4NHAA

Structure of human dicer platform-paz-connector helix cassette in complex with 16-mer sirna having 5'-p and uu-3' ends (3.4 angstrom resolution)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
294
structure length
234
Chain Sequence
LYVIGMVLTTPLPDELRKLYPPEDTTRCFGILTAKPIPQIPVYTRSGEVTISIELKKSGFMLSLQMLELITRLHQYIFSHILRLSAYCVLPLNVTLDIDFKFMEDIEKSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPKQILVPELCAIHPIPASLWRKAVCLPSILYRLHC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endoribonuclease Dicer
publication title A Phosphate-Binding Pocket within the Platform-PAZ-Connector Helix Cassette of Human Dicer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/rna
total genus 43
structure length 234
sequence length 294
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2013-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02170 PAZ PAZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.260.10 Mainly Beta Beta Complex paz domain paz domain 4nhaA02
4W5OA 2XFMA 3O6EX 4Z4IA 4Z4HA 4Z4FA 2L5CA 4NGBA 5T7BA 5JS2A 1SI2A 4W5TA 4NH5A 1R4KA 4W5NA 2QVWA 4Z4CA 1T2RA 4NGGA 3O3IX 4W5QA 1R6ZA 4F3TA 1VYNA 3O7VX 4NGCA 4KRFA 4KREA 3O7XA 4NGDA 4NH3A 4W5RA 4Z4GA 3MJ0A 2FFLA 4OLBA 1T2SA 4Z4EA 4NHAA 2L5DA 4OLAA 3QIRA 5KI6A 4NGFA 5JS1A 1SI3A 4NH6A
chains in the Genus database with same CATH superfamily
4W5OA 2XFMA 3O6EX 4Z4IA 4Z4HA 4Z4FA 2L5CA 4NGBA 3DLHA 5T7BA 1Z26A 5JS2A 1U04A 1SI2A 4W5TA 4NH5A 1R4KA 4W5NA 3DLBA 3HO1A 2QVWA 4Z4CA 1T2RA 4NGGA 3O3IX 4W5QA 1R6ZA 4F3TA 1VYNA 3O7VX 4NGCA 4KRFA 4KREA 3O7XA 3HM9A 4NGDA 2DB9A 4NH3A 4W5RA 4L1UA 4Z4GA 3HJFA 2FFLA 3MJ0A 4OLBA 1T2SA 3U1UA 4Z4EA 3HK2A 2L5DA 4NHAA 4OLAA 3QIRA 1SI3A 3DA5A 3HVRA 5KI6A 4NGFA 4L1PA 3F73A 5JS1A 1Z25A 4NH6A 2BZEA
chains in the Genus database with same CATH topology
4W5OA 2XFMA 3O6EX 4Z4IA 4Z4HA 4Z4FA 2L5CA 4NGBA 3DLHA 5T7BA 1Z26A 5JS2A 1U04A 1SI2A 4W5TA 4NH5A 1R4KA 4W5NA 3DLBA 3HO1A 2QVWA 4Z4CA 1T2RA 4NGGA 3O3IX 4W5QA 1R6ZA 4F3TA 1VYNA 3O7VX 4NGCA 4KRFA 4KREA 3O7XA 3HM9A 4NGDA 2DB9A 4NH3A 4W5RA 4L1UA 4Z4GA 3HJFA 2FFLA 3MJ0A 4OLBA 1T2SA 3U1UA 4Z4EA 3HK2A 2L5DA 4NHAA 4OLAA 3QIRA 1SI3A 3DA5A 3HVRA 5KI6A 4NGFA 4L1PA 3F73A 5JS1A 1Z25A 4NH6A 2BZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W5O A;  2XFM A;  3O6E X;  4Z4I A;  4Z4H A;  4Z4F A;  2L5C A;  4NGB A;  5T7B A;  5JS2 A;  1SI2 A;  4W5T A;  4NH5 A;  1R4K A;  4W5N A;  2QVW A;  4Z4C A;  1T2R A;  4NGG A;  3O3I X;  4W5Q A;  1R6Z A;  4F3T A;  1VYN A;  3O7V X;  4NGC A;  4KRF A;  4KRE A;  3O7X A;  4NGD A;  4NH3 A;  4W5R A;  4Z4G A;  3MJ0 A;  2FFL A;  4OLB A;  1T2S A;  4Z4E A;  4NHA A;  2L5D A;  4OLA A;  3QIR A;  5KI6 A;  4NGF A;  5JS1 A;  1SI3 A;  4NH6 A; 
#chains in the Genus database with same CATH topology
 4W5O A;  2XFM A;  3O6E X;  4Z4I A;  4Z4H A;  4Z4F A;  2L5C A;  4NGB A;  3DLH A;  5T7B A;  1Z26 A;  5JS2 A;  1U04 A;  1SI2 A;  4W5T A;  4NH5 A;  1R4K A;  4W5N A;  3DLB A;  3HO1 A;  2QVW A;  4Z4C A;  1T2R A;  4NGG A;  3O3I X;  4W5Q A;  1R6Z A;  4F3T A;  1VYN A;  3O7V X;  4NGC A;  4KRF A;  4KRE A;  3O7X A;  3HM9 A;  4NGD A;  2DB9 A;  4NH3 A;  4W5R A;  4L1U A;  4Z4G A;  3HJF A;  2FFL A;  3MJ0 A;  4OLB A;  1T2S A;  3U1U A;  4Z4E A;  3HK2 A;  2L5D A;  4NHA A;  4OLA A;  3QIR A;  1SI3 A;  3DA5 A;  3HVR A;  5KI6 A;  4NGF A;  4L1P A;  3F73 A;  5JS1 A;  1Z25 A;  4NH6 A;  2BZE A; 
#chains in the Genus database with same CATH homology
 4W5O A;  2XFM A;  3O6E X;  4Z4I A;  4Z4H A;  4Z4F A;  2L5C A;  4NGB A;  3DLH A;  5T7B A;  1Z26 A;  5JS2 A;  1U04 A;  1SI2 A;  4W5T A;  4NH5 A;  1R4K A;  4W5N A;  3DLB A;  3HO1 A;  2QVW A;  4Z4C A;  1T2R A;  4NGG A;  3O3I X;  4W5Q A;  1R6Z A;  4F3T A;  1VYN A;  3O7V X;  4NGC A;  4KRF A;  4KRE A;  3O7X A;  3HM9 A;  4NGD A;  2DB9 A;  4NH3 A;  4W5R A;  4L1U A;  4Z4G A;  3HJF A;  2FFL A;  3MJ0 A;  4OLB A;  1T2S A;  3U1U A;  4Z4E A;  3HK2 A;  2L5D A;  4NHA A;  4OLA A;  3QIR A;  1SI3 A;  3DA5 A;  3HVR A;  5KI6 A;  4NGF A;  4L1P A;  3F73 A;  5JS1 A;  1Z25 A;  4NH6 A;  2BZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...