA 5T57A 3TZHA 2G1UA 3WFIA 2Y1EA 5KCZA 3KV3O 3MJSA 4J0FA 2GD1O 3C7DB 4FFPA 2X7HA 3NTOA 5A3VA 1CERA 4WCDA 1T2FA 4OSOA 3RBXA 1PJQA 4YT5A 1E3SA 1DC3A 1XQ1A 3RROA 1UXJA 3PEFA 4FSHA 3RJ9A 1Q0LA 1N7HA 5CEJA 1E7WA 1C1XB 1HL3A 4B8WA 3KO8A 1HF3A 1HRDA 1V6AA 4MIEA 1GPDG 2B4QA 3ST7A 1QYWA 4IIUA 1XHLA 1ZK3A 1ZH8A 3E82A 2Q50A 1Y8QB 1I8TA 1C1DA 3G1TA 2P5UA 3BMOA 5G4KB 3C85A 4RZHA 3PGJA 3VPXA 1KVUA 5JDIA 2WTBA 4ILKA 4YAKA 4Y6PA 2O3QA 1F0YA 4IINA 4CMBA 4PCVA 5JW6A 3NV9A 6LDHA 3MWDB 2R00A 2OO5A 5DBFA 4FFMA 3ICCA 2GYYA 2PZJA 4GWGA 1GQQA 1ZK1A 5I9LA 4Y8VA 4J7XA 5JPIA 4F46A 4DYDA 5HM8A 3AOEA 4RDIA 3ZWCA 3HWRA 4J16A 1A9YA 2FHSA 3JD2A 3W1VA 4TVBA 1O95A 4DMMA 1LDBA 3CH6A 5JDIC 1DXYA 2E37A 1LLUA 3JYLA 4TRJA 1KYQA 2XAAA 4Z9YA 2CNBA 3B1JA 4WNIA 2IODA 2R00C 3KXDA 4NJMB 2HKIA 1L1FA 4GLOA 3AUSA 1Y7TA 1LEHA 4NI5A 1B8PA 3L4BC 5KVCA 3GH3A 2GO1A 3JQCA 2ZCVA 4M54A 5L51A 4QEDA 1ISHA 3ROPA 3RU9A 5JE8A 4CL8A 5LC1A 4FOOA 1EK6A 1I24A 3ZNPA 2J3HA 2VYVD 3JQBA 2Q2VA 3IUPA 1XWFA 2YQ5A 1F12A 4OL9A 1PZEA 4EZBA 1J5PA 1IZ0A 3CIFA 2UV8A 4XYLA 1D3AA 3DTTA 4BGUA 1NR1A 2LDBA 1PQPA 2IXAA 1TT5B 1HE4A 3FWNA 4B7XA 1PQWA 2E4AA 2QW8A 5L4SA 1BRMA 4YDRA 2EP5A 3QVTA 1KY4A 1YOVB 4NJOA 4R68A 4RCVA 3TFOA 4NDNE 4IY1A 4CM9A 3I4CA 3JSAA 5H83A 2DUUA 4LRTB 5DP2A 1HSOA 4L4RA 3RIHA 1I33A 2JCYA 5TGDA 3CMMA 5EQDA 1LLCA 1T24A 1NWHA 4FJ0A 5DNAA 1XKQA 2I3AA 4CM3A 4E33A 5H82A 3GVPA 1V35A 4BNYA 3JYQA 2A94A 4NQZA 1XLTA 1W8DA 4RVSA 3JQAD 4JBHA 2PZLA 1ZJZA 4CM7A 1GD1O 1QR6A 3IKTA 3DOOA 2DFVA 2F00A 4RPKA 4KQXA 2AEFA 3JQGA 3GAZA 2TMGA 2X9VA 5TJ9A 4BNNA 1LU9A 2JKVA 2JCVA 3RU7A 4CM1A 2EW8A 3JQFA 5BNIA 1A5ZA 4E5NA 1J0XO 4XJSA 4BHTA 3DZGA 3ZHXA 3AY3A 4LN1A 3BHJA 2H9IA 3PYMA 3V2HA 1PJBA 1H2HA 4YWJA 4CLHA 1E7QA 4PLHA 1WAMA 1I2BA 2J6IA 4BO2A 1NQ5A 1UAYA 5U4QA 4CQMB 5IZCC 1NBOA 3AU9A 3D64A 4DREA 1Z7BA 4HKTA 5A05A 3OICA 1WMBA 4ND3A 5JAMA 1VC2A 1VRWA 2CZCA 4BNXA 1BDBA 3BAZA 3GEGA 4CM4B 4NK5A 3S1LA 2B83A 3CUKA 3G79A 3GK3A 2YHIB 3A9WA 3RUHA 1O94A 4RPHA 3I9JA 3F47A 3VKVA 1YQGA 1B2LA 1EE2A 3IKVA 3R0IA 5JMWA 2CSUA 3GEMA 1HE3A 3ITDA 3PHIA 2DBZA 4L4XA 2CVQA 1ZSNA 2SCUA 1G1AA 3TZCA 2PH5A 5KNLA 3BMQA 1PGJA 4CMHA 2O3JA 2I9PA 2J5QA 4E21A 2AE2A 2FR8A 3H9GA 3OEWA 5L95A 2J5RA 2GN4A 3W6UA 3AW9A 2YHUA 3S2IA 3DBLB 1DIRA 2RHRA 3GPIA 4XDYA 1O6ZA 4CUZA 1T2DA 2HU2A 3PK0A 1GU7A 3QJ5A 1H5QA 1VKOA 1U2DA 1VJ1A 2WD7B 4L76A 3TZ6A 3UAGA 1PGOA 3H8VA 4PLTA 3U62A 2VWHA 3EVTA 3VZRA 1D1TA 4B4UA 3LT2A 5TRTA 2NTNA 1R15A 4CR7A 2FRDA 2X0NA 1PQUA 3ZWAA 1P0FA 2VZ8A 3ZW9A 2GPTA 4KUGA 4XIJA 2ZTLA 3WGTA 4LMRA 3WGZA 3PWSA 2AQ8A 4HX5A 5DP1A 1XQ6A 4MVJF 3NT2A 4HFRA 4YT4A 2EKLA 3PZRA 3Q2KA 5K9ZA 4LMPA 3RBZA 4BS9A 1ONPA 1XSEA 2I67A 1FDVA 3KSZO 4GLLA 5B4UA 4L8VA 2D1YA 1LQUA 1PR9A 4WASA 4JXKA 5G0UA 4R1TA 4Y6SA 3S2FA 3PLRA 1VI2A 4L4SA 1P74A 4EJMA 2RHCA 2ZTMA 4WLOA 1KEPA 4FFRA 1KVQA 1LDYA 2B4RO 2NV6A 2C2YA 4U6SA 4CMGA 2YUTA 4FC6A 3Q0EA 1BTOA 4BNLA 4BNMA 4R9SA 3ONDA 4AJIA 1ADBA 1M2WA 2Q1TA 4BKQA 2ZQZA 3QRWA 4A03A 3GA0A 2Y1CA 3W6ZA 3BMNB 1F8FA 3OMLA 1YO6A 1GZ3A 1LBEA 3E9MA 1UP4A 4NU5A 1PS8A 4N5LA 5KJ1A 3MOGA 1XGKA 2Y1GA 2PTGA 2X0RA 2HK8A 2JFHA 2UDPA 1YKFA 2CDAA 1LC0A 2WD8A 4GH5A 5FF9A 4MPDA 1PGPA 3AUUA 3JD4A 4BV9A 3ZV6A 4CJXA 2HRBA 4XGNA 3WLEA 4YBZA 4CMCA 5C3MA 1MFZA 4NPCA 2DTXA 2JFFA 3Q1LA 4AJ1A 2NU9A 1ULSA 1NR7A 5K6AA 3MEQA 5HWSA 1NTOA 4XB1A 2ET6A 2CD9A 3K31A 4K9DA 4A26A 4AJ2A 3RVDA 3SVTA 4R3NA 3FNHA 1GQYA 3UH1A 1UAGA 3GC6A 2D59A 1ZJYA 3ZH2A 3MZ0A 1ARZA 2G5CA 2A4KA 2UUOA 3BA1A 1TXGA 1MUUA 5K6AC 3PHLA 4FOSA 4MP3A 1H0KA 1XU9A 2X5JO 1E3WA 5GZ3A 3JD0A 4FJ2A 4K1LA 3AU8A 1KVSA 3CSDA 2NWQA 3JQEA 4M87A 4DXHA 3NJ4A 5G0TA 2IZ0A 2V65A 1EVJA 4LSWA 3TWOA 4R54A 1KIFA 3FCOA 3E03A 4CM8A 1J49A 1WLYA 3MJTA 3RKRA 5F1PA 2C54A 4AVYA 4J43A 1R6DA 4PLPA 1H93A 1EDZA 3TQHA 3OECA 2XXBA 5JCJA 1GV1A 5L9AA 3RC2A 5F1KA 2BI8A 5THQA 1KERA 2FWMX 4MKXA 1HLDA 3AM4A 5EMHA 1E3IA 3OJOA 4XA8A 5F21A 3KYCA 2PLAA 5HS6A 1HDXA 2GRAA 2IXBA 4NMHA 2HQ1A 2VWGA 5A9RA 1U4OA 5TIIA 3ZNOA 4DBZA 3G17A 1Z7EA 4PRLA 1DFGA 4XCVA 3PIIA 2JAHA 2LDXA 3D5QA 4I1IA 1GEEA 1T2CA 3ONEA 3TRIA 3AI1A 2DUWA 1YE3A 2VOEA 3DDNA 1GUFA 1LUAA 3PTZA 4OMUA 4RVFA 3F1LA 4EGFA 2AQHA 4XGKA 1SBYA 2YV3A 3ETGA 2GN6A 3OIFA 1GUZA 1LRKA 3W8EA 5I9MA 4NFSA 4IQ0A 3NRCA 4WLUA 4AJ4A 4KTTE 3BXXA 4IGEA 3LLVA 1QLJA 1R12A 2R6JA 3GGPA 3FI9A 1Z73A 1DLIA 2VTDA 5JC1A 4EITA 3KB6A 3INGA 5A1TA 1LSJA 3TSCA 1AHIA 4AJHA 3ROQA 5IXSA 3SBOA 2WJPA 4P4LA 4QT0A 4B3HA 2GN9A 1PJLA 1YVEI 2G76A 4HFJA 2IZ1A 3BIOA 3GHHA 4ZGWA 3GVCA 4PN3A 2X8LA 2B37A 3QWBA 4OYRA 1WP4A 4FB5A 1QYDA 5IJZA 2WDZA 4Q39A 1U5CA 1QYVA 5JC8A 3TPCA 5CPFA 4B4OA 3S2GA 3DBHB 4A0SA 1EZ4A 1LXCA 1P1FA 4YJGB 4IBOA 4S3MA 3JD3A 1YXMA 2I76A 1ONOA 4NH4A 1UXHA 3WBBA 4YACA 3D4NA 1HDOA 3STHA 3O8QB 3D3EA 2J3IA 4FBGA 4B8ZA 2AW5A 1L7EA 4HNGA 3ZU3A 4YT2A 4E31A 3D0OA 4OIMA 4CLRB 4R01A 1E5LA 2C82A 3BMCB 2E48A 2IRWA 1ISGA 4G81A 5KVVA 4ROSA 4WLVA 3GFBA 4GL4A 1E6EA 1I10A 2GDZA 4KDEA 3PHJA 2FSSA 4AFNA 5A5FA 1SOWA 3DL2A 3DHEA 3HB5X 1U2GA 2ZK7A 2ILTA 5EQFA 1HETA 3UVEA 4ZQFA 4BNKA 2Y0DA 3D4PA 1B16A 3ZCXA 2AQIA 1EEHA 1U7TA 4BNVA 4ID9A 1P1HA 3L9XA 4E32A 1ZW1A 3CXRA 3QHAA 3JYNA 1C0KA 1E3JA 2DTDA 2X86A 3KYDB 2EWMA 3L6EA 4FW8A 2X6TA 2NSDA 2UAGA 3TFQA 2BD0A 4TSKA 1ENPA 3MTJA 2CUKA 3M6IA 1LSSA 4GBJA 3F1KA 3FRJA 3M2PA 3FNEA 3D3WB 3UOGA 1MV8A 3I1JA 3V2UA 4BO0A 2CVOA 5K1SA 3P19A 3H2ZA 4D41A 4YPOA 3LC7O 4BB6A 4ZQGA 2ZATA 1BXZA 2XPCA 1LC3A 3LT0A 1ADCA 3QQPA 4XYGA 4Q3BA 4IQ8A 1NFRA 2D5AA 3U0BA 3U09A 4D45A 1U3VA 4J90A 2Y67A 4YYZA 2VNSA 3GZNA 5T6BA 4BO4A 3VVCA 2OHXA 1LI4A 1YL6A 4U0JA 2C20A 2YW9A 1OAAA 1WWKA 5FFFA 3VZSA 3O4RA 1RM3A 1G0OA 4FFOA 5JS6A 3OHSX 4D3SA 2GGSA 3ASUA 2YDYA 2IEBA 1K89A 3VH2A 3WNVA 3RCBA 1YDWA 1IPEA 4AJNA 4J1NA 1R4NA 4IGFA 4WECA 5KKAA 5BSEA 2YJZA 4PG4A 3GN1A 4YVFA 1PZHA 2AMFA 5IDYA 3WOHA 3DQPA 1P1KA 1BHSA 4FCCA 4E6PA 1EVYA 1JVBA 3IMFA 3JQ8B 4GGOA 4YR9A 2YFHA 3DC2A 1WDLA 1YJ8A 2H6EA 3HDQA 4IPTA 3P2OA 2VN8A 1DIBA 3GAFA 3GPDG 3T7CA 2O3RA 2FMUA 3GUCA 1U7HA 1SPXA 1FJHA 3LF1A 2POQX 2AXQA 4KWIA 4CUKA 2YQ4A 1YL7A 1VL0A 3BTSA 4JBGA 1E1LA 1FF9A 1K5HA 4TKMA 2VUTA 2ZCUA 3VDRA 2O3SA 3AFMA 3NEPX 3X2FA 3U4HA 3RWBA 2ZJ1A 4JBIA 1N92A 1P77A 2DLDA 4NR0A 3C1OA 3PPIA 2XXJA 5CG1A 2CF6A 1P33A 1LJ8A 4IZHA 2V6GA 4KUEA 2O4UX 4FC7A 2P9EA 1JKIA 1EBUA 4Q3NA 5JY1A 1H9BA 4DUPA 4L73A 1DLJA 1ML3A 4J7CA 3WG9A 4ZRNA 3O38A 5JXWA 2C7GA 4PG8A 4EUHA 1XELA 1R4NB 4GX5A 4YT8A 2HDHA 1YQDA 1SAYA 3Q3CA 3MJCA 4FGWA 3TF5A 1BVUA 3GVXA 2W98A 4U0KA 4W82A 4QO8A 1HZJA 3TZQA 3EGOA 2VCYA 3RI3A 1B26A 3B6ZA 1CIVA 1PR3A 3PZBA 3BMCA 5EIOA 3W8FA 3BHIA 4A2CA 4E2YA 4GI2A 4YB8A 3ULKA 1YBMA 2D4AA 1LSUA 1SZJG 2DVMA 1K3TA 4R41A 2C2XA 2I6TA 4WUVA 3TL3A 3NAQA 3KSDO 3UCXA 4IXTA 5TNXA 2FPGA 1F06A 2EV9A 3LDHA 1Y9AA 1CF2O 3EHEA 4OKNA 4TRNA 3ORFA 3ZDFA 1R4MB 3WIDA 3KTDA 4HADA 3ONFA 1XIVA 4WK6A 3IP1A 5EJ2A 4B7UA 4IDAA 4ZQEA 3TOXA 1UR5A 3E48A 3F3SA 4ALIA 4D43A 1Z6ZA 5DF1A 3K5PA 3DMTC 4QXMA 5I7EA 5IZ4A 1HT0A 3HUDA 3I9MA 2H5LA 1N1EA 3OQ1A 4WCFC 3VTFA 2AEJA 2QIOA 1H6CA 2OUIA 3WYEA 1ZCJA 3EAGA 2DM6A 2RH4A 4MVJH 1ZZEA 2DTEA 1KOLA 1GTMA 2A35A 5ICMA 5CDSA 3W4JA 3IP3A 3AM5A 1IL0A 2F1KA 2PKRA 4R16A 3JTMA 3DBRB 4MVJD 3GNTA 1Z45A 3ICPA 4YJHA 5ILGA 4D46A 2HMSA 3ENNA 5KIAA 1NVTA 3WYBA 4BL5A 5L40A 1HE2A 4QFDA 4HY3A 4Q3DA 3RUEA 4IJUA 1GR0A 2IYOA 4ZRMA 5IZCA 4A73A 1JKFA 2PKQP 3VPGA 2VUSA 4DQXA 1AN9A 5KVSA 3FNGA 5ICSA 1YS4A 2VYVA 4Z3KA 2W8ZA 4MIYA 3PLNA 1O8CA 2EIHA 2EKPA 4UUMA 5LDHA 5IXYA 4MINA 5F5NA 1B8UA 2VT3A 3INRA 2UYYA 3KLPX 4ND4A 1UP6A 3HNPA 2HMUA 2UVDA 4C7KA 1CWUA 4E5PA 3ASVA 1JW9B 1OBFO 1N5DA 1N8KA 3HDHA 2ZYAA 4OQZA 1ZXLA 4XEHA 3INTA 3QY9A 3IDSA 5JAIA 1ZXBA 1M66A 4G5HA 1WDKA 1U3WA 4FFLA 4N5MA 4FGSA 1D8AA 3H65A 3RUCA 3FBTA 1PZGA 5FEUA 4N18A 3MOIA 4PFJA 1E0DA 4DIOA 1C14A 1J6UA 3C8MA 4AICA 3Q11A 1DEHA 1I2CA 4WPGA 5COQA 4YAIA 3SC6A 1SNYA 1T25A 3GG2A 4GX0A 4EUEA 4E12A 3I5MA 4YJFB 5JY6A 3L77A 4A10A 2Q3EA 3IIEA 5B1YA 3C3XA 4IS3A 3U49A 1IE3A 5G4KA 5CFZA 1ID1A 1RPNA 1HWYA 4RVDA 2BF7A 3OIDA 3DB2A 2D5CA 1U8FO 5TT0A 4J1TA 3F46A 2QYSA 3Q9UA 4B4VA 1QV6A 1NPDA 4GAEA 5DT9A 2FZEA 3MWEB 3G49A 2G0TA 2CMDA 1Y81A 2W2LD 3N74A 2H1SA 3PHHA 1O89A 2HO5A 4J9UE 1NQAO 1JQBA 4RLHA 2AA3A 3PFFA 3WQSB 2V6MA 3WIEA 2PD6A 5JO9A 1KC3A 2IYPA 3ZWVA 1K6JA 4DMLA 3OJEA 4J4BA 3KYCB 5L3ZA 5CP8A 2BLLA 3VPSA 3OQ6A 2EF1A 2PWZA 5CDUA 2O23A 1R16A 1TLTA 4BO1A 2NUAA 1NAHA 4NFHA 3UXYA 4IXWA 3RASA 2GUGA 5DCYA 2FOIA 4YJFA 1GYRA 2FPPA 2X58A 4MKRA 2NU8A 4DL9A 2B35A 3I6QA 5ES3A 1GCUA 5CAEA 5IG2A 2JHFA 3DBVO 1WNTA 4AJKA 2FSVA 3DBLA 2Y1OA 3KEOA 2NQTA 3OFSA 1GEGA 2PZKA 2GERA 1OZAA 1P0CA 2V7PA 2WYVA 2O2YA 4P4GA 2HK9A 3WBFA 1FDUA 1A27A 1DRVA 4NNJA 1IZ9A 3PWKA 4PZEA 2NM0A 3VPFA 2P4QA 4P22A 2X9GA 4WLEA 4NBUA 2X0JA 4RORA 3RUFA 1PTJA 2VOJA 2RCYA 4GKBA 4I5GA 1RKXA 1M67A 3NDIA 3QWAA 4XYBA 5IF3A 1VPDA 1ZSYA 1X13A 4YAJA 2QX7A 3WICA 3M1AA 3AOEC 4JK3A 1O0SA 4XX0A 1SO8A 1A7KA 2H63A 2P4HX 2WMDA 4IMPA 1NPYA 3UUWA 3KHUA 1QSGA 5AVOA 4AJOA 1K6XA 1X0XA 4E2WA 4U5QA 4JX8A 4DPMA 1ZKMA 3RFTA 3EMKA 1YONA 4IJVA 4ZQHA 3Q9NA 3KOUA 2GZ3A 3K73O 4J2OA 4DC0A 4CLOA 4BKUA 4J91A 3EW7A 3ETDA 1TI7A 3WLFA 1ULUA 5AYVA 4XD2A 3DMYA 1X7DA 5JAZA 2OL4A 3JQGB 4WGGA 4S1VA 3CKYA 3T4XA 1H6AA 4BQPA 3OF2A 4J9VA 3V1YA 3PDUA 1KETA 1A7AA 1MLDA 5H81A 3GRKA 3GMDA 1CRWG 1CJCA 2AG5A 4K28A 5COAA 3IQDB 4BNHA 1C3VA 1H9AA 5G0SA 3SC4A 2VHVA 1A4UA 4FFNA 2DKNA 2Q1UA 1R66A 5BR7A 2VRCD 2GN8A 2XOXA 2ZB4A 1DHRA 1MG5A 2E82A 3H7AA 4CR6A 3TNLA 3HJAA 1E92A 1VKNA 3WWZA 3LYLA 2NVBA 4RQTA 3D1LA 1MGOA 1A4IA 1UZLA 3ITKA 5U9CA 4BKPA 4DPLA 4B7CA 1E6UA 1TA4A 4PRKA 4GVXA 4GX2A 3RD5A 4DPKA 4II3A 3ROMA 5A06A 4YQYA 5TLSA 5KWEA 1VM6A 4LRSB 4B3JA 3GR6A 4Q9NA 2O48X 4BMVA 2D3TA 4GSLA 5HRUA 3AOGA 1OOEA 1BXGB 3R1IA 3DFZA 1LSOA 1OI7A 3DTYA 4FR5A 2HMWA 4IMRA 1IHYA 3I4FA 3JD1A 4OAQA 3LF2A 2PFGA 3ZWMA 1N1GA 4BNFA 2BI7A 1PJ2A 2Y68A 4ESOA 2AE1A 2WSBA 3GOHA 4UVHA 2Q1WA 4FS3A 1HYGA 2I99A 7ADHA 1ZBQA 1IUKA 1VL8A 2VRCA 3ADOA 3UCEA 4MVJA 4Z3DA 1YB1A 2QHXA 1KY5A 3PFWO 1BMDA 2X4GA 4RO0A 2B36A 4ALNA 4IDEA 4I5EA 2VYNA 1HYHA 3ZGYA 5GZ6A 2DT5A 1SOVA 2EW2A 2ZTVA 1DJQA 1GAEO 3WR5A 1YOVA 3BTUA 4CV3A 1X15A 2YHIA 2WWRA 2X1HA 1PIWA 4MKZA 2CDCA 4DBVO 4BV8A 3ENKA 3GG9A 1L7DA 2CY0A 4BNIA 3I83A 1C0LA 2AEMA 4QX6A 2QZZA 4CQMD 3JQ8A 4IDFA 3PVZA 3MJVA 2I3GA 4LCJA 4UEKA 4B3IA 4GPD1 1E1NA 1K0UA 2HSDA 3COSA 1GADO 2E49A 1C1XA 4GQAA 1X7HA 5TX7A 3OJFA 4I9HA 3P2YA 4GWKA 3C1AA 4D7AA 4GKVA 4W7IA 4KZPA 3G0OA 3DAPA 5JO0A 4NK4A 1E7MA 2GZ2A 3E9QA 4WOKA 1ADGA 3UICA 4XQ9A 2NU6A 2NVUA 1PGNA 3PJGA 4PLVA 3HN7A 5AXBA 1LA2A 3WQRA 3ON5A 4TQGA 1ORRA 1CQIA 1VSUA 4B4WA 4Y67A 4CLRA 2PV7A 3QP9A 3R3JA 3T7EA 3SJUA 2HK7A 4CMEC 4ALMA 2NADA 2YZ7A 3FTNA 4ZU3A 5CDTA 1SB9A 3AK4A 3N7UA 5IN4A 3Q2IA 1V3VA 1EVZA 2X0IA 1Y5RA 4ZD6A 1ENZA 4G2NA 4DIBA 2JHGA 1M75A 3VH1A 2ZB3A 3ZI0A 4QQRA 3KEQA 4CLOB 5HA5A 4XRGA 4OJNA 5AQ1A 2DBQA 1ADFA 1EQ2A 9LDBA 3F4BA 4XJTA 2C59A 3BZUA 3K2EA 4R1NA 1OFGA 3QE3A 1H94A 3TL2A 3UCFA 4ZVVA 3G1UA 2X9NA 4BO7A 3ZHBA 5FI3A 3WDSA 5A4DA 2YV2A 4BOYA 1UJMA 3DFUA 1QMGA 4JN6B 4E5YA 3FN4A 3FBGA 4BNJA 4ND5A 3I52A 3WMXA 5JYDA 1SEVA 3LZ6A 5F1OA 1DIHA 1GQ2A 3I3OA 1HSZA 3C24A 1UUFA 3H3JA 3KRTA 4W9NA 5AXCA 4RPJA 3RFVA 4Z6KA 1HDGO 2O7SA 2WEKA 1DDOA 2BFMA 2J5KA 3BYZA 3K6JA 1YQXA 2BFAA 2HMTA 4L75A 1EUDA 5L7WA 4D79A 3O8QA 1DHTA 3I6IA 3KVOA 3P5SA 4I5DA 3E8XA 1Q1NA 3NGLA 4BNWA 1E1MA 4YJGA 1P1IA 4ZN6A 1B7GO 4OXYA 3UW3A 3DBHA 1DB3A 3GNSA 5K0ZA 1JAXA 1DIAA 4C7JA 2A9FA 5THKA 4F6CA 4BGIA 1T26A 3GUYA 3DAGA 1PL6A 1MP0A 2DQ4A 3DEYX 4OH1A 4E0BA 5BNTA 1GY8A 2PNFA 4W4TA 2PD4A 3B1KA 1DAPA 4HXYA 2CVZA 3U9LA 3WJ7A 3FR8A 5EERA 4WCFB 1P45A 1I5RA 1NVMB 5DBIA 2VWQA 3NX4A 2BMAA 4UVIA 2I66A 5KJEA 2B5WA 3MCVA 3RQSA 3LVFO 4CMIB 3TJRA 4LVUA 4UUNA 5ITWA 3H3FA 4ND1A 5I8WA 3WTCA 1UDAA 3KETA 2JAPA 3IAHA 1XR3A 5GZ1A 2DFDA 4OM8A 1NASA 3G3EA 3HFGA 1P3DA 2FP4A 4H7PA 3WMWA 3X2EA 3TDKA 4E5KA 2HMVA 3E9NA 5JAQA 4K6FA 4N54A 4YRBA 3H4VA 1QLHA 1SEPA 4WEOA 1MG0A 5IDWA 1NHWA 1UZMA 4OO3A 3QWIA 4CV2A 1PZFA 2D0IA 3O9ZA 4M8SA 5HS4A 2DPHA 3ZWBA 3RAJA 4OOFA 4PG7A 4RL6A 5G2OA 4BGVA 3WGGA 3VKUA 4EYEA 1AUPA 2VT2A 3CE6A 1LX6A 3JQFC 1LDNA 1KS9A 3PJEA 3SXPA 5T67A 1NQOA 4KOAA 3BHMA 4PG6A 3EC7A 4E13A 3LQFA 4YRAA 3K92A 2NVWA 4MO2A 3E5MA 4IUYA 4JIGA 1ZK0A 1H2BA 1OC2A 1JU9A 3DBRA 4R51A 3FR7A 1T2EA 5C5IA 1KVTA 3F5QA 1Z74A 4YAGA 3VZQA 2FZWA 5LDGA 4EEZA 3C7AA 4DVJA 3EDMA 4XYMA 3LT1A 1ENYA 2BELA 3L4SO 3H5NA 1IB6A 1U4SA 3WJAA 2NACA 5BSHA 2BGLA 1I30A 3W4KA 3MTGA 4FDAA 1P9LA 3FWZA 4IDBA 1KC1A 2UUPA 3DONA 3ZWOA 1ISJA 1R0KA 4YJDA 3BMNA 2PA3A 1KVRA 2DC1A 2O50A 5JBIA 5KTKA 4FJ1A 1NXQA 4FIZA 1S7CA 5JNLA 2Q49A 3TOZA 2JD2A 3NTRA 4RVGA 3UKOA 3OETA 3HADA 5ILOA 1EFLA 2BH9A 2Q45A 2RIRA 1GYPA 2FN7A 2P9CA 1P44A 4PGFA 1I3MA 4UUOA 4W6ZA 5CEEA 3MJ4A 2C07A 4U7WA 2I65A 1U5AA 1XU7A 2IDZA 4G65A 1XEAA 1GZ4A 1HE5A 1NYTA 4QFCA 5L53A 4YQZA 3R3SA 2GASA 3N58A 2EXXA 3K9QO 4OXKA 4YJHB 2Y99A 3V1TC 3FD8A 1QG6A 1V3TA 1WZIA 2Q46A 1DRWA 4YRDA 1U1IA 3LSYA 4JCOA 4CV0A 1U9JA 4DLLA 4BMNA 1UZNA 2QRKA 3HDJA 3ZWPA 3ZWYA 4INAA 3ADPA 1I3KA 1MX3A 1EUCA 1YWGO 5ENDA 4WE3A 3RBVA 2PR2A 4RV9A 1JDJA 2O4CA 3K96A 3L0DA 1GV0A 1N7GA 4I9NA 1E7YA 1JWBB 2IE0A 1GCOA 4DTIA 5KJ6A 1P1JA 1U8XX 1T4BA 1SC6A 1AGNA 2Y0EA 1BW9B 3K8ZA 3V1UA 3H9EO 4KQWA 3ZU2A 2NQ8A 2VRBA 1GPJA 1QP8A 1M76A 3AJRA 3H6KA 4E2ZA 4O5OA 1VSVA 3F9IA 4TROA 2EJWA 5TSDA 4ONEA 1PU2A 3F6YA 4BVAA 5A9SB 2W4QA 4O6VA 3JQBC 1CDOA 1GYQA 4KUHA 3ZHYA 4NBRA 3GFGA 4MVJP 1IY8A 3RUAA 1Y8RA 3LK7A 4E4YA 5BQFA 3L6DA 3CZRA 4MDHA 4UUPA 3BMQB 3QA9A 1WZEA 3CPSA 3OIGA 1PGQA 3ZV4A 3EYWA 3OBBA 4WLNA 1EFKA 3PYXA 4LCEA 4D44A 1ZNQO 5DCWA 1TT7A 1D1SA 1DRUA 2QRJA 1HKUA 1QRRA 1JTVA 1QYCA 4CLEA 5G0WA 2VZ0A 4JJIA 3JQ7B 1MC4A 1OMOA 2RAFA 2Z5LA 1X14A 3E5RA 3EY4A 4MOWA 1SB8A 3EVNA 1V8BA 1EQUA 4J4TA 1CETA 3JQAB 4PZDA 4FD3A 2ZB7A 3JQ7A 3BTOA 5KVQA 1JKJA 4OKIA 5L4NA 1X1TA 4Q3CA 1T2AA 2HAEA 2NNLD 4D0RA 1UH5A 4HV4A 4BO3A 3B70A 2QZ9A 2VWPA 2HRZA 4I9UA 4XWYA 1MB4A 5KJCA 3ANMA 1NQTA 3JYOA 4XQEA 1MC5A 4KDFA 5BSGA 4WOJA 5CHEA 4XYEA 4CQMA 3RC9A 2NTJA 4JJGA 4Y9DA 1LLDA 3RUIA 1ZUD1 1NFFA 3GZNB 4WEQA 3WB9A 1BGVA 1R4MA 3HZZA 5CEFA 5EESA 5DOZA 5I8ZA 4D42A 3DZFA 1HTBA 1UXKA 4R1SA 1Q0HA 2ZQYA 1EBFA 2FY8A 4JQCA 1DSSG 5A9SA 1AXGA 5EINA 3DO5A 5IFLA 4JP3A 1I2ZA 3NKLA 1UDCA 2OZPA 2ZKLA 3IJPA 3WNQA 3RKUA 2PK3A 3FTPA 4TVOA 4RJTA 3AY6A 1V9LA 5U1PA 4ITUA 1ZMTA 3H2SA 4GMGA 4TRRA 4OSPA 1JLLA 2NVUB 5DZSA 1U3TA 1F8GA 1B3BA 5IDQA 1ZVMA 1A9ZA 3ETEA 4PLFA 5GMOA 1SCUA 2P68A 3QSGA 3M1LA 4XGIA 2VTEA 5CDGA 1PWXA 3HSKA 1N9GB 1DPGA 3KBOA 1BWSA 3PI7A 4ALKA 2EERA 4TZTA 3ZZNA 4CR8A 1ZMOA 3LC1O 4EI2A 1DFHA 2G17A 4NZ9A 1Y5MA 4EUFA 1KEUA 3WGHA 4DC1A 5TC4A 1HDCA 1B14A 4CV1A 3GZ4A 3T4EA 2YDXA 4BO6A 5L7YA 2R2GA 3CINA 4YEDA 2G82A 1U3UA 5TS3A 3GDFA 2X5KO 2IEDA 3H9UA 4DYVA 5CPBA 5BNFA 3IUSA 2DBVO 4BO5A 4CUJA 1WW8A 1HDRA 5TQVA 1JVSA 4XB2A 1QV7A 4CM5A 1J4AA 3R6DA 4XKJA 3E6AA 4LVCA 5EL0A 1EE9A 3DOCA 3OA0A 3RJ5A 1E3EA 2Q99A 3I9NA 4NBVA 5ENVA 5B37A 3KYDA 1D7OA 3U4DA 3H5AA 2VZ9A 2CDBA 3WGQA 3RSHA 2BKAA 3OJ0A 3DWFA 4RPLA 2ZB8A 1WVGA 1KEVA 3GT0A 4UEJA 3PJFA 1YJQA 1JA9A 2QQ5A 2BHLA 2Y1DA 1LLQA 4HUJA 2JL1A 1M6WA 4BGEA 1EDOA 3I9OA 1VLLA 4O1MA 2V6FA 3DAFA 3JQAA 4PLCA 4RVHA 4KP7A 3UFXA 3WXBA 3IL2A 8ADHA 4DLBA 1DFIA 4F3YA 4IS2A 3NDJA 1FDTA 1HZZA 4TWRA 3O26A 5T64A 3SEFA 2X22A 3KZVA 5A5EA 1TB4A 5LCXA 1Y1PA 4J2HA 3F5SA 2JCXA 3TN7A 2O2SA 3A14A 4A5OA 1NM5A 2VHWA 3QWHA 3JQDA 1AHHA 2Z1MA 1RWBA 3DZHA 5HTOA 4NIMA 1E7RA 4E3ZA 4N5NA 5A3JA 4RF3A 1I01A 4LSMA 5B12A 3QVSA 4DQVA 3CZMA 3OM9A 1E77A 4RDHA 5JLAA 3CEAA 3WGOA 4MVJM 1AXEA 3I9KA 3Q6IA 5COBA 4M1QA 3AUAA 4Z0HO 2O3UA 2OP1A 1I32A 2PY6A 4I08A 4CMEA 1NPTO 3D3WA 2WYWA 5G4LA 4PVCA 1ZEJA 3L9WA 4ZICA 4F6LA
chains in the Genus database with same CATH superfamily
2FEXA 1TEVA 2DRIA 2GN0A 5DFAA 1YJ5A 5TQ0A 1VG8A 3KXLA 4R1QA 1CY2A 4F97A 1YDEA 1LV8A 1Q7CA 2AXPA 4M0KA 2EZ4A 1XDWA 1FK8A 2CLFB 3M2TA 1DGQA 3PL5A 1X42A 5BT9A 1RC8A 5D51S 3Q7TA 3I04A 3MJEA 1PJTA 3PXXA 4AJPA 3TQOA 4RFSB 4BMSA 1Z25A 3ZU4A 1LRLA 4AY3A 4XLTA 1J0DA 1DIOB 3JARB 3JPWA 2YASA 4MW6A 1AF7A 4OPMA 4UJ3A 3TECE 3DBIA 4FYMA 5ITZA 5AXAA 4LGVA 1P17A 4RQUA 3ZUPA 5L3VA 4TTIA 2B8WA 4GZLA 4IIVA 1XD8A 4PZAA 1P31A 2GBLA 4N3BA 5C3UA 2VJAA 2WP8J 2HU8A 3HB4X 3FCSB 1C1DB 1CUAA 1HYEA 3LKVA 4GPTA 4Q1AA 2ERXA 3OFKA 5BV1A 2MSEB 5LXTA 1XZBA 4OHXA 4UTPA 1DCMA 4QG3A 1H1LA 4PLWA 3JR3A 5L4LA 4EA9A 2ZWAA 4IMJB 2L18A 4HF7A 3LX6A 1S4QA 4P0QB 3EWIA 3F2IA 3L6OO 2AGVA 5CA0B 3QEAZ 1LTHR 2Z1NA 3NOXA 2VJDA 1FRFS 1NW6A 1QMPA 2ZYDA 3WK4A 3WSVA 4WZBE 3RRXA 3K9NA 5T5QA 2VDWA 1A71A 3GLSA 4A6PA 1T5TA 2JFGA 3RB8A 5LJLA 4UATA 4DR3B 1NX6A 1K3UB 2VDUE 4BWGA 4OQ4A 2JJYA 4CEHA 1Z8NA 1ZGBA 3M6AA 4U6QA 1EFRA 2Q6TA 4H3VA 4QTXA 3NBQA 3HDYA 1TM3E 2JI4A 2R8RA 1BXRB 2I34A 2W0MA 3K5HA 3GFRA 1KPHA 3LO5A 4FYKA 4YO8A 5I7VA 2FX3A 2O07A 1NUSA 4G5YA 4Z0PA 3ZNNA 4G5QA 2Q4EA 5FI5A 4PHHA 5D01A 5BWOA 4LBZA 3WSWA 3NATA 2REQB 3ELUA 3S99A 2IU4A 4DCTA 1EP9A 3ZGZA 1V1JA 1W44A 3G2JA 3OZUA 4G3XA 4ZTBA 5IKOA 3VH4A 3PFBA 4AJJA 2C0CA 2MSDB 2FMHA 2DFKB 2OFPA 3HFJA 2ATCA 4UPDA 1WJGA 4E03A 3U80A 1EFVA 2VG8A 2I9KA 3AI2A 3W90A 3AT1A 5A4KA 3A2NA 3R8XA 2C83A 3C39A 3M89A 3AJEA 4EG4A 2VH2A 3FY4A 3E81A 2QG4A 621PA 5L3RA 4D9FA 1LY1A 1TFRA 4L7QA 2XCUA 1Z4QA 4S04A 1SKBA 1CVIA 4ZJUA 1GL9B 2Z09A 1JJ7A 3EVAA 3L5OA 1NJ2A 5JVDA 3OE7A 1TKCA 3WHLA 2J48A 3R2JA 3H9JA 4NS1A 4WADA 4N8DA 3ILVA 2Q5IA 2VUUA 3A4NA 1EK5A 2XV1A 3NVMB 1V5EA 4MYUA 5ALSA 3HVRA 1MD9A 2JLZA 4O1HA 1QNFA 1SG9A 3G8CA 5CYOA 2VDQB 4RA6B 1Z22A 4FONA 4CL3A 4C89A 3EZLA 5H9VA 4CBVA 1CUZA 3TKLA 4EA6A 1TO2E 3E4CA 2DECA 2BBTA 8LDHA 2V74B 5I9BA 2ACVA 3DKPA 2PTHA 3T5CA 3ZD7A 5CFOA 3MIZA 1J9GA 1NHGA 2D7CA 3LNCA 4QTTB 3UHAA 4WBNB 4OHUA 3F6SA 4LJ7A 3R24A 4Y2TA 3WGJA 1WUYA 5DNWA 4LYDA 4FX2A 4EBFA 2WDPA 3GVHA 2GOYA 4MVYA 1ADJA 4MGHA 4JU9A 2A6PA 1H1LB 1E2LA 3L06A 1Z0IA 2XUQA 4J94A 1OH5A 4LYFA 4YCNA 1JSZA 2JJ2D 2GD0A 3CF2A 2FUNB 5I7FA 1LPAB 1YGYA 4U02A 1DOHA 5BSFA 2R6GA 3P2MA 4ENQA 5JECA 1P4SA 1GTZA 2PQMA 4XASA 5DHRA 1Z18A 5I9NA 3TUIC 2IU6A 2Z95A 2FZCA 5CT5A 1ZGHA 3ZV5A 3JQQA 3OC0A 2XNDD 4REOA 5EJ9A 1SMKA 5IC6A 2HF7A 1OB2A 4CCYB 1QDUA 5LP6F 2YYSA 2DAPA 2EW1A 2YINC 3B9BA 2QRLA 4DA9A 4WCFA 5A6VA 5I01A 2D54A 3NNNA 3OKCA 1F1JA 3R5TA 1XKXA 3R5KA 2RGBA 4GZ6A 3MVEA 2P5YA 2XTMA 1W75A 4UCWA 2CLMB 3QV1A 4P4NA 4RHTA 3TQSA 4JJEA 3UBMA 1WMDA 4TTAA 1D4FA 1ZD5A 2ZYUX 4OLAA 3QXHA 3D0KA 5TB5A 4OQMA 1YB4A 3DOJA 3ELWA 4FKMA 3ZIAD 3WYCA 1HZZC 3BXFA 3LKZA 5TF4A 3ZDQA 5I8PA 3TL6A 4JNKA 1YZQA 2BR4A 1L5NA 3U7QA 2WR8A 4AMVA 4H0FA 2DBRA 3AG6A 3SVLA 3R9IA 1RWVA 2IOFA 5AOVA 5AK3A 1NQUA 1G6KA 3P7MA 1VBMA 4ZRDA 3QOFA 3BE5A 1T3HA 4DM7A 4H18A 4LW8A 7MHTA 1I3NA 1OJLA 4X65B 3P4YA 3KJFA 1EB9A 1SWWA 3PHGA 3CEHA 2Q41A 1XA0A 4HP8A 2E4UA 1GKIA 2ZYGA 4HDAA 3E2PA 3GLHB 3CNLA 4EFKA 1SULA 4DV0B 4HLUA 1E6CA 3I2KA 3CEMA 1Z75A 2ZEJA 2ZI5A 4ZVRA 1WBBA 10MHA 1EWQA 3HN2A 1AMNA 3PNKA 2HCTA 1J24A 3EG9B 1DAMA 2VQ3A 1ULZA 2VDKB 3OIUA 2ZRCA 3OEED 3QXJA 1VE6A 2SCUB 2JLWA 3RREA 4X64B 1JG2A 4XGRA 4IJKA 4AZ3A 1JLMA 1HTTA 3S2EA 4MKGA 2OCXA 4BJHB 3HP4A 3ZS9A 2CB9A 3V48A 5F7XA 1PL8A 1XRQA 3PX3A 3QBDA 4M0UA 2HH9A 5GONA 5JANA 3DZKA 4BKOA 4I5IA 1KHTA 3G7SA 4JWKA 1N9GA 1R5OA 2P62A 2XYQA 2W90A 3HB9A 3U39A 1G3MA 4CM9D 1V95A 1MJGM 4KYUA 5KDDA 1P4GA 3RHFA 4QGSA 3BEDA 4UFOA 1MOPA 3GGOA 4WKGA 5DHTA 4PYOA 3MSCA 4BNZA 4MHTA 5K99A 2JFVA 3K6RA 4QLOA 6ADHA 4CM4A 4RGBA 3IR5A 3OT1A 4G5SA 2A5YB 4GXQA 4HDSB 3V2GA 4N7RA 5EWMA 3QU7A 4BNUA 1D6SA 5EN4A 1UAAA 5J4LA 2P4SA 3MMXA 3OJCA 5TEVA 3SNKA 5HW0A 5JZMA 4NBTA 3STWA 3O3NB 5D3KA 3DCJA 4BPRA 3B12A 1TAQA 1RM0A 2YUIA 4FLMA 5JH7B 3BVPA 1YZFA 1RJDA 4ZTUB 2I33A 4CKZA 5LP6B 3C3WA 5KKCA 2XYVA 3WWPA 4TS4A 3UGKA 4ZO9A 2BTQB 4WERA 3EIHA 2CF5A 3GBVA 3LDGA 5CLFA 1OGJA 4TMYA 3ANLA 1JFTA 3VYWA 2J9RA 5E8JA 1C9YA 1GRCA 5DWQA 3ANNA 1GUDA 1U0NA 4P6VF 4TV9F 1HMPA 3IIKA 3PXUA 1CQJA 1PL7A 3BTVA 3JZIA 4O63O 1LPSA 4HYQA 4XUGB 5H70A 3WBKA 1PFKA 4NOJA 1T4DA 1KAGA 4Q00A 3RIXA 3ZW7A 2WQ6A 4YRNA 1PX0A 4B83A 2FWIA 3SZRA 5CA1B 5HM6A 3KL4A 4Y2XA 5HJEA 3NONA 2Q2WA 2GF9A 1QUFA 5A03A 4V39A 4XR4A 1V6CA 4RIHA 1N5LA 2O7QA 2ZRMA 3RGWS 4EKEA 5J23A 2PKQO 3OX3A 4KSYA 4OOEA 2XF2A 2GF2A 3LUDA 4ZOLB 1OBHA 4TWIA 2DR0A 4UNRA 3T06B 4ZVPA 1ZEMA 2J45A 4KH0A 5HZGA 4QECA 2ZCJA 3O4IA 4CFYA 4L6AA 3M6WA 5KU7A 5A0TA 4HDKB 4MVJE 2B7CA 5A7HA 3IJEB 4KQEA 1XZHA 3WHIA 1KI7A 4FT2A 3BZBA 2AFIB 4RL4A 3VR4A 2J3JA 1DC4A 1S3FA 3CJTA 3FPEA 3IV9A 3C3KA 2AYXA 1F9EA 1NSFA 2YFQA 1B0AA 2WQZA 1L1QA 3DXFA 2RIPA 3EWAA 5FNVA 1O6FA 1XAHA 4Z1MA 3I04M 1MMFB 1Q1QA 3IXQA 3OE4A 3BUSA 1D2NA 5JV5A 1OXVA 4H59A 3DZJA 4ZT2A 4RF5A 4BB9A 2QAIA 1UFQA 2NW6A 1ZSVA 1XJWA 4MUMA 3E7DA 1E58A 3DGEC 4LEIA 3W4IA 1P9RA 1REQB 3IDZA 4AW9A 2Y93A 4IIJF 3ROZA 1FMTA 1Z0AA 5EIHA 4ZWNA 4B71A 2IS6A 4QUIA 2AZDA 2E6KA 3SHOA 2PRIA 3U7JA 3LW8A 4MV9A 3ACDA 4F6RB 4ZI5A 1M1YB 3FHCB 2WY2D 2P3QA 3ZX5A 3OM0A 2WHPA 5IAEA 4KVFA 3QF4A 2PR7A 1AKRA 2Y1WA 1T1RA 2VT6A 4G4IA 4F8YA 2QR3A 3QEJA 1E9SA 1F1BA 4L51A 3EFHA 4Y6RA 4RENA 2WSLA 2XWSA 4LV8B 4O3FA 4ZYUA 1YRYE 5LZ4A 4C7OA 3CC8A 4QL3A 4LTDA 3HCEA 3C7CB 1WETA 4DB4A 2C78A 4MVWA 4J6EA 1QIIA 1GTVA 2X5OA 3SYLA 4RTOA 2ZSFA 3QVXA 2GILA 5JVDF 3E18A 3FWHA 3RRBA 2JJ1A 1W0CA 5BPHA 1PP4A 3MB8A 1DBVO 5IN5A 3AYXB 1M2JA 1ZXXA 4KMSA 1EVLA 3HKBA 3SC2A 3L8HA 4YXFA 4AKHA 1FFWA 3SXUA 2P1RA 3U4QB 1SCNE 2PD3A 3PP8A 4PX5A 4M86A 2Q3BA 3TBKA 4X1KB 4UARA 1KKMA 4F06A 3A4TA 2EYQA 3TNYA 3AHGA 4QPDA 5I48A 1CYDA 3W8DA 3P45A 4BFSA 4BO8A 1T29A 3A3OA 5GOZA 5LM3A 2QRUA 2I7CA 2V7XA 1SH7A 1YDHA 4UU8A 4L5JA 4XWTA 4C29A 2VAMA 1IM5A 1E2HA 1XK6A 5K2MA 1BDIA 5JD5A 1XVUA 2FFAA 4G1VA 1MB0A 1YQ9A 4NU6A 3WGYA 1G4HA 2V0NA 5K8LA 2CV0A 4OYYA 1P19A 1I36A 1NSTA 1OX6A 1DAEA 3MQ4A 1L4GA 4GOOD 4E7PA 3TEMA 4DG5A 4RD2A 5CDYA 2C5EA 4LF8B 2VYQA 4R31A 4TL8A 1CUWA 3RSSA 1DAIA 3TOVA 1PTJC 1XZPA 1PYDA 2OMEA 4KQHA 4KPUB 3AR7A 1UPBA 4LISA 1VPTA 1E2UA 1Y48E 3GJ3A 3KLBA 4DV3B 3OTQA 4R9NA 3SQDA 1QTNA 4ZO8A 4P0PB 5E3HA 1C30B 1NMSA 3KFLA 1VKRA 1P2UA 2B9EA 2PPLA 3IOYA 3MFQA 2JPDA 1XQVA 3NRBA 4NFYA 4Q82A 2HLPA 1G8FA 1XWIA 2R60A 2GRUA 2VNAA 1Y1KE 2XF8A 4MS4A 5J5VA 5KYWA 5ALWA 2WU0A 4DDUA 3CT6A 2GZ1A 3ABIA 3CFYA 4GYKA 4EPRA 3VUEA 2DCMA 3LY8A 4QXAA 3WFJA 1E4EA 5IDVA 4C0SA 3CVUA 2EJVA 5ER9A 3FFWA 2NO9A 5A02A 1E60A 1ECBA 3BH6A 4N03A 2YMLA 4NL4H 1WUTA 2B1GA 4J6FA 5JWHA 1MH9A 1W48A 5JR3A 1ZI9A 4DIKA 1CUCA 2Z9DA 1FDSA 3V4ZA 1T4GA 1JXMA 4S1WA 2KSQA 5E7MA 4B35A 8OHMA 2JH9A 4O4JA 3FHLA 2QG9A 5TARA 1SXJD 2HUNA 2BGKA 2VQDA 4GZ5A 2ZI9A 3UT5B 2V6BA 4TMXA 4YPVA 2AS0A 2I5PO 2NSHA 2OO3A 2WP0A 2XIJA 3IESA 4J7UA 4MEJA 5JMPA 4YCBA 1Y3DE 2W70A 2G9NA 2H4ZA 5HIAA 4URFA 3PEWA 4LOIA 1S01A 3A7DA 1DKMA 1Q2XA 2VPIA 3R40A 3T94A 1LVGA 4HYYA 3VOAA 4BQRA 1IUOA 4PLYA 4BNGA 3B8EA 4CXMA 5GQSA 2F59A 2ZVDA 4RIEA 1S3IA 4Y2RA 3HWX1 4CLDA 5JFOA 3CU5A 5IAAA 1JVNA 4AZ3B 4JYZA 3LX4A 3FKSA 2UUCB 1NY6A 5CGZA 4AJEA 4DLPA 5C18A 3FVWA 2EL9A 1COWD 1TMOA 3IQWA 2R751 3PPVA 2QL6A 1XQWA 2BFPA 4RE5A 2VJMB 3V8NA 5FOXA 1HFJA 3V4VB 5C8YF 4UD6A 4V0LA 4K87A 5IJXA 3IQFA 1JEQA 4DXAA 5ALRA 1UPXA 3DMPA 5FADA 3T7DA 4HLNA 3CGWA 3N9IA 5AVJA 4HZGA 3AEYA 4KO4S 3B82A 4YDHB 1QP0A 2EG9A 3WVNA 3FUUA 4DM4A 1NW5A 2KX7A 3DLTA 4S0ZA 2YXLA 4C88A 3UJ3X 4XD7A 2F62A 4HNSA 4WNCA 1J1UA 3F97A 1HQYE 1QHSA 3BILA 3FZEA 3KSUA 3D7LA 4R1UA 2IU0A 1JT9A 3VO2A 2QV0A 3KZNA 3EHDA 3PYLA 2QORA 3ZEAA 1B15A 1U0TA 1KFJB 3KVRA 1UMDB 2YYYA 2ANCA 4KBFA 4PYMA 3UJBA 4YRJA 3N70A 3F71A 4Q7MB 3LY7A 1EP2B 3JQ9C 3ZUGA 3BIJA 3ZCRA 2QXYA 4F91B 1E98A 3C3AA 2IV3A 1GGKA 4O33A 4CQLA 1ECJA 2C29D 5H59A 1CUUA 4D4HA 3GQVA 4Q9JA 4PZPA 4GMHA 4HAWA 2IWHA 4EK9A 5JYEA 1CP3A 3UB4A 1TTTA 1UINA 1N5OX 2Y2UA 4QUAA 5BQPA 1U4NA 4PCUA 5C7IO 1H23A 5FBZA 3V8BA 2HA4A 3BE4A 3GFOA 3RYHA 4TT8A 1GAWA 3FDJA 2NTYC 2ZRIA 3TIGA 3X1WA 5DEIA 3TZHA 3KJXA 2NV2B 2QG6A 5CVJA 2Y1EA 2P2ZA 3GPBA 4LYYA 3QX9A 4J0FA 1TAHA 2D8MA 4TYYA 4RIIA 2XT9A 1B6TA 1G9XA 3KHKA 4FU0A 1ODIA 2IE8A 4JT2A 4C43A 4WCDA 5DNVA 3UM9A 5MF6A 2FZKA 2XITA 2BHTA 1O54A 2R4UA 2IYYA 1DC3A 3CRRA 3ND7A 4LC9A 4DV4B 1WY5A 5GM2A 1UXJA 3PEFA 4FSHA 4GUAA 1Q0LA 1DT3A 1XAJA 4QXRA 1YNOA 3SBEA 1C1XB 1JEJA 1TF5A 1SUPA 1GPDG 3A6LA 2B4QA 3ST7A 2QB5A 1XHLA 2NOAA 4IIUA 4OJMX 3O91A 1OLUB 5FNZA 4GGMX 3RVSA 1FTNA 3T9AA 5AM1A 3E82A 2Q50A 1YS7A 2XMCA 1QH1A 1Y8QB 2HOQA 4KV7A 5C1IA 4J0GA 1I8TA 1XRLA 3WA6A 3BMOA 3NFRA 3WY9A 3HBAA 5ALGA 5F52A 3DCYA 1U8YA 1X1RA 2Z2ZA 4NS4A 3V1LA 4DLUA 3W5CA 5JDIA 4D4JA 3KQPA 2XB4A 1UMDA 2IJGX 4IINA 4CMBA 1M74A 3NV9A 3G5TA 4MW7A 1JALA 4S0XA 4LGCA 3ORSA 3GUZA 1EM6A 1CRZA 4FFMA 5E7JA 1WQ4A 3RG8A 4GWGA 5B57C 1JEYB 2D2FA 4KGDA 1DX6A 2GYUA 1RPAA 4Q4JB 5BSTA 4ZIRA 4QU8A 1GQQA 1RFGE 1RQ7A 5E3IA 3M0EA 4KEAA 4DYDA 4CEIA 1N6HA 5LBTA 3ZBQA 2IHZA 3LUBA 2HWWA 3JD2A 3W1VA 1V4NA 4PM4A 4RX1A 2V55B 4DMMA 5CW2A 3CH6A 3EBOA 5PNTA 4YRFA 1T6BY 4GS5A 3SLRA 2VTBB 1DXYA 4KXNA 1R6TA 1KYQA 4JLNA 4LYEA 3B1JA 2BZSA 4WNIA 3KXDA 1HR0B 1E9BA 1E2IA 3TYXA 4UPEA 4DV6B 3B5EA 4GLOA 1VCOA 5J2TF 3AUSA 1I2AA 1BMFD 2ZW9A 3OZXA 4C9BA 1B8PA 3L4BC 5CU7A 3OLCX 4XVRA 3JQCA 4M1WA 3UA4A 2ZCVA 1ULAA 3WDKA 4DQLA 5IASA 2DWUA 3JALA 3S2ZA 1D9ZA 2MIIA 4WFQA 4FN5A 4EBBA 1QBGA 4O4HF 1EK6A 3IEXA 1JFLA 4D8UA 1XZ8A 2HC9A 4G85A 1XWFA 3IDQA 3DD1A 4CQNA 3FDZA 1C9JA 3FSGA 4Q9DA 3SY8A 3QH4A 3VNSA 1Q44A 1F12A 1ABEA 4JLVA 4LZPA 4RMHA 4ZKDA 1BQ3A 1X19A 1ZITA 2J4FA 1AGYA 1J5PA 3EXIA 3I6BA 3TLMA 4DNPA 5CFLA 2GPBA 3EOAI 4ZDJA 3BEOA 3DXYA 1JMVA 5J9FA 2UV8A 1ICIA 1TOAA 1D3AA 2NUTB 3IIMA 3KDPA 3PU6A 4OFBA 5TV2A 4C5CA 4WOBA 2IXAA 1VSBA 1W96A 4B7XA 2E4AA 3KQTA 2GAOA 3CZCA 2QW8A 3UENA 5JLJA 2JEOA 1BRMA 2RKOA 3QVTA 2IYSA 4WNAB 2YN4A 1KY4A 4Q7EA 5GGXA 4HLQB 2XHZA 1G2PA 1G7CA 1YOVB 3A1CA 4HRYA 5LN1A 4R68A 3EEQA 3JZDA 4WX2B 5IMSA 2RGWA 5FORA 4IY1A 1YIAA 3I4CA 5H83A 1U0HC 3G88A 1ZN7A 1RQPA 1HSOA 1RHQA 2CHVA 2YRWA 4LPKA 3UYKA 2JCYA 3DULA 3QLUC 4DR4B 1ZMBA 2Y4NA 1LLCA 1Z5ZA 4FJ0A 3H84A 1AZWA 3KQOA 1XP8A 2H1CA 1IZZA 1NVAA 1STOA 2R4QA 2YR0A 3Q5EA 2Q3JA 3IFSA 4KGVA 5I5EA 3SS7X 2I3AA 3V7UA 1SWVA 4CM3A 3W5AA 3GVPA 5EJ7A 3D6HA 4TMTA 5EPEA 4YMVA 4NQZA 2A94A 2Q6IA 4LJKA 4J0JA 1W8DA 3JQAD 4PGMA 2CUTA 4TTRA 1JSLA 3MINB 4OLFA 5ALOA 3CH5A 4EB6A 5F98A 3DOOA 2DFVA 1IVNA 4K6HA 1YNSA 4BNNA 2B30A 1LU9A 3WQBA 2JCVA 3RU7A 3NCHA 1WDWB 3JQFA 3J7TA 4JQOA 3T3PB 1J0XO 5BNIA 1VDZA 3AY3A 2C3PA 2FDRA 3BHJA 1DBQA 1PJBA 1H2HA 2ZBDA 4YWJA 4ERNA 4I66A 4PLHA 1WAMA 1R64A 4BO2A 4FHFA 3TLCA 2F8MA 3LCJA 4B6OA 1CZOA 2PX5A 2LWIA 1WCV1 3ZD6A 2G09A 2Q62A 4XUEA 3KG2A 3DMNA 2X4LA 3VHLB 1K68A 3LPLA 3OICA 4AP9A 2PUWA 1IMJA 1QIHA 2YYAA 2C4NA 3BAZA 1WVIA 3AR6A 1WF6A 1QNLA 2G08A 3MJDA 4DGQA 4F3CA 3O1JC 1FJGB 3G79A 1JS1X 1TW3A 2FPWA 3RUHA 1E32A 2GNPA 2L19A 1N4AA 1JG4A 4EF6A 3QOYA 2A4MA 3IKVA 4WDQA 1GGVA 5JMWA 5G1NA 3KB2A 2J33A 3S5JA 3LOUA 2BMEA 5EIBD 1QAQA 3BRCA 4F5DA 5IKXA 2QUIA 1BWRA 1SY7A 3ITDA 1AKEA 3OBIA 4M88A 1Z34A 3ESXA 4DMKA 2UU9B 4B9EA 3G0GA 4L4XA 4M4SA 3BG5A 2CVQA 1ZSNA 2Q8QA 1H8HA 2EP8A 3GUUA 2M6KA 5KNLA 3LWDA 4ERXA 3ITEA 1QWSA 3AW8A 3VSBA 2YFKA 4Q18A 2I9PA 4MQFA 2G67A 3KEMA 2V9CA 3WIUA 3WMGA 4YNBA 4E21A 2FR8A 3IBCA 4FOLA 4YRCA 4ZAWA 1OZHA 3ESQA 2DHQA 2AC4A 4B33A 3OEWA 1O94C 1P5HA 3QX7A 1ATZA 3QFSA 3CW2A 2C9YA 5DN6D 3V7FA 4QJ5A 4IXNA 3S2IA 3DPUA 1UADA 5IWAB 3AZOA 4AMZA 4EA8A 4A8TA 2EKBA 2JCSA 3UMCA 2GO7A 3GLGA 1S3SA 2PKWA 2BR5A 2NU8B 3W8RA 3MCTA 4BE4A 1T9ZA 5L6MB 2Z4RA 2X2EA 4FE3A 3AKZA 4L5BA 1E1YA 1T2DA 3C43A 3F0TA 3M5PA 3P2IA 4C0WA 3QJ5A 4IXDA 2WD7B 4L76A 4YJ3B 4ZVSA 4GBED 5HRCA 1B76A 3K9WA 1PGOA 3H8VA 3F73A 3MM4A 4HZIA 4RGVA 5C5EA 4UNQA 3W2EA 1SXGA 5MN4A 1IY9A 1QH9A 3M3PA 5CFNA 3SF8A 4Y30A 1T8YA 3MS4A 4TMKA 2YKGA 1D1TA 1LKZA 1YT5A 1RWMA 3EXG2 2P6NA 3EEIA 5FR1A 1R15A 4YP6A 2O7RA 2FRDA 2X0NA 1G8PA 1PQUA 1QCZA 4H7IA 2VZ8A 1ESCA 1QC5B 3U7EB 2FCAA 3PF9A 4ZPJA 2JGEA 3ZW9A 2YW2A 1A97A 3GV0A 1HNZB 3AR3A 4RKRA 4UCQA 3UGJA 4AWXA 4UHBA 1PL0A 3WYFA 4U7DA 1A8PA 5CITA 4EHNA 3WGZA 4CRWB 4FDVA 1GZSA 1FLDA 3VR6A 3F6RA 5DP1A 1AKUA 1C3OA 2QE6A 1XTUA 5JFTA 4IYRA 3G2PA 3KDAA 1H66A 2REXB 5K9ZA 1LI7A 1O4WA 3CEJA 1BC5A 1ONPA 2I67A 1PAUA 4WXEA 4FXPA 3UXMA 1LQUA 1PR9A 1N2EA 2JHPA 5G0UA 2ZSUA 1GG5A 4PGGA 3S2FA 4L4SA 1OGIA 1BOOA 4DA4A 5BXYA 5T3YA 1P74A 1JT2A 1KORA 2RHCA 4MCAA 5ABPA 2ZTMA 2HYIC 1K8XB 2Q5FA 1KEPA 1PNQA 3Q7PA 2CKDA 3UAYA 4JI1B 4I55B 2WKRA 2C2OA 2R2AA 1LDYA 2NV6A 4OMDA 4QPNA 2ZJAA 3M81A 2ZIUB 3HA5A 3LWNA 5BN1A 2AKYA 4U6SA 2H9YA 5IVPA 4FC6A 5EYPB 3DUFB 3Q0EA 5AUOB 1BTOA 8ATCA 2X6QA 5DHQA 2I54A 1NLMA 1EFHA 3ROGA 1O97D 1QVAA 3ONDA 3FLBA 2FOXA 4U63A 1Z4NA 2H4WA 4D6XA 2Y1CA 1YO6A 3IXMA 1LBEA 3F7OA 1H5NA 4JR2A 1IQUA 5AI4A 2FPPB 3SEQA 3QNMA 3TQQA 4F93B 4N5LA 1W88B 2WFAA 1XQ9A 3MOGA 4H7JA 3D3NA 3SAJA 4QOIA 4IIXA 2HK8A 2JFHA 1HI9A 2X0RA 2ZRLA 5ANRB 1XRMA 2ALJA 2O5CA 3KKEA 4H1TA 4QHTA 5FHQA 4AO6A 5IX8A 4GEKA 3AUUA 3ZY6A 1PJRA 4NABA 2H85A 3ZV6A 3UWMA 1KXZA 1O94D 2R1TB 4FGLA 2OE2A 1RMQA 1ST2A 4XX0B 1L5HB 5C3MA 1NATA 4X85A 4NPCA 3ZDRA 2AD1A 4DQKA 5K6AA 1P5FA 1NR7A 4PYQA 1EGMB 3OVMA 1KAMA 2NO1A 2I4IA 4JMLA 4FUQA 1TZ2A 3C5WP 4WGFA 3KVNA 3K31A 4JENA 4CT4B 3P5BA 3A6FA 5CXXA 2RDMA 3E9RA 3O75A 5CH3A 4CDNA 2X41A 3RVDA 4D6YA 4JVLA 1P0QA 1VIVA 2HD4A 3PNMA 3ZY5A 4EO4A 5D2CA 3IUNA 1QGUB 2W6JA 3OAAA 2UZIR 4PYKA 3UH1A 3EFOA 3OCXA 1QGUA 2VSNA 2O52A 1T5HX 2X2FA 3GC6A 4COKA 3FHTA 3NBFA 1ARZA 2G5CA 4INPA 4UBJA 3BA1A 2ZRFA 4JLBA 2RAPA 4FOSA 3EH2A 3NWOA 4FR2A 4NZYA 3DXXA 3UQZA 1E2MA 4REQA 4XSVA 5IW8A 5IXJA 2EDAA 3JD0A 2O2CA 3H04A 4WCVA 4HNUA 1NYLA 5LWHA 1QV9A 3AIKA 2NWQA 5B2FA 2HCRA 5KMGA 4LXXA 2BLNA 5B7NA 1EVJA 1K8YB 4R54A 3O95A 1KIFA 1T0IA 3E03A 4CM8A 1J49A 3RKRA 4Z4FA 2C54A 3LGAA 4MRRA 4RANA 4OY3A 1PNRA 2X1LA 2WUVA 1T3TA 1VHLA 4IH1A 1A98A 1D2AA 3HVHA 4P5EA 3QEKA 5C51B 1E9CA 1GV1A 2GI4A 4Z4EA 1ODLA 2PX6A 3RC2A 2QUZA 2ZT7A 4S2UA 5ELLA 5DI9A 1ILWA 1GRNA 4EP1A 2Q8NA 2IY8A 4H3KB 3JY6A 4KQ2A 4I4NA 1UT5A 3K4HA 1EDBA 2PLAA 2XGOA 2XE4A 1Z7WA 4C0XA 4JJZA 1L6IA 2GRAA 1T9BA 4NMHA 2VWGA 1P80A 4IWYA 2PKYX 5TIIA 2CNNA 1JXAA 2JIMA 4LX0A 2WJVA 1VE1A 3GFFA 4G0MA 1VCMA 4PRLA 5ULLA 2VDWB 2CGEA 2VSYA 3PIIA 5F51A 4LI0A 4I1IA 4H1HA 6NULA 3ONEA 1T2CA 2GFQA 1GNQA 1GFZA 3LZCA 1LUAA 2D1QA 4QGAA 1KF0A 4DUYB 1SBYA 1W4LA 3OIFA 3HCWA 3QFFA 1BCRB 1LRKA 1ZINA 2GB4A 4IQ0A 3NRCA 1TYCA 4AJ4A 4Y6QA 4O4JF 4Z7JA 2BFEB 5CVUA 1JDZA 3CUSA 1Z63A 3GGPA 2IEIA 3OPYB 4YLYA 4NNPA 3RTCA 1Z73A 5D5HA 4F2GA 1ZQ1A 4NXNB 1FQOA 2RGUA 3KB6A 5BSUA 1WLSA 1LSJA 4AJHA 5JVDB 5BUCA 2PT6A 1HRKA 2VXCA 3SBOA 5IXSA 2JLYA 1NLZA 4UDOA 5DSXA 4B3HA 5DX0A 3RIEA 4EENA 1W93A 3AGPA 2FEKA 2HDWA 4BRUA 4IP0A 2IZ1A 1LWNA 3BIOA 1TIBA 4IIEA 4ZGWA 1AZTA 3AF1A 5AVZA 5ETJA 2B3DA 1D7AA 3ONNA 3P9SA 2FFRA 1ND5A 4X92A 2JBWA 3PNLA 3L4EA 3VJMA 2AUNA 1AM4D 2COEA 2VYFA 3KP1A 1RT9A 1DKLA 3PFGA 4OD0A 5BVGB 4OYRA 4Q3OA 4FB5A 3PPYA 4M8KA 3ZS8A 1DJOA 4EOGA 3EGWA 1ESMA 5JC8A 5ALDA 1G21A 4EELA 4KR7A 4DM3A 2LR0A 3A10A 1ZDMA 4U7TB 1NUQA 4B4OA 1RVDA 1DAGA 1E2DA 3U3JA 1HGXA 2XUHA 1LXCA 1P1FA 4YJGB 4MDEA 4BNHA 4S3MA 3ZXIA 1TO6A 2YVLA 3CE9A 4I2NA 4MW4A 1QFYA 3OQIA 4FI3F 4US0R 3MWYW 3ED1A 1XQYA 3WGUA 1Y33E 3HWSA 3LBAA 3TCXB 3D4NA 3E0QA 4Q4AA 3LDFA 3GQBB 4ZI7F 4RWZA 3FYUA 4L5YA 4AS2A 1VCHA 3EOBI 3TTWA 4HNGA 1JJAA 4F0JA 4E31A 1I0LA 1Z5OA 3W5HA 3D0OA 2G9UA 4DRXB 5JJKA 1LX7A 3EVGA 3SM9A 4F7DA 3LHFA 2E48A 2WJIA 4Y0VA 5E6UB 2Q5LA 3A1WA 3EVDA 3QY0A 3GFBA 1IIBA 1PX2A 4B31A 3AETB 2HF2A 4PO3X 2PS3A 3MD9A 3R3HA 4KO2S 1VA4A 1L7BA 3ZQKA 5A5FA 2HLDD 1A9QA 5BV2P 1SOWA 1OFUA 4MZDA 2WF8A 1U2GA 1ZL2A 2C2WA 3HB5X 3QX3A 3UVEA 4OQXA 1HETA 1XZJA 4OAPA 3A11A 3ZCTA 2QDKA 1X39A 3MQ2A 4ZQFA 1O6GA 3UMYA 4HEA6 5H3CA 1CBUA 3D4PA 2AOUA 2FUG6 1B16A 1Z29A 3Q3HA 3L0YA 2JA1A 1EEHA 4XVQA 4ID9A 1P1HA 3L9XA 4DJJA 3N0TA 1QC5A 2OO5C 4MV1A 4O4JB 2JGLA 3LY9A 4HQLA 4AN4A 3VPCA 2W4IA 5KDOA 1BNCA 1KZHA 2IHVA 5J3JA 1BN6A 1ZI8A 3JYNA 1E3JA 3MNFA 3OX1A 4C7XA 3F3MA 4UOEA 1GARA 1K8RA 2X86A 4BWYA 1Q11A 4HDQB 4FW8A 2X6TA 2NSDA 4TLCA 2AJDA 3KQLA 4J16C 4WVLA 4ILEA 2JLCA 2PYZA 4Y2JA 1OTYA 3M6IA 4LOJA 3Q87B 5HF6A 4BZZA 1P5RA 1HH4A 1SXHA 4W8OA 1CJMA 4B6SA 3FNEA 2ZRAA 2QNBA 3HLKA 2DQZA 1KMMA 3ENVA 3FMOB 3PKIA 3GU3A 4D41A 1C1YA 5ALJA 4PX3A 5F9FA 2VFAA 2ZATA 4Q48A 1XTKA 4ZCMA 1X9GA 3DV0B 4GNKA 1PWHA 4IQ8A 1MVNA 2PSFA 3CBGA 5BSMA 3U09A 5FB3A 4UBIA 3SX4A 3DPIA 2C5SA 5HJ7A 2AVNA 1NXXA 1N0IA 3GZNA 5E9AA 4BO4A 1Z28A 1P0MA 1ZGJA 2PT9A 2P77A 3CO5A 4G63A 2YJ4A 8ABPA 3K32A 4JJ4A 1TKAA 5FFFA 3RJMA 2A0FA 4ZVUA 3HZOA 3IO5A 5JS6A 2PYIA 4UCFA 2N1BA 3ASUA 2AI3A 5ADWA 1Y7LA 2IEBA 4FEGA 3K9HA 3QFTA 3M1YA 4IV5A 4QOHA 2LD4A 1UIMA 3R7SA 3WNVA 2W48A 3N53A 1BA2A 1QS0A 4US1R 5BSEA 4WECA 2WB2A 4DUZB 2BRUC 4OHOA 2JK0A 3GN1A 2G9VA 3NHAA 4MAFA 5IDYA 4L02A 3WOHA 5JS8A 1V7CA 1GRVA 1BHSA 1PV2A 2I4LA 4UNIA 4ZU1X 1JVBA 3GJZA 3JQ8B 4GGOA 5AOAA 3SQOA 1VJCA 3UWPA 4KWEA 3QTTA 3DC2A 2F1JA 2YZGA 4ZZ3A 1ZIPA 4Q9IA 3A6KA 1XDSA 1XT6A 1DIBA 2G5GX 3GPDG 3KVVA 3RJTA 3RSCA 1Q7EA 4KWCA 2VSFA 1ONSA 1SC1A 1U7HA 1UPAA 2YICA 3KX2A 2YQ4A 5FWYA 1YL7A 2VJYA 2R85A 2I2AA 5SYNA 1VL0A 4PBSA 1GZHB 3BTSA 4K0RA 1K5HA 4Q24A 3RSLA 4DMGA 2VUTA 4U9HS 1GRRA 3CUWA 1FTGA 3VDRA 4A6XA 1JSRA 5JSHA 1DS6A 1TCVA 4DR7B 2ZJ1A 4XE5A 1SOMA 4QHSA 4NCAA 1FUEA 1SVNA 1BHO1 3S8YA 3H2YA 1QCYA 1V8OA 2YOFA 1OIXA 1QAOA 2BF4A 3LXRA 2CF6A 3NC4A 2VSQA 3PPIA 3W04A 5AUNB 5CG1A 2WNHA 4IZHA 4CN8A 1WBDA 4BBZA 2FEOA 3R44A 4B3RB 1KH3A 1FNSA 3N0XA 4K86A 3EIQA 2DWPA 1MX9A 5JY1A 1W2GA 2A9PA 1H9BA 2Q4DA 3ZWKA 3ZD9A 2B7BA 2QBYB 4D3YA 1S8OA 1VMEA 1DLJA 2OCAA 4FW9A 3E9DA 1ZC4A 3KEFA 4ZRNA 5CCEA 5A62A 5KCMA 5JXWA 4OI0A 1EFPB 2HHCA 2C3MA 3U16A 4IFIA 1SBNE 4EUHA 4QASA 1XZEA 2C4VA 2RKBA 2H1FA 3NQ41 3ZIUA 4C04A 2M2IA 4NVRA 4AZ0A 4F92B 4YT8A 5DISB 1SCQA 1VLMA 3ZE0B 2VUHB 1GU1A 5BVHA 3TF5A 3NYQA 1BVUA 5AM5A 4HYEA 4MGYR 3MSXA 1BEEA 1HZJA 4OMCA 1PYOA 2O2HA 3BGOS 4TXJA 4OK5A 1OLUA 1PFUA 4Y2YA 2AJTA 3G9UA 2Q3LA 2HJVA 1PR3A 1L5VA 5EKXA 3M9WA 4YB8A 4N3NA 3Q8XB 2P30A 1DUIA 3MJHA 1SZJG 1J2TA 2PT7A 5KOYA 3UK1A 5BNWA 4RULA 5ALNA 2ZFUA 1U0BB 2I6TA 2QQGA 5FV7A 3RGGA 8MHTA 1FLNA 4HAYA 2QVXX 4Q7QA 3UCXA 1XMOB 2K4MA 1DTEA 3IAM1 2FPGA 2CMFA 2H18A 1JZTA 1XNQB 2P9TA 4HGQA 2Q5OA 3CEPB 1CF2O 5AKKA 4R7ZA 3I61A 3ORFA 5AR1A 2BM1A 4C05A 5CFMA 4URUR 2RJOA 1W59A 1UPCA 1XIVA 2FWPA 2HXSA 3GRCA 3IP1A 5DBHX 4B7UA 3TOXA 4LWOA 4ZQEA 4DDWA 5FTWA 3F3SA 4OSEA 2I22A 2X6RA 1OA0A 4D43A 1Z6ZA 1NJ5A 1OT5A 4GI7A 1MIOA 1CDZA 3VHXB 4ZALA 1OV6A 1HT0A 3AJAA 3HUDA 1WTCA 3I9MA 4LKRA 4R9UC 5HKAA 2Q1YA 3T34A 2H5LA 2PSSA 4P98A 3OQ1A 4D99A 5IUNC 4NCJA 1RE1A 3A4LA 4I1SA 2AEJA 2FN8A 3F9CA 3FDIA 3VTFA 1RYMA 3WAJA 1OB5A 1WB5A 4RV5A 2BCJQ 3HJGA 1YQWA 1ZCJA 4A16A 4MVJH 1ZZEA 4E1BA 1QPBA 1KOLA 3RV3A 1H4QA 5CDSA 1A8SA 1C9KA 3IP3A 2VQEB 3BOSA 3K0SA 4EG7A 1X3SA 1IHUA 1S2GA 3CH4B 4R16A 5A6SB 4XUDA 2VIIA 3I28A 5B36A 1P75A 3IALA 4YJHA 3W2IA 3GLKA 2DPLA 2HMSA 3IPCA 2OV3A 3ZOKA 1NVTA 3BIWA 1DMSA 4G8CA 3TLGA 3UHFA 1Z0JA 1NOJA 1W5EA 1NV9A 3GJ7A 4OMFG 5EGSA 3ZKAA 4UBOA 4TMWA 3EFOB 1Z0UA 4RTQA 1PV4A 1EVEA 1T4CA 1GR0A 2PANA 3HPQA 3GT7A 3LCMA 1K88A 2SHKA 2IYOA 2Q0QA 1EAYA 4ZRMA 1MCZA 2C9ZA 3TDMA 4DLKA 4E22A 4QT4A 1AN9A 5JISA 1Q21A 5ICSA 3CLKA 3WAKA 4Z3KA 2HPVA 3PGA1 1RAIA 2EIHA 4V1CA 2VPYA 1OPXA 1IBCA 2ACEA 5F5NA 4DSZA 2EF0A 1UP6A 3HNPA 3GLFA 4LNUB