4NH5A

Structure of human dicer platform-paz-connector helix cassette in complex with 14-mer sirna having 5'-puu and uu-3' ends (2.55 angstrom resolution)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
298
structure length
271
Chain Sequence
QPCYLYVIGMVLTTPLPDELNFRRRKLYPPEDTTRCFGILTAKPIPQIPHFPVYTRSGEVTISIELAASGFMLSLQMLELITRLHQYIFSHILRLEKYCVLPLNVVNSTLDIDFKFMEDIEKSEARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLHC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endoribonuclease Dicer
publication title A Phosphate-Binding Pocket within the Platform-PAZ-Connector Helix Cassette of Human Dicer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/rna
total genus 67
structure length 271
sequence length 298
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2013-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02170 PAZ PAZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.260.10 Mainly Beta Beta Complex paz domain paz domain 4nh5A02
4NGGA 4F3TA 4OLAA 4NGBA 4NH3A 3O6EX 1T2RA 4Z4IA 1R6ZA 4NGFA 4Z4EA 4KRFA 3O7VX 4Z4FA 5JS2A 5JS1A 4W5TA 1T2SA 3O7XA 5KI6A 3MJ0A 2FFLA 4Z4HA 4W5QA 4OLBA 1SI2A 2XFMA 4NGCA 5T7BA 2QVWA 3O3IX 4W5OA 1R4KA 2L5CA 2L5DA 4NGDA 4KREA 4W5NA 1VYNA 3QIRA 4W5RA 4NH5A 1SI3A 4NHAA 4NH6A 4Z4CA 4Z4GA
chains in the Genus database with same CATH superfamily
4NGGA 3HJFA 4F3TA 3U1UA 4OLAA 4NGBA 4NH3A 3O6EX 1T2RA 4Z4IA 1R6ZA 4NGFA 4Z4EA 4KRFA 3HO1A 3O7VX 3F73A 5JS2A 1Z25A 4Z4FA 5JS1A 3HK2A 4W5TA 1T2SA 3O7XA 5KI6A 3HVRA 3MJ0A 2FFLA 4Z4HA 1Z26A 4W5QA 4OLBA 3DA5A 2DB9A 4L1UA 1SI2A 1U04A 2XFMA 4NGCA 5T7BA 2QVWA 3HM9A 3DLBA 3O3IX 1R4KA 2L5CA 4W5OA 2L5DA 2BZEA 4NGDA 4KREA 4W5NA 1VYNA 3QIRA 4W5RA 4NH5A 4L1PA 1SI3A 4NHAA 4NH6A 3DLHA 4Z4CA 4Z4GA
chains in the Genus database with same CATH topology
4NGGA 3HJFA 4F3TA 3U1UA 4OLAA 4NGBA 4NH3A 3O6EX 1T2RA 4Z4IA 1R6ZA 4NGFA 4Z4EA 4KRFA 3HO1A 3O7VX 3F73A 5JS2A 1Z25A 4Z4FA 5JS1A 3HK2A 4W5TA 1T2SA 3O7XA 5KI6A 3HVRA 3MJ0A 2FFLA 4Z4HA 1Z26A 4W5QA 4OLBA 3DA5A 2DB9A 4L1UA 1SI2A 1U04A 2XFMA 4NGCA 5T7BA 2QVWA 3HM9A 3DLBA 3O3IX 1R4KA 2L5CA 4W5OA 2L5DA 2BZEA 4NGDA 4KREA 4W5NA 1VYNA 3QIRA 4W5RA 4NH5A 4L1PA 1SI3A 4NHAA 4NH6A 3DLHA 4Z4CA 4Z4GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NGG A;  4F3T A;  4OLA A;  4NGB A;  4NH3 A;  3O6E X;  1T2R A;  4Z4I A;  1R6Z A;  4NGF A;  4Z4E A;  4KRF A;  3O7V X;  4Z4F A;  5JS2 A;  5JS1 A;  4W5T A;  1T2S A;  3O7X A;  5KI6 A;  3MJ0 A;  2FFL A;  4Z4H A;  4W5Q A;  4OLB A;  1SI2 A;  2XFM A;  4NGC A;  5T7B A;  2QVW A;  3O3I X;  4W5O A;  1R4K A;  2L5C A;  2L5D A;  4NGD A;  4KRE A;  4W5N A;  1VYN A;  3QIR A;  4W5R A;  4NH5 A;  1SI3 A;  4NHA A;  4NH6 A;  4Z4C A;  4Z4G A; 
#chains in the Genus database with same CATH topology
 4NGG A;  3HJF A;  4F3T A;  3U1U A;  4OLA A;  4NGB A;  4NH3 A;  3O6E X;  1T2R A;  4Z4I A;  1R6Z A;  4NGF A;  4Z4E A;  4KRF A;  3HO1 A;  3O7V X;  3F73 A;  5JS2 A;  1Z25 A;  4Z4F A;  5JS1 A;  3HK2 A;  4W5T A;  1T2S A;  3O7X A;  5KI6 A;  3HVR A;  3MJ0 A;  2FFL A;  4Z4H A;  1Z26 A;  4W5Q A;  4OLB A;  3DA5 A;  2DB9 A;  4L1U A;  1SI2 A;  1U04 A;  2XFM A;  4NGC A;  5T7B A;  2QVW A;  3HM9 A;  3DLB A;  3O3I X;  1R4K A;  2L5C A;  4W5O A;  2L5D A;  2BZE A;  4NGD A;  4KRE A;  4W5N A;  1VYN A;  3QIR A;  4W5R A;  4NH5 A;  4L1P A;  1SI3 A;  4NHA A;  4NH6 A;  3DLH A;  4Z4C A;  4Z4G A; 
#chains in the Genus database with same CATH homology
 4NGG A;  3HJF A;  4F3T A;  3U1U A;  4OLA A;  4NGB A;  4NH3 A;  3O6E X;  1T2R A;  4Z4I A;  1R6Z A;  4NGF A;  4Z4E A;  4KRF A;  3HO1 A;  3O7V X;  3F73 A;  5JS2 A;  1Z25 A;  4Z4F A;  5JS1 A;  3HK2 A;  4W5T A;  1T2S A;  3O7X A;  5KI6 A;  3HVR A;  3MJ0 A;  2FFL A;  4Z4H A;  1Z26 A;  4W5Q A;  4OLB A;  3DA5 A;  2DB9 A;  4L1U A;  1SI2 A;  1U04 A;  2XFM A;  4NGC A;  5T7B A;  2QVW A;  3HM9 A;  3DLB A;  3O3I X;  1R4K A;  2L5C A;  4W5O A;  2L5D A;  2BZE A;  4NGD A;  4KRE A;  4W5N A;  1VYN A;  3QIR A;  4W5R A;  4NH5 A;  4L1P A;  1SI3 A;  4NHA A;  4NH6 A;  3DLH A;  4Z4C A;  4Z4G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...