4NH5A

Structure of human dicer platform-paz-connector helix cassette in complex with 14-mer sirna having 5'-puu and uu-3' ends (2.55 angstrom resolution)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
298
structure length
271
Chain Sequence
QPCYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFGILTAKPIPQIPHFPVYTRSGEVTISIELAASGFMLSLQMLELITRLHQYIFSHILRLEKYCVLPLNVVNSTLDIDFKFMEDIEKSEARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLHC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Phosphate-Binding Pocket within the Platform-PAZ-Connector Helix Cassette of Human Dicer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/rna
molecule keywords Endoribonuclease Dicer
total genus 67
structure length 271
sequence length 298
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2013-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02170 PAZ PAZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.260.10 Mainly Beta Beta Complex paz domain paz domain 4nh5A02
2XFMA 4NH3A 4NHAA 1T2SA 3O3IX 1SI2A 4KREA 4W5OA 4W5TA 4W5NA 4F3TA 1SI3A 4NGBA 2L5DA 4NGFA 4OLBA 3QIRA 1VYNA 1T2RA 4W5QA 4NGDA 4Z4GA 4Z4EA 3O7VX 5KI6A 5JS1A 2QVWA 3O6EX 4NGGA 3O7XA 4KRFA 4NGCA 5JS2A 4NH5A 4W5RA 4OLAA 2L5CA 4Z4IA 1R6ZA 4Z4FA 4Z4CA 4NH6A 4Z4HA 3MJ0A 1R4KA 5T7BA 2FFLA
chains in the Genus database with same CATH superfamily
2BZEA 4L1UA 1Z25A 2XFMA 4NH3A 4NHAA 1T2SA 4L1PA 3O3IX 1SI2A 4KREA 4W5OA 3DA5A 4W5TA 4W5NA 4F3TA 3HM9A 3F73A 1SI3A 4NGBA 2L5DA 3HO1A 4OLBA 4NGFA 1U04A 3QIRA 3HK2A 1VYNA 1T2RA 3HVRA 4W5QA 4NGDA 4Z4GA 4Z4EA 3HJFA 3O7VX 1Z26A 3DLBA 5KI6A 3DLHA 5JS1A 2QVWA 3O6EX 4NGGA 3O7XA 3U1UA 4KRFA 4NGCA 5JS2A 2DB9A 4NH5A 4W5RA 4OLAA 2L5CA 4Z4IA 1R6ZA 4Z4FA 4Z4CA 4NH6A 4Z4HA 3MJ0A 1R4KA 5T7BA 2FFLA
chains in the Genus database with same CATH topology
2BZEA 4L1UA 1Z25A 2XFMA 4NH3A 4NHAA 1T2SA 4L1PA 3O3IX 1SI2A 4KREA 4W5OA 3DA5A 4W5TA 4W5NA 4F3TA 3HM9A 3F73A 1SI3A 4NGBA 2L5DA 3HO1A 4OLBA 4NGFA 1U04A 3QIRA 3HK2A 1VYNA 1T2RA 3HVRA 4W5QA 4NGDA 4Z4GA 4Z4EA 3HJFA 3O7VX 1Z26A 3DLBA 5KI6A 3DLHA 5JS1A 2QVWA 3O6EX 4NGGA 3O7XA 3U1UA 4KRFA 4NGCA 5JS2A 2DB9A 4NH5A 4W5RA 4OLAA 2L5CA 4Z4IA 1R6ZA 4Z4FA 4Z4CA 4NH6A 4Z4HA 3MJ0A 1R4KA 5T7BA 2FFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XFM A;  4NH3 A;  4NHA A;  1T2S A;  3O3I X;  1SI2 A;  4KRE A;  4W5O A;  4W5T A;  4W5N A;  4F3T A;  1SI3 A;  4NGB A;  2L5D A;  4NGF A;  4OLB A;  3QIR A;  1VYN A;  1T2R A;  4W5Q A;  4NGD A;  4Z4G A;  4Z4E A;  3O7V X;  5KI6 A;  5JS1 A;  2QVW A;  3O6E X;  4NGG A;  3O7X A;  4KRF A;  4NGC A;  5JS2 A;  4NH5 A;  4W5R A;  4OLA A;  2L5C A;  4Z4I A;  1R6Z A;  4Z4F A;  4Z4C A;  4NH6 A;  4Z4H A;  3MJ0 A;  1R4K A;  5T7B A;  2FFL A; 
#chains in the Genus database with same CATH topology
 2BZE A;  4L1U A;  1Z25 A;  2XFM A;  4NH3 A;  4NHA A;  1T2S A;  4L1P A;  3O3I X;  1SI2 A;  4KRE A;  4W5O A;  3DA5 A;  4W5T A;  4W5N A;  4F3T A;  3HM9 A;  3F73 A;  1SI3 A;  4NGB A;  2L5D A;  3HO1 A;  4OLB A;  4NGF A;  1U04 A;  3QIR A;  3HK2 A;  1VYN A;  1T2R A;  3HVR A;  4W5Q A;  4NGD A;  4Z4G A;  4Z4E A;  3HJF A;  3O7V X;  1Z26 A;  3DLB A;  5KI6 A;  3DLH A;  5JS1 A;  2QVW A;  3O6E X;  4NGG A;  3O7X A;  3U1U A;  4KRF A;  4NGC A;  5JS2 A;  2DB9 A;  4NH5 A;  4W5R A;  4OLA A;  2L5C A;  4Z4I A;  1R6Z A;  4Z4F A;  4Z4C A;  4NH6 A;  4Z4H A;  3MJ0 A;  1R4K A;  5T7B A;  2FFL A; 
#chains in the Genus database with same CATH homology
 2BZE A;  4L1U A;  1Z25 A;  2XFM A;  4NH3 A;  4NHA A;  1T2S A;  4L1P A;  3O3I X;  1SI2 A;  4KRE A;  4W5O A;  3DA5 A;  4W5T A;  4W5N A;  4F3T A;  3HM9 A;  3F73 A;  1SI3 A;  4NGB A;  2L5D A;  3HO1 A;  4OLB A;  4NGF A;  1U04 A;  3QIR A;  3HK2 A;  1VYN A;  1T2R A;  3HVR A;  4W5Q A;  4NGD A;  4Z4G A;  4Z4E A;  3HJF A;  3O7V X;  1Z26 A;  3DLB A;  5KI6 A;  3DLH A;  5JS1 A;  2QVW A;  3O6E X;  4NGG A;  3O7X A;  3U1U A;  4KRF A;  4NGC A;  5JS2 A;  2DB9 A;  4NH5 A;  4W5R A;  4OLA A;  2L5C A;  4Z4I A;  1R6Z A;  4Z4F A;  4Z4C A;  4NH6 A;  4Z4H A;  3MJ0 A;  1R4K A;  5T7B A;  2FFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...